diff --git a/go.mod b/go.mod index ef312d46309fa..b0dc1a42ec84b 100644 --- a/go.mod +++ b/go.mod @@ -37,7 +37,7 @@ require ( github.com/fatih/color v1.18.0 github.com/felixge/fgprof v0.9.5 github.com/fluent/fluent-bit-go v0.0.0-20230731091245-a7a013e2473c - github.com/fsouza/fake-gcs-server v1.50.2 + github.com/fsouza/fake-gcs-server v1.51.0 github.com/go-kit/log v0.2.1 github.com/go-logfmt/logfmt v0.6.0 github.com/gocql/gocql v1.7.0 @@ -154,24 +154,26 @@ require ( ) require ( - cel.dev/expr v0.16.1 // indirect + cel.dev/expr v0.19.1 // indirect cloud.google.com/go/auth v0.13.0 // indirect cloud.google.com/go/auth/oauth2adapt v0.2.6 // indirect - cloud.google.com/go/monitoring v1.21.2 // indirect + cloud.google.com/go/monitoring v1.22.1 // indirect github.com/GoogleCloudPlatform/opentelemetry-operations-go/detectors/gcp v1.25.0 // indirect - github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric v0.48.1 // indirect - github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping v0.48.1 // indirect + github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric v0.49.0 // indirect + github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping v0.49.0 // indirect github.com/andybalholm/brotli v1.1.0 // indirect github.com/aws/aws-sdk-go-v2/service/internal/accept-encoding v1.12.0 // indirect github.com/aws/aws-sdk-go-v2/service/ssooidc v1.28.4 // indirect github.com/dlclark/regexp2 v1.11.4 // indirect github.com/ebitengine/purego v0.8.1 // indirect + github.com/envoyproxy/go-control-plane/envoy v1.32.2 // indirect + github.com/envoyproxy/go-control-plane/ratelimit v0.1.0 // indirect github.com/fxamacker/cbor/v2 v2.7.0 // indirect github.com/gabriel-vasile/mimetype v1.4.4 // indirect github.com/go-ini/ini v1.67.0 // indirect github.com/go-ole/go-ole v1.3.0 // indirect github.com/go-redsync/redsync/v4 v4.13.0 // indirect - github.com/goccy/go-json v0.10.3 // indirect + github.com/goccy/go-json v0.10.4 // indirect github.com/gorilla/handlers v1.5.2 // indirect github.com/hashicorp/golang-lru v1.0.2 // indirect github.com/imdario/mergo v0.3.16 // indirect @@ -195,11 +197,11 @@ require ( github.com/xhit/go-str2duration/v2 v2.1.0 // indirect github.com/yusufpapurcu/wmi v1.2.4 // indirect go.opentelemetry.io/auto/sdk v1.1.0 // indirect - go.opentelemetry.io/contrib/detectors/gcp v1.29.0 // indirect - go.opentelemetry.io/otel/sdk v1.29.0 // indirect - go.opentelemetry.io/otel/sdk/metric v1.29.0 // indirect + go.opentelemetry.io/contrib/detectors/gcp v1.33.0 // indirect + go.opentelemetry.io/otel/sdk v1.33.0 // indirect + go.opentelemetry.io/otel/sdk/metric v1.33.0 // indirect golang.org/x/exp v0.0.0-20240909161429-701f63a606c0 // indirect - google.golang.org/grpc/stats/opentelemetry v0.0.0-20240907200651-3ffb98b2c93a // indirect + google.golang.org/grpc/stats/opentelemetry v0.0.0-20241028142157-ada6787961b3 // indirect ) require ( @@ -242,8 +244,7 @@ require ( github.com/aws/smithy-go v1.22.1 // indirect github.com/bboreham/go-loser v0.0.0-20230920113527-fcc2c21820a3 // indirect github.com/beorn7/perks v1.0.1 // indirect - github.com/census-instrumentation/opencensus-proto v0.4.1 // indirect - github.com/cncf/xds/go v0.0.0-20240905190251-b4127c9b8d78 // indirect + github.com/cncf/xds/go v0.0.0-20241223141626-cff3c89139a3 // indirect github.com/containerd/log v0.1.0 // indirect github.com/coreos/go-semver v0.3.1 // indirect github.com/coreos/go-systemd/v22 v22.5.0 // indirect @@ -262,7 +263,6 @@ require ( github.com/eapache/queue v1.1.0 // indirect github.com/edsrzf/mmap-go v1.1.0 // indirect github.com/emicklei/go-restful/v3 v3.11.0 // indirect - github.com/envoyproxy/go-control-plane v0.13.1 // indirect github.com/envoyproxy/protoc-gen-validate v1.1.0 // indirect github.com/felixge/httpsnoop v1.0.4 // indirect github.com/go-kit/kit v0.12.0 // indirect @@ -316,7 +316,7 @@ require ( github.com/josharian/intern v1.0.0 // indirect github.com/jpillora/backoff v1.0.0 // indirect github.com/julienschmidt/httprouter v1.3.0 // indirect - github.com/klauspost/cpuid/v2 v2.2.8 // indirect + github.com/klauspost/cpuid/v2 v2.2.9 // indirect github.com/kylelemons/godebug v1.1.0 // indirect github.com/leodido/go-urn v1.4.0 // indirect github.com/leodido/ragel-machinery v0.0.0-20190525184631-5f46317e436b // indirect @@ -361,8 +361,8 @@ require ( go.mongodb.org/mongo-driver v1.17.0 // indirect go.opencensus.io v0.24.0 // indirect go.opentelemetry.io/collector/semconv v0.108.1 // indirect - go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.54.0 // indirect - go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.54.0 // indirect + go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.58.0 // indirect + go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.58.0 // indirect go.opentelemetry.io/otel v1.33.0 go.opentelemetry.io/otel/metric v1.33.0 // indirect go.opentelemetry.io/otel/trace v1.33.0 @@ -372,8 +372,8 @@ require ( golang.org/x/term v0.28.0 // indirect golang.org/x/tools v0.26.0 // indirect google.golang.org/genproto v0.0.0-20241118233622-e639e219e697 // indirect - google.golang.org/genproto/googleapis/api v0.0.0-20241118233622-e639e219e697 // indirect - google.golang.org/genproto/googleapis/rpc v0.0.0-20241209162323-e6fa225c2576 + google.golang.org/genproto/googleapis/api v0.0.0-20250102185135-69823020774d // indirect + google.golang.org/genproto/googleapis/rpc v0.0.0-20250102185135-69823020774d gopkg.in/fsnotify/fsnotify.v1 v1.4.7 // indirect gopkg.in/inf.v0 v0.9.1 // indirect gopkg.in/tomb.v1 v1.0.0-20141024135613-dd632973f1e7 // indirect diff --git a/go.sum b/go.sum index 0452a1696821f..c39073d0a4c12 100644 --- a/go.sum +++ b/go.sum @@ -1,5 +1,5 @@ -cel.dev/expr v0.16.1 h1:NR0+oFYzR1CqLFhTAqg3ql59G9VfN8fKq1TCHJ6gq1g= -cel.dev/expr v0.16.1/go.mod h1:AsGA5zb3WruAEQeQng1RZdGEXmBj0jvMWh6l5SnNuC8= +cel.dev/expr v0.19.1 h1:NciYrtDRIR0lNCnH1LFJegdjspNx9fI59O7TWcua/W4= +cel.dev/expr v0.19.1/go.mod h1:MrpN08Q+lEBs+bGYdLxxHkZoUSsCp0nSKTs0nTymJgw= cloud.google.com/go v0.26.0/go.mod h1:aQUYkXzVsufM+DwF1aE+0xfcU+56JwCaLick0ClmMTw= cloud.google.com/go v0.34.0/go.mod h1:aQUYkXzVsufM+DwF1aE+0xfcU+56JwCaLick0ClmMTw= cloud.google.com/go v0.38.0/go.mod h1:990N+gfupTy94rShfmMCWGDn0LpTmnzTp2qbd1dvSRU= @@ -41,8 +41,8 @@ cloud.google.com/go/logging v1.12.0 h1:ex1igYcGFd4S/RZWOCU51StlIEuey5bjqwH9ZYjHi cloud.google.com/go/logging v1.12.0/go.mod h1:wwYBt5HlYP1InnrtYI0wtwttpVU1rifnMT7RejksUAM= cloud.google.com/go/longrunning v0.6.2 h1:xjDfh1pQcWPEvnfjZmwjKQEcHnpz6lHjfy7Fo0MK+hc= cloud.google.com/go/longrunning v0.6.2/go.mod h1:k/vIs83RN4bE3YCswdXC5PFfWVILjm3hpEUlSko4PiI= -cloud.google.com/go/monitoring v1.21.2 h1:FChwVtClH19E7pJ+e0xUhJPGksctZNVOk2UhMmblmdU= -cloud.google.com/go/monitoring v1.21.2/go.mod h1:hS3pXvaG8KgWTSz+dAdyzPrGUYmi2Q+WFX8g2hqVEZU= +cloud.google.com/go/monitoring v1.22.1 h1:KQbnAC4IAH+5x3iWuPZT5iN9VXqKMzzOgqcYB6fqPDE= +cloud.google.com/go/monitoring v1.22.1/go.mod h1:AuZZXAoN0WWWfsSvET1Cpc4/1D8LXq8KRDU87fMS6XY= cloud.google.com/go/pubsub v1.0.1/go.mod h1:R0Gpsv3s54REJCy4fxDixWD93lHJMoZTyQ2kNxGRt3I= cloud.google.com/go/pubsub v1.1.0/go.mod h1:EwwdRX2sKPjnvnqCa270oGRyludottCI76h+R3AArQw= cloud.google.com/go/pubsub v1.2.0/go.mod h1:jhfEVHT8odbXTkndysNHCcx0awwzvfOlguIAii9o8iA= @@ -122,12 +122,12 @@ github.com/DmitriyVTitov/size v1.5.0 h1:/PzqxYrOyOUX1BXj6J9OuVRVGe+66VL4D9FlUaW5 github.com/DmitriyVTitov/size v1.5.0/go.mod h1:le6rNI4CoLQV1b9gzp1+3d7hMAD/uu2QcJ+aYbNgiU0= github.com/GoogleCloudPlatform/opentelemetry-operations-go/detectors/gcp v1.25.0 h1:3c8yed4lgqTt+oTQ+JNMDo+F4xprBf+O/il4ZC0nRLw= github.com/GoogleCloudPlatform/opentelemetry-operations-go/detectors/gcp v1.25.0/go.mod h1:obipzmGjfSjam60XLwGfqUkJsfiheAl+TUjG+4yzyPM= -github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric v0.48.1 h1:UQ0AhxogsIRZDkElkblfnwjc3IaltCm2HUMvezQaL7s= -github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric v0.48.1/go.mod h1:jyqM3eLpJ3IbIFDTKVz2rF9T/xWGW0rIriGwnz8l9Tk= -github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/cloudmock v0.48.1 h1:oTX4vsorBZo/Zdum6OKPA4o7544hm6smoRv1QjpTwGo= -github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/cloudmock v0.48.1/go.mod h1:0wEl7vrAD8mehJyohS9HZy+WyEOaQO2mJx86Cvh93kM= -github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping v0.48.1 h1:8nn+rsCvTq9axyEh382S0PFLBeaFwNsT43IrPWzctRU= -github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping v0.48.1/go.mod h1:viRWSEhtMZqz1rhwmOVKkWl6SwmVowfL9O2YR5gI2PE= +github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric v0.49.0 h1:o90wcURuxekmXrtxmYWTyNla0+ZEHhud6DI1ZTxd1vI= +github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric v0.49.0/go.mod h1:6fTWu4m3jocfUZLYF5KsZC1TUfRvEjs7lM4crme/irw= +github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/cloudmock v0.49.0 h1:jJKWl98inONJAr/IZrdFQUWcwUO95DLY1XMD1ZIut+g= +github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/cloudmock v0.49.0/go.mod h1:l2fIqmwB+FKSfvn3bAD/0i+AXAxhIZjTK2svT/mgUXs= +github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping v0.49.0 h1:GYUJLfvd++4DMuMhCFLgLXvFwofIxh/qOwoGuS/LTew= +github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping v0.49.0/go.mod h1:wRbFgBQUVm1YXrvWKofAEmq9HNJTDphbAaJSSX01KUI= github.com/HdrHistogram/hdrhistogram-go v1.1.2 h1:5IcZpTvzydCQeHzK4Ef/D5rrSqwxob0t8PQPMybUNFM= github.com/HdrHistogram/hdrhistogram-go v1.1.2/go.mod h1:yDgFjdqOqDEKOvasDdhWNXYg9BVp4O+o5f6V/ehm6Oo= github.com/IBM/go-sdk-core/v5 v5.18.3 h1:q6IDU3N2bHGwijK9pMnzKC5gqdaRII56NzB4ZNdSFvY= @@ -256,8 +256,6 @@ github.com/cenkalti/backoff v2.2.1+incompatible/go.mod h1:90ReRw6GdpyfrHakVjL/QH github.com/cenkalti/backoff/v4 v4.3.0 h1:MyRJ/UdXutAwSAT+s3wNd7MfTIcy71VQueUuFK343L8= github.com/cenkalti/backoff/v4 v4.3.0/go.mod h1:Y3VNntkOUPxTVeUxJ/G5vcM//AlwfmyYozVcomhLiZE= github.com/census-instrumentation/opencensus-proto v0.2.1/go.mod h1:f6KPmirojxKA12rnyqOA5BBL4O983OfeGPqjHWSTneU= -github.com/census-instrumentation/opencensus-proto v0.4.1 h1:iKLQ0xPNFxR/2hzXZMrBo8f1j86j5WHzznCCQxV/b8g= -github.com/census-instrumentation/opencensus-proto v0.4.1/go.mod h1:4T9NM4+4Vw91VeyqjLS6ao50K5bOcLKN6Q42XnYaRYw= github.com/cespare/xxhash/v2 v2.1.1/go.mod h1:VGX0DQ3Q6kWi7AoAeZDth3/j3BFtOZR5XLFGgcrjCOs= github.com/cespare/xxhash/v2 v2.3.0 h1:UL815xU9SqsFlibzuggzjXhog7bL6oX9BbNZnL2UFvs= github.com/cespare/xxhash/v2 v2.3.0/go.mod h1:VGX0DQ3Q6kWi7AoAeZDth3/j3BFtOZR5XLFGgcrjCOs= @@ -280,8 +278,8 @@ github.com/clbanning/x2j v0.0.0-20191024224557-825249438eec/go.mod h1:jMjuTZXRI4 github.com/client9/misspell v0.3.4/go.mod h1:qj6jICC3Q7zFZvVWo7KLAzC3yx5G7kyvSDkc90ppPyw= github.com/cncf/udpa/go v0.0.0-20191209042840-269d4d468f6f/go.mod h1:M8M6+tZqaGXZJjfX53e64911xZQV5JYwmTeXPW+k8Sc= github.com/cncf/udpa/go v0.0.0-20201120205902-5459f2c99403/go.mod h1:WmhPx2Nbnhtbo57+VJT5O0JRkEi1Wbu0z5j0R8u5Hbk= -github.com/cncf/xds/go v0.0.0-20240905190251-b4127c9b8d78 h1:QVw89YDxXxEe+l8gU8ETbOasdwEV+avkR75ZzsVV9WI= -github.com/cncf/xds/go v0.0.0-20240905190251-b4127c9b8d78/go.mod h1:W+zGtBO5Y1IgJhy4+A9GOqVhqLpfZi+vwmdNXUehLA8= +github.com/cncf/xds/go v0.0.0-20241223141626-cff3c89139a3 h1:boJj011Hh+874zpIySeApCX4GeOjPl9qhRF3QuIZq+Q= +github.com/cncf/xds/go v0.0.0-20241223141626-cff3c89139a3/go.mod h1:W+zGtBO5Y1IgJhy4+A9GOqVhqLpfZi+vwmdNXUehLA8= github.com/cockroachdb/datadriven v0.0.0-20190809214429-80d97fb3cbaa/go.mod h1:zn76sxSg3SzpJ0PPJaLDCu+Bu0Lg3sKTORVIj19EIF8= github.com/codahale/hdrhistogram v0.0.0-20161010025455-3a0bb77429bd/go.mod h1:sE/e/2PUdi/liOCUjSTXgM1o87ZssimdTWN964YiIeI= github.com/containerd/fifo v1.1.0 h1:4I2mbh5stb1u6ycIABlBw9zgtlK8viPI9QkQNRQEEmY= @@ -370,8 +368,12 @@ github.com/envoyproxy/go-control-plane v0.9.0/go.mod h1:YTl/9mNaCwkRvm6d1a2C3ymF github.com/envoyproxy/go-control-plane v0.9.1-0.20191026205805-5f8ba28d4473/go.mod h1:YTl/9mNaCwkRvm6d1a2C3ymFceY/DCBVvsKhRF0iEA4= github.com/envoyproxy/go-control-plane v0.9.4/go.mod h1:6rpuAdCZL397s3pYoYcLgu1mIlRU8Am5FuJP05cCM98= github.com/envoyproxy/go-control-plane v0.9.9-0.20210217033140-668b12f5399d/go.mod h1:cXg6YxExXjJnVBQHBLXeUAgxn2UodCpnH306RInaBQk= -github.com/envoyproxy/go-control-plane v0.13.1 h1:vPfJZCkob6yTMEgS+0TwfTUfbHjfy/6vOJ8hUWX/uXE= -github.com/envoyproxy/go-control-plane v0.13.1/go.mod h1:X45hY0mufo6Fd0KW3rqsGvQMw58jvjymeCzBU3mWyHw= +github.com/envoyproxy/go-control-plane v0.13.3 h1:F2vYcSF8iRNhfvhZQRZ5Dvuyu0TpXazE9+h53TzkvA4= +github.com/envoyproxy/go-control-plane v0.13.3/go.mod h1:uhvHSBAMSvy2Y+CuAYfByIRH19zcdir1rgmMzKUo3eA= +github.com/envoyproxy/go-control-plane/envoy v1.32.2 h1:zidqwmijfcbyKqVxjQDFx042PgX+p9U+/fu/f9VtSk8= +github.com/envoyproxy/go-control-plane/envoy v1.32.2/go.mod h1:eR2SOX2IedqlPvmiKjUH7Wu//S602JKI7HPC/L3SRq8= +github.com/envoyproxy/go-control-plane/ratelimit v0.1.0 h1:/G9QYbddjL25KvtKTv3an9lx6VBE2cnb8wp1vEGNYGI= +github.com/envoyproxy/go-control-plane/ratelimit v0.1.0/go.mod h1:Wk+tMFAFbCXaJPzVVHnPgRKdUdwW/KdbRt94AzgRee4= github.com/envoyproxy/protoc-gen-validate v0.1.0/go.mod h1:iSmxcyjqTsJpI2R4NaDN7+kN2VEUnK/pcBlmesArF7c= github.com/envoyproxy/protoc-gen-validate v1.1.0 h1:tntQDh69XqOCOZsDz0lVJQez/2L6Uu2PdjCQwWCJ3bM= github.com/envoyproxy/protoc-gen-validate v1.1.0/go.mod h1:sXRDRVmzEbkM7CVcM06s9shE/m23dg3wzjl0UWqJ2q4= @@ -399,8 +401,8 @@ github.com/fsnotify/fsnotify v1.4.7/go.mod h1:jwhsz4b93w/PPRr/qN1Yymfu8t87LnFCMo github.com/fsnotify/fsnotify v1.6.0/go.mod h1:sl3t1tCWJFWoRz9R8WJCbQihKKwmorjAbSClcnxKAGw= github.com/fsnotify/fsnotify v1.8.0 h1:dAwr6QBTBZIkG8roQaJjGof0pp0EeF+tNV7YBP3F/8M= github.com/fsnotify/fsnotify v1.8.0/go.mod h1:8jBTzvmWwFyi3Pb8djgCCO5IBqzKJ/Jwo8TRcHyHii0= -github.com/fsouza/fake-gcs-server v1.50.2 h1:ulrS1pavCOCbMZfN5ZPgBRMFWclON9xDsuLBniXtQoE= -github.com/fsouza/fake-gcs-server v1.50.2/go.mod h1:VU6Zgei4647KuT4XER8WHv5Hcj2NIySndyG8gfvwckA= +github.com/fsouza/fake-gcs-server v1.51.0 h1:RvZJMIKmEKOXE0B4peHGe5QXDVgqDtoHcx1ju+7S8oE= +github.com/fsouza/fake-gcs-server v1.51.0/go.mod h1:EJG62UWFEyQAu5S7fMs0R1UzG0D8n67z/tsXJRdULHM= github.com/fullstorydev/emulators/storage v0.0.0-20240401123056-edc69752f474 h1:TufioMBjkJ6/Oqmlye/ReuxHFS35HyLmypj/BNy/8GY= github.com/fullstorydev/emulators/storage v0.0.0-20240401123056-edc69752f474/go.mod h1:PQwxF4UU8wuL+srGxr3BOhIW5zXqgucwVlO/nPZLsxw= github.com/fxamacker/cbor/v2 v2.7.0 h1:iM5WgngdRBanHcxugY4JySA0nk1wZorNOpTgCMedv5E= @@ -479,8 +481,8 @@ github.com/go-zookeeper/zk v1.0.3/go.mod h1:nOB03cncLtlp4t+UAkGSV+9beXP/akpekBwL github.com/gobwas/httphead v0.1.0/go.mod h1:O/RXo79gxV8G+RqlR/otEwx4Q36zl9rqC5u12GKvMCM= github.com/gobwas/pool v0.2.1/go.mod h1:q8bcK0KcYlCgd9e7WYLm9LpyS+YeLd8JVDW6WezmKEw= github.com/gobwas/ws v1.2.1/go.mod h1:hRKAFb8wOxFROYNsT1bqfWnhX+b5MFeJM9r2ZSwg/KY= -github.com/goccy/go-json v0.10.3 h1:KZ5WoDbxAIgm2HNbYckL0se1fHD6rz5j4ywS6ebzDqA= -github.com/goccy/go-json v0.10.3/go.mod h1:oq7eo15ShAhp70Anwd5lgX2pLfOS3QCiwU/PULtXL6M= +github.com/goccy/go-json v0.10.4 h1:JSwxQzIqKfmFX1swYPpUThQZp/Ka4wzJdK0LWVytLPM= +github.com/goccy/go-json v0.10.4/go.mod h1:oq7eo15ShAhp70Anwd5lgX2pLfOS3QCiwU/PULtXL6M= github.com/godbus/dbus/v5 v5.0.4/go.mod h1:xhWf0FNVPg57R7Z0UbKHbJfkEywrmjJnf7w5xrFpKfA= github.com/gofrs/flock v0.7.1/go.mod h1:F1TvTiK9OcQqauNUHlbJvyl9Qa1QvF/gOUDKA14jxHU= github.com/gofrs/flock v0.8.1 h1:+gYjHKf32LDeiEEFhQaotPbLuUXjY5ZqxKgXy7n59aw= @@ -775,8 +777,8 @@ github.com/kisielk/gotool v1.0.0/go.mod h1:XhKaO+MFFWcvkIS/tQcRk01m1F5IRFswLeQ+o github.com/klauspost/compress v1.17.11 h1:In6xLpyWOi1+C7tXUUWv2ot1QvBjxevKAaI6IXrJmUc= github.com/klauspost/compress v1.17.11/go.mod h1:pMDklpSncoRMuLFrf1W9Ss9KT+0rH90U12bZKk7uwG0= github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= -github.com/klauspost/cpuid/v2 v2.2.8 h1:+StwCXwm9PdpiEkPyzBXIy+M9KUb4ODm0Zarf1kS5BM= -github.com/klauspost/cpuid/v2 v2.2.8/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws= +github.com/klauspost/cpuid/v2 v2.2.9 h1:66ze0taIn2H33fBvCkXuv9BmCwDfafmiIVpKV9kKGuY= +github.com/klauspost/cpuid/v2 v2.2.9/go.mod h1:rqkxqrZ1EhYM9G+hXH7YdowN5R5RGN6NK4QwQ3WMXF8= github.com/klauspost/pgzip v1.2.6 h1:8RXeL5crjEUFnR2/Sn6GJNWtSQ3Dk8pq4CL3jvdDyjU= github.com/klauspost/pgzip v1.2.6/go.mod h1:Ch1tH69qFZu15pkjo5kYi6mth2Zzwzt50oCQKQE9RUs= github.com/kolo/xmlrpc v0.0.0-20220921171641-a4b6fa1dd06b h1:udzkj9S/zlT5X367kqJis0QP7YMxobob6zhzq6Yre00= @@ -1209,12 +1211,12 @@ go.opentelemetry.io/collector/pdata v1.22.0 h1:3yhjL46NLdTMoP8rkkcE9B0pzjf2973cr go.opentelemetry.io/collector/pdata v1.22.0/go.mod h1:nLLf6uDg8Kn5g3WNZwGyu8+kf77SwOqQvMTb5AXEbEY= go.opentelemetry.io/collector/semconv v0.108.1 h1:Txk9tauUnamZaxS5vlf1O0uZ4VD6nioRBR0nX8L/fU4= go.opentelemetry.io/collector/semconv v0.108.1/go.mod h1:zCJ5njhWpejR+A40kiEoeFm1xq1uzyZwMnRNX6/D82A= -go.opentelemetry.io/contrib/detectors/gcp v1.29.0 h1:TiaiXB4DpGD3sdzNlYQxruQngn5Apwzi1X0DRhuGvDQ= -go.opentelemetry.io/contrib/detectors/gcp v1.29.0/go.mod h1:GW2aWZNwR2ZxDLdv8OyC2G8zkRoQBuURgV7RPQgcPoU= -go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.54.0 h1:r6I7RJCN86bpD/FQwedZ0vSixDpwuWREjW9oRMsmqDc= -go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.54.0/go.mod h1:B9yO6b04uB80CzjedvewuqDhxJxi11s7/GtiGa8bAjI= -go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.54.0 h1:TT4fX+nBOA/+LUkobKGW1ydGcn+G3vRw9+g5HwCphpk= -go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.54.0/go.mod h1:L7UH0GbB0p47T4Rri3uHjbpCFYrVrwc1I25QhNPiGK8= +go.opentelemetry.io/contrib/detectors/gcp v1.33.0 h1:FVPoXEoILwgbZUu4X7YSgsESsAmGRgoYcnXkzgQPhP4= +go.opentelemetry.io/contrib/detectors/gcp v1.33.0/go.mod h1:ZHrLmr4ikK2AwRj9QL+c9s2SOlgoSRyMpNVzUj2fZqI= +go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.58.0 h1:PS8wXpbyaDJQ2VDHHncMe9Vct0Zn1fEjpsjrLxGJoSc= +go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.58.0/go.mod h1:HDBUsEjOuRC0EzKZ1bSaRGZWUBAzo+MhAcUUORSr4D0= +go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.58.0 h1:yd02MEjBdJkG3uabWP9apV+OuWRIXGDuJEUJbOHmCFU= +go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.58.0/go.mod h1:umTcuxiv1n/s/S6/c2AT/g2CQ7u5C59sHDNmfSwgz7Q= go.opentelemetry.io/otel v1.33.0 h1:/FerN9bax5LoK51X/sI0SVYrjSE0/yUL7DpxW4K3FWw= go.opentelemetry.io/otel v1.33.0/go.mod h1:SUUkR6csvUQl+yjReHu5uM3EtVV7MBm5FHKRlNx4I8I= go.opentelemetry.io/otel/exporters/otlp/otlptrace v1.29.0 h1:dIIDULZJpgdiHz5tXrTgKIMLkus6jEFa7x5SOKcyR7E= @@ -1225,10 +1227,10 @@ go.opentelemetry.io/otel/exporters/stdout/stdoutmetric v1.29.0 h1:WDdP9acbMYjbKI go.opentelemetry.io/otel/exporters/stdout/stdoutmetric v1.29.0/go.mod h1:BLbf7zbNIONBLPwvFnwNHGj4zge8uTCM/UPIVW1Mq2I= go.opentelemetry.io/otel/metric v1.33.0 h1:r+JOocAyeRVXD8lZpjdQjzMadVZp2M4WmQ+5WtEnklQ= go.opentelemetry.io/otel/metric v1.33.0/go.mod h1:L9+Fyctbp6HFTddIxClbQkjtubW6O9QS3Ann/M82u6M= -go.opentelemetry.io/otel/sdk v1.29.0 h1:vkqKjk7gwhS8VaWb0POZKmIEDimRCMsopNYnriHyryo= -go.opentelemetry.io/otel/sdk v1.29.0/go.mod h1:pM8Dx5WKnvxLCb+8lG1PRNIDxu9g9b9g59Qr7hfAAok= -go.opentelemetry.io/otel/sdk/metric v1.29.0 h1:K2CfmJohnRgvZ9UAj2/FhIf/okdWcNdBwe1m8xFXiSY= -go.opentelemetry.io/otel/sdk/metric v1.29.0/go.mod h1:6zZLdCl2fkauYoZIOn/soQIDSWFmNSRcICarHfuhNJQ= +go.opentelemetry.io/otel/sdk v1.33.0 h1:iax7M131HuAm9QkZotNHEfstof92xM+N8sr3uHXc2IM= +go.opentelemetry.io/otel/sdk v1.33.0/go.mod h1:A1Q5oi7/9XaMlIWzPSxLRWOI8nG3FnzHJNbiENQuihM= +go.opentelemetry.io/otel/sdk/metric v1.33.0 h1:Gs5VK9/WUJhNXZgn8MR6ITatvAmKeIuCtNbsP3JkNqU= +go.opentelemetry.io/otel/sdk/metric v1.33.0/go.mod h1:dL5ykHZmm1B1nVRk9dDjChwDmt81MjVp3gLkQRwKf/Q= go.opentelemetry.io/otel/trace v1.33.0 h1:cCJuF7LRjUFso9LPnEAHJDB2pqzp+hbO8eu1qqW2d/s= go.opentelemetry.io/otel/trace v1.33.0/go.mod h1:uIcdVUZMpTAmz0tI1z04GoVSezK37CbGV4fr1f2nBck= go.opentelemetry.io/proto/otlp v1.3.1 h1:TrMUixzpM0yuc/znrFTP9MMRh8trP93mkCiDVeXrui0= @@ -1611,10 +1613,10 @@ google.golang.org/genproto v0.0.0-20200825200019-8632dd797987/go.mod h1:FWY/as6D google.golang.org/genproto v0.0.0-20210602131652-f16073e35f0c/go.mod h1:UODoCrxHCcBojKKwX1terBiRUaqAsFqJiF615XL43r0= google.golang.org/genproto v0.0.0-20241118233622-e639e219e697 h1:ToEetK57OidYuqD4Q5w+vfEnPvPpuTwedCNVohYJfNk= google.golang.org/genproto v0.0.0-20241118233622-e639e219e697/go.mod h1:JJrvXBWRZaFMxBufik1a4RpFw4HhgVtBBWQeQgUj2cc= -google.golang.org/genproto/googleapis/api v0.0.0-20241118233622-e639e219e697 h1:pgr/4QbFyktUv9CtQ/Fq4gzEE6/Xs7iCXbktaGzLHbQ= -google.golang.org/genproto/googleapis/api v0.0.0-20241118233622-e639e219e697/go.mod h1:+D9ySVjN8nY8YCVjc5O7PZDIdZporIDY3KaGfJunh88= -google.golang.org/genproto/googleapis/rpc v0.0.0-20241209162323-e6fa225c2576 h1:8ZmaLZE4XWrtU3MyClkYqqtl6Oegr3235h7jxsDyqCY= -google.golang.org/genproto/googleapis/rpc v0.0.0-20241209162323-e6fa225c2576/go.mod h1:5uTbfoYQed2U9p3KIj2/Zzm02PYhndfdmML0qC3q3FU= +google.golang.org/genproto/googleapis/api v0.0.0-20250102185135-69823020774d h1:H8tOf8XM88HvKqLTxe755haY6r1fqqzLbEnfrmLXlSA= +google.golang.org/genproto/googleapis/api v0.0.0-20250102185135-69823020774d/go.mod h1:2v7Z7gP2ZUOGsaFyxATQSRoBnKygqVq2Cwnvom7QiqY= +google.golang.org/genproto/googleapis/rpc v0.0.0-20250102185135-69823020774d h1:xJJRGY7TJcvIlpSrN3K6LAWgNFUILlO+OMAqtg9aqnw= +google.golang.org/genproto/googleapis/rpc v0.0.0-20250102185135-69823020774d/go.mod h1:3ENsm/5D1mzDyhpzeRi1NR784I0BcofWBoSc5QqqMK4= google.golang.org/grpc v1.12.0/go.mod h1:yo6s7OP7yaDglbqo1J04qKzAhqBH6lvTonzMVmEdcZw= google.golang.org/grpc v1.17.0/go.mod h1:6QZJwpn2B+Zp71q/5VxRsJ6NXXVCE5NRUHRo+f3cWCs= google.golang.org/grpc v1.19.0/go.mod h1:mqu4LbDTu4XGKhr4mRzUsmM4RtVoemTSY81AxZiDr8c= @@ -1638,8 +1640,8 @@ google.golang.org/grpc v1.33.2/go.mod h1:JMHMWHQWaTccqQQlmk3MJZS+GWXOdAesneDmEnv google.golang.org/grpc v1.38.0/go.mod h1:NREThFqKR1f3iQ6oBuvc5LadQuXVGo9rkm5ZGrQdJfM= google.golang.org/grpc v1.68.1 h1:oI5oTa11+ng8r8XMMN7jAOmWfPZWbYpCFaMUTACxkM0= google.golang.org/grpc v1.68.1/go.mod h1:+q1XYFJjShcqn0QZHvCyeR4CXPA+llXIeUIfIe00waw= -google.golang.org/grpc/stats/opentelemetry v0.0.0-20240907200651-3ffb98b2c93a h1:UIpYSuWdWHSzjwcAFRLjKcPXFZVVLXGEM23W+NWqipw= -google.golang.org/grpc/stats/opentelemetry v0.0.0-20240907200651-3ffb98b2c93a/go.mod h1:9i1T9n4ZinTUZGgzENMi8MDDgbGC5mqTS75JAv6xN3A= +google.golang.org/grpc/stats/opentelemetry v0.0.0-20241028142157-ada6787961b3 h1:hUfOButuEtpc0UvYiaYRbNwxVYr0mQQOWq6X8beJ9Gc= +google.golang.org/grpc/stats/opentelemetry v0.0.0-20241028142157-ada6787961b3/go.mod h1:jzYlkSMbKypzuu6xoAEijsNVo9ZeDF1u/zCfFgsx7jg= google.golang.org/protobuf v0.0.0-20200109180630-ec00e32a8dfd/go.mod h1:DFci5gLYBciE7Vtevhsrf46CRTquxDuWsQurQQe4oz8= google.golang.org/protobuf v0.0.0-20200221191635-4d8936d0db64/go.mod h1:kwYJMbMJ01Woi6D6+Kah6886xMZcty6N08ah7+eCXa0= google.golang.org/protobuf v0.0.0-20200228230310-ab0ca4ff8a60/go.mod h1:cfTl7dwQJ+fmap5saPgwCLgHXTUD7jkjRqWcaiX5VyM= diff --git a/vendor/cel.dev/expr/.bazelversion b/vendor/cel.dev/expr/.bazelversion index 579c9d21e7d79..26bc914a3b009 100644 --- a/vendor/cel.dev/expr/.bazelversion +++ b/vendor/cel.dev/expr/.bazelversion @@ -1,2 +1,2 @@ -6.4.0 +7.0.1 # Keep this pinned version in parity with cel-go diff --git a/vendor/cel.dev/expr/.gitignore b/vendor/cel.dev/expr/.gitignore index ac51a054d2da1..0d4fed27c9f02 100644 --- a/vendor/cel.dev/expr/.gitignore +++ b/vendor/cel.dev/expr/.gitignore @@ -1 +1,2 @@ bazel-* +MODULE.bazel.lock diff --git a/vendor/cel.dev/expr/BUILD.bazel b/vendor/cel.dev/expr/BUILD.bazel index 0bbe9ed7736c4..37d8adc950302 100644 --- a/vendor/cel.dev/expr/BUILD.bazel +++ b/vendor/cel.dev/expr/BUILD.bazel @@ -16,7 +16,7 @@ go_library( importpath = "cel.dev/expr", visibility = ["//visibility:public"], deps = [ - "//proto/cel/expr:google_rpc_status_go_proto", + "@org_golang_google_genproto_googleapis_rpc//status:go_default_library", "@org_golang_google_protobuf//reflect/protoreflect", "@org_golang_google_protobuf//runtime/protoimpl", "@org_golang_google_protobuf//types/known/anypb", diff --git a/vendor/cel.dev/expr/MODULE.bazel b/vendor/cel.dev/expr/MODULE.bazel new file mode 100644 index 0000000000000..9794266f56476 --- /dev/null +++ b/vendor/cel.dev/expr/MODULE.bazel @@ -0,0 +1,70 @@ +module( + name = "cel-spec", +) + +bazel_dep( + name = "bazel_skylib", + version = "1.7.1", +) +bazel_dep( + name = "gazelle", + version = "0.36.0", + repo_name = "bazel_gazelle", +) +bazel_dep( + name = "googleapis", + version = "0.0.0-20240819-fe8ba054a", + repo_name = "com_google_googleapis", +) +bazel_dep( + name = "protobuf", + version = "26.0", + repo_name = "com_google_protobuf", +) +bazel_dep( + name = "rules_cc", + version = "0.0.9", +) +bazel_dep( + name = "rules_go", + version = "0.49.0", + repo_name = "io_bazel_rules_go", +) +bazel_dep( + name = "rules_java", + version = "7.6.5", +) +bazel_dep( + name = "rules_proto", + version = "6.0.0", +) +bazel_dep( + name = "rules_python", + version = "0.35.0", +) + +### PYTHON ### +python = use_extension("@rules_python//python/extensions:python.bzl", "python") +python.toolchain( + ignore_root_user_error = True, + python_version = "3.11", +) + +switched_rules = use_extension("@com_google_googleapis//:extensions.bzl", "switched_rules") +switched_rules.use_languages( + cc = True, + go = True, + java = True, +) +use_repo(switched_rules, "com_google_googleapis_imports") + +go_sdk = use_extension("@io_bazel_rules_go//go:extensions.bzl", "go_sdk") +go_sdk.download(version = "1.21.1") + +go_deps = use_extension("@bazel_gazelle//:extensions.bzl", "go_deps") +go_deps.from_file(go_mod = "//:go.mod") +use_repo( + go_deps, + "org_golang_google_genproto_googleapis_rpc", + "org_golang_google_protobuf", +) diff --git a/vendor/cel.dev/expr/README.md b/vendor/cel.dev/expr/README.md index 2da1e7f2fa24a..7930c0b755cf7 100644 --- a/vendor/cel.dev/expr/README.md +++ b/vendor/cel.dev/expr/README.md @@ -33,8 +33,7 @@ The required components of a system that supports CEL are: * The textual representation of an expression as written by a developer. It is of similar syntax to expressions in C/C++/Java/JavaScript -* A binary representation of an expression. It is an abstract syntax tree - (AST). +* A representation of the program's abstract syntax tree (AST). * A compiler library that converts the textual representation to the binary representation. This can be done ahead of time (in the control plane) or just before evaluation (in the data plane). @@ -43,6 +42,15 @@ The required components of a system that supports CEL are: * An evaluator library that takes the binary format in the context and produces a result, usually a Boolean. +For use cases which require persistence or cross-process communcation, it is +highly recommended to serialize the type-checked expression as a protocol +buffer. The CEL team will maintains canonical protocol buffers for ASTs and +will keep these versions identical and wire-compatible in perpetuity: + +* [CEL canonical](https://github.com/google/cel-spec/tree/master/proto/cel/expr) +* [CEL v1alpha1](https://github.com/googleapis/googleapis/tree/master/google/api/expr/v1alpha1) + + Example of boolean conditions and object construction: ``` c diff --git a/vendor/cel.dev/expr/WORKSPACE b/vendor/cel.dev/expr/WORKSPACE index bb4c469adbbaf..b6dc9ed673042 100644 --- a/vendor/cel.dev/expr/WORKSPACE +++ b/vendor/cel.dev/expr/WORKSPACE @@ -27,13 +27,13 @@ http_archive( ], ) -# googleapis as of 05/26/2023 +# googleapis as of 09/16/2024 http_archive( name = "com_google_googleapis", - strip_prefix = "googleapis-07c27163ac591955d736f3057b1619ece66f5b99", - sha256 = "bd8e735d881fb829751ecb1a77038dda4a8d274c45490cb9fcf004583ee10571", + strip_prefix = "googleapis-4082d5e51e8481f6ccc384cacd896f4e78f19dee", + sha256 = "57319889d47578b3c89bf1b3f34888d796a8913d63b32d750a4cd12ed303c4e8", urls = [ - "https://github.com/googleapis/googleapis/archive/07c27163ac591955d736f3057b1619ece66f5b99.tar.gz", + "https://github.com/googleapis/googleapis/archive/4082d5e51e8481f6ccc384cacd896f4e78f19dee.tar.gz", ], ) @@ -95,22 +95,22 @@ switched_rules_by_language( # Do *not* call *_dependencies(), etc, yet. See comment at the end. # Generated Google APIs protos for Golang -# Generated Google APIs protos for Golang 05/25/2023 +# Generated Google APIs protos for Golang 08/26/2024 go_repository( name = "org_golang_google_genproto_googleapis_api", build_file_proto_mode = "disable_global", importpath = "google.golang.org/genproto/googleapis/api", - sum = "h1:m8v1xLLLzMe1m5P+gCTF8nJB9epwZQUBERm20Oy1poQ=", - version = "v0.0.0-20230525234035-dd9d682886f9", + sum = "h1:YcyjlL1PRr2Q17/I0dPk2JmYS5CDXfcdb2Z3YRioEbw=", + version = "v0.0.0-20240826202546-f6391c0de4c7", ) -# Generated Google APIs protos for Golang 05/25/2023 +# Generated Google APIs protos for Golang 08/26/2024 go_repository( name = "org_golang_google_genproto_googleapis_rpc", build_file_proto_mode = "disable_global", importpath = "google.golang.org/genproto/googleapis/rpc", - sum = "h1:0nDDozoAU19Qb2HwhXadU8OcsiO/09cnTqhUtq2MEOM=", - version = "v0.0.0-20230525234030-28d5490b6b19", + sum = "h1:2035KHhUv+EpyB+hWgJnaWKJOdX1E95w2S8Rr4uWKTs=", + version = "v0.0.0-20240826202546-f6391c0de4c7", ) # gRPC deps diff --git a/vendor/cel.dev/expr/WORKSPACE.bzlmod b/vendor/cel.dev/expr/WORKSPACE.bzlmod new file mode 100644 index 0000000000000..e69de29bb2d1d diff --git a/vendor/cel.dev/expr/cloudbuild.yaml b/vendor/cel.dev/expr/cloudbuild.yaml index 8a8ea3763f6da..c40881f122779 100644 --- a/vendor/cel.dev/expr/cloudbuild.yaml +++ b/vendor/cel.dev/expr/cloudbuild.yaml @@ -1,8 +1,8 @@ steps: -- name: 'gcr.io/cloud-builders/bazel:6.4.0' +- name: 'gcr.io/cloud-builders/bazel:7.0.1' entrypoint: bazel - args: ['test', '--test_output=errors', '...'] - id: bazel-test + args: ['build', '...'] + id: bazel-build waitFor: ['-'] timeout: 15m options: diff --git a/vendor/cel.dev/expr/regen_go_proto.sh b/vendor/cel.dev/expr/regen_go_proto.sh index abf2f9788ea88..fdcbb3ce25675 100644 --- a/vendor/cel.dev/expr/regen_go_proto.sh +++ b/vendor/cel.dev/expr/regen_go_proto.sh @@ -1,9 +1,9 @@ #!/bin/sh -bazel build //proto/test/... -files=($(bazel aquery 'kind(proto, //proto/...)' | grep Outputs | grep "[.]pb[.]go" | sed 's/Outputs: \[//' | sed 's/\]//' | tr "," "\n")) +bazel build //proto/cel/expr/conformance/... +files=($(bazel aquery 'kind(proto, //proto/cel/expr/conformance/...)' | grep Outputs | grep "[.]pb[.]go" | sed 's/Outputs: \[//' | sed 's/\]//' | tr "," "\n")) for src in ${files[@]}; do - dst=$(echo $src | sed 's/\(.*\%\/github.com\/google\/cel-spec\/\(.*\)\)/\2/') + dst=$(echo $src | sed 's/\(.*\/cel.dev\/expr\/\(.*\)\)/\2/') echo "copying $dst" $(cp $src $dst) done diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/alert_policy_client.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/alert_policy_client.go index ae1dd6b9a2331..c099e6fa9b749 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/alert_policy_client.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/alert_policy_client.go @@ -19,6 +19,7 @@ package monitoring import ( "context" "fmt" + "log/slog" "math" "net/url" "time" @@ -217,6 +218,8 @@ type alertPolicyGRPCClient struct { // The x-goog-* metadata to be sent with each request. xGoogHeaders []string + + logger *slog.Logger } // NewAlertPolicyClient creates a new alert policy service client based on gRPC. @@ -251,6 +254,7 @@ func NewAlertPolicyClient(ctx context.Context, opts ...option.ClientOption) (*Al connPool: connPool, alertPolicyClient: monitoringpb.NewAlertPolicyServiceClient(connPool), CallOptions: &client.CallOptions, + logger: internaloption.GetLogger(opts), } c.setGoogleClientInfo() @@ -304,7 +308,7 @@ func (c *alertPolicyGRPCClient) ListAlertPolicies(ctx context.Context, req *moni } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.alertPolicyClient.ListAlertPolicies(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.alertPolicyClient.ListAlertPolicies, req, settings.GRPC, c.logger, "ListAlertPolicies") return err }, opts...) if err != nil { @@ -339,7 +343,7 @@ func (c *alertPolicyGRPCClient) GetAlertPolicy(ctx context.Context, req *monitor var resp *monitoringpb.AlertPolicy err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.alertPolicyClient.GetAlertPolicy(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.alertPolicyClient.GetAlertPolicy, req, settings.GRPC, c.logger, "GetAlertPolicy") return err }, opts...) if err != nil { @@ -357,7 +361,7 @@ func (c *alertPolicyGRPCClient) CreateAlertPolicy(ctx context.Context, req *moni var resp *monitoringpb.AlertPolicy err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.alertPolicyClient.CreateAlertPolicy(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.alertPolicyClient.CreateAlertPolicy, req, settings.GRPC, c.logger, "CreateAlertPolicy") return err }, opts...) if err != nil { @@ -374,7 +378,7 @@ func (c *alertPolicyGRPCClient) DeleteAlertPolicy(ctx context.Context, req *moni opts = append((*c.CallOptions).DeleteAlertPolicy[0:len((*c.CallOptions).DeleteAlertPolicy):len((*c.CallOptions).DeleteAlertPolicy)], opts...) err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - _, err = c.alertPolicyClient.DeleteAlertPolicy(ctx, req, settings.GRPC...) + _, err = executeRPC(ctx, c.alertPolicyClient.DeleteAlertPolicy, req, settings.GRPC, c.logger, "DeleteAlertPolicy") return err }, opts...) return err @@ -389,7 +393,7 @@ func (c *alertPolicyGRPCClient) UpdateAlertPolicy(ctx context.Context, req *moni var resp *monitoringpb.AlertPolicy err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.alertPolicyClient.UpdateAlertPolicy(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.alertPolicyClient.UpdateAlertPolicy, req, settings.GRPC, c.logger, "UpdateAlertPolicy") return err }, opts...) if err != nil { diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/auxiliary.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/auxiliary.go index 4de74e773e1e3..52c29f957e9c1 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/auxiliary.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/auxiliary.go @@ -43,7 +43,7 @@ type AlertPolicyIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoringpb.AlertPolicy, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *AlertPolicyIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -90,7 +90,7 @@ type GroupIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoringpb.Group, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *GroupIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -137,7 +137,7 @@ type MetricDescriptorIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*metricpb.MetricDescriptor, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *MetricDescriptorIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -184,7 +184,7 @@ type MonitoredResourceDescriptorIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoredrespb.MonitoredResourceDescriptor, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *MonitoredResourceDescriptorIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -231,7 +231,7 @@ type MonitoredResourceIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoredrespb.MonitoredResource, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *MonitoredResourceIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -278,7 +278,7 @@ type NotificationChannelDescriptorIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoringpb.NotificationChannelDescriptor, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *NotificationChannelDescriptorIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -325,7 +325,7 @@ type NotificationChannelIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoringpb.NotificationChannel, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *NotificationChannelIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -372,7 +372,7 @@ type ServiceIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoringpb.Service, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *ServiceIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -419,7 +419,7 @@ type ServiceLevelObjectiveIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoringpb.ServiceLevelObjective, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *ServiceLevelObjectiveIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -466,7 +466,7 @@ type SnoozeIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoringpb.Snooze, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *SnoozeIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -513,7 +513,7 @@ type TimeSeriesDataIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoringpb.TimeSeriesData, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *TimeSeriesDataIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -560,7 +560,7 @@ type TimeSeriesIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoringpb.TimeSeries, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *TimeSeriesIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -607,7 +607,7 @@ type UptimeCheckConfigIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoringpb.UptimeCheckConfig, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *UptimeCheckConfigIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } @@ -654,7 +654,7 @@ type UptimeCheckIpIterator struct { InternalFetch func(pageSize int, pageToken string) (results []*monitoringpb.UptimeCheckIp, nextPageToken string, err error) } -// PageInfo supports pagination. See the google.golang.org/api/iterator package for details. +// PageInfo supports pagination. See the [google.golang.org/api/iterator] package for details. func (it *UptimeCheckIpIterator) PageInfo() *iterator.PageInfo { return it.pageInfo } diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/doc.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/doc.go index e8c4036475352..633cd6d97753a 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/doc.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/doc.go @@ -19,6 +19,8 @@ // // Manages your Cloud Monitoring data and configurations. // +// NOTE: This package is in beta. It is not stable, and may be subject to changes. +// // # General documentation // // For information that is relevant for all client libraries please reference @@ -35,6 +37,7 @@ // // To get started with this package, create a client. // +// // go get cloud.google.com/go/monitoring/apiv3/v2@latest // ctx := context.Background() // // This snippet has been automatically generated and should be regarded as a code template only. // // It will require modifications to work: @@ -53,19 +56,7 @@ // // # Using the Client // -// The following is an example of making an API call with the newly created client. -// -// ctx := context.Background() -// // This snippet has been automatically generated and should be regarded as a code template only. -// // It will require modifications to work: -// // - It may require correct/in-range values for request initialization. -// // - It may require specifying regional endpoints when creating the service client as shown in: -// // https://pkg.go.dev/cloud.google.com/go#hdr-Client_Options -// c, err := monitoring.NewAlertPolicyClient(ctx) -// if err != nil { -// // TODO: Handle error. -// } -// defer c.Close() +// The following is an example of making an API call with the newly created client, mentioned above. // // req := &monitoringpb.CreateAlertPolicyRequest{ // // TODO: Fill request struct fields. @@ -92,33 +83,3 @@ // [Debugging Client Libraries]: https://pkg.go.dev/cloud.google.com/go#hdr-Debugging // [Inspecting errors]: https://pkg.go.dev/cloud.google.com/go#hdr-Inspecting_errors package monitoring // import "cloud.google.com/go/monitoring/apiv3/v2" - -import ( - "context" - - "google.golang.org/api/option" -) - -// For more information on implementing a client constructor hook, see -// https://github.com/googleapis/google-cloud-go/wiki/Customizing-constructors. -type clientHookParams struct{} -type clientHook func(context.Context, clientHookParams) ([]option.ClientOption, error) - -var versionClient string - -func getVersionClient() string { - if versionClient == "" { - return "UNKNOWN" - } - return versionClient -} - -// DefaultAuthScopes reports the default set of authentication scopes to use with this package. -func DefaultAuthScopes() []string { - return []string{ - "https://www.googleapis.com/auth/cloud-platform", - "https://www.googleapis.com/auth/monitoring", - "https://www.googleapis.com/auth/monitoring.read", - "https://www.googleapis.com/auth/monitoring.write", - } -} diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/group_client.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/group_client.go index da216081d5a32..e7e51bf789cab 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/group_client.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/group_client.go @@ -19,6 +19,7 @@ package monitoring import ( "context" "fmt" + "log/slog" "math" "net/url" "time" @@ -235,6 +236,8 @@ type groupGRPCClient struct { // The x-goog-* metadata to be sent with each request. xGoogHeaders []string + + logger *slog.Logger } // NewGroupClient creates a new group service client based on gRPC. @@ -272,6 +275,7 @@ func NewGroupClient(ctx context.Context, opts ...option.ClientOption) (*GroupCli connPool: connPool, groupClient: monitoringpb.NewGroupServiceClient(connPool), CallOptions: &client.CallOptions, + logger: internaloption.GetLogger(opts), } c.setGoogleClientInfo() @@ -325,7 +329,7 @@ func (c *groupGRPCClient) ListGroups(ctx context.Context, req *monitoringpb.List } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.groupClient.ListGroups(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.groupClient.ListGroups, req, settings.GRPC, c.logger, "ListGroups") return err }, opts...) if err != nil { @@ -360,7 +364,7 @@ func (c *groupGRPCClient) GetGroup(ctx context.Context, req *monitoringpb.GetGro var resp *monitoringpb.Group err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.groupClient.GetGroup(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.groupClient.GetGroup, req, settings.GRPC, c.logger, "GetGroup") return err }, opts...) if err != nil { @@ -378,7 +382,7 @@ func (c *groupGRPCClient) CreateGroup(ctx context.Context, req *monitoringpb.Cre var resp *monitoringpb.Group err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.groupClient.CreateGroup(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.groupClient.CreateGroup, req, settings.GRPC, c.logger, "CreateGroup") return err }, opts...) if err != nil { @@ -396,7 +400,7 @@ func (c *groupGRPCClient) UpdateGroup(ctx context.Context, req *monitoringpb.Upd var resp *monitoringpb.Group err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.groupClient.UpdateGroup(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.groupClient.UpdateGroup, req, settings.GRPC, c.logger, "UpdateGroup") return err }, opts...) if err != nil { @@ -413,7 +417,7 @@ func (c *groupGRPCClient) DeleteGroup(ctx context.Context, req *monitoringpb.Del opts = append((*c.CallOptions).DeleteGroup[0:len((*c.CallOptions).DeleteGroup):len((*c.CallOptions).DeleteGroup)], opts...) err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - _, err = c.groupClient.DeleteGroup(ctx, req, settings.GRPC...) + _, err = executeRPC(ctx, c.groupClient.DeleteGroup, req, settings.GRPC, c.logger, "DeleteGroup") return err }, opts...) return err @@ -439,7 +443,7 @@ func (c *groupGRPCClient) ListGroupMembers(ctx context.Context, req *monitoringp } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.groupClient.ListGroupMembers(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.groupClient.ListGroupMembers, req, settings.GRPC, c.logger, "ListGroupMembers") return err }, opts...) if err != nil { diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/helpers.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/helpers.go new file mode 100644 index 0000000000000..7eb0121796c07 --- /dev/null +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/helpers.go @@ -0,0 +1,64 @@ +// Copyright 2024 Google LLC +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// https://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +// Code generated by protoc-gen-go_gapic. DO NOT EDIT. + +package monitoring + +import ( + "context" + "log/slog" + + "github.com/googleapis/gax-go/v2/internallog/grpclog" + "google.golang.org/api/option" + "google.golang.org/grpc" + "google.golang.org/protobuf/proto" +) + +const serviceName = "monitoring.googleapis.com" + +// For more information on implementing a client constructor hook, see +// https://github.com/googleapis/google-cloud-go/wiki/Customizing-constructors. +type clientHookParams struct{} +type clientHook func(context.Context, clientHookParams) ([]option.ClientOption, error) + +var versionClient string + +func getVersionClient() string { + if versionClient == "" { + return "UNKNOWN" + } + return versionClient +} + +// DefaultAuthScopes reports the default set of authentication scopes to use with this package. +func DefaultAuthScopes() []string { + return []string{ + "https://www.googleapis.com/auth/cloud-platform", + "https://www.googleapis.com/auth/monitoring", + "https://www.googleapis.com/auth/monitoring.read", + "https://www.googleapis.com/auth/monitoring.write", + } +} + +func executeRPC[I proto.Message, O proto.Message](ctx context.Context, fn func(context.Context, I, ...grpc.CallOption) (O, error), req I, opts []grpc.CallOption, logger *slog.Logger, rpc string) (O, error) { + var zero O + logger.DebugContext(ctx, "api request", "serviceName", serviceName, "rpcName", rpc, "request", grpclog.ProtoMessageRequest(ctx, req)) + resp, err := fn(ctx, req, opts...) + if err != nil { + return zero, err + } + logger.DebugContext(ctx, "api response", "serviceName", serviceName, "rpcName", rpc, "response", grpclog.ProtoMessageResponse(resp)) + return resp, err +} diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/metric_client.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/metric_client.go index d43d261d185ae..f5d405050c538 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/metric_client.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/metric_client.go @@ -19,6 +19,7 @@ package monitoring import ( "context" "fmt" + "log/slog" "math" "net/url" "time" @@ -283,6 +284,8 @@ type metricGRPCClient struct { // The x-goog-* metadata to be sent with each request. xGoogHeaders []string + + logger *slog.Logger } // NewMetricClient creates a new metric service client based on gRPC. @@ -310,6 +313,7 @@ func NewMetricClient(ctx context.Context, opts ...option.ClientOption) (*MetricC connPool: connPool, metricClient: monitoringpb.NewMetricServiceClient(connPool), CallOptions: &client.CallOptions, + logger: internaloption.GetLogger(opts), } c.setGoogleClientInfo() @@ -363,7 +367,7 @@ func (c *metricGRPCClient) ListMonitoredResourceDescriptors(ctx context.Context, } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.metricClient.ListMonitoredResourceDescriptors(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.metricClient.ListMonitoredResourceDescriptors, req, settings.GRPC, c.logger, "ListMonitoredResourceDescriptors") return err }, opts...) if err != nil { @@ -398,7 +402,7 @@ func (c *metricGRPCClient) GetMonitoredResourceDescriptor(ctx context.Context, r var resp *monitoredrespb.MonitoredResourceDescriptor err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.metricClient.GetMonitoredResourceDescriptor(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.metricClient.GetMonitoredResourceDescriptor, req, settings.GRPC, c.logger, "GetMonitoredResourceDescriptor") return err }, opts...) if err != nil { @@ -427,7 +431,7 @@ func (c *metricGRPCClient) ListMetricDescriptors(ctx context.Context, req *monit } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.metricClient.ListMetricDescriptors(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.metricClient.ListMetricDescriptors, req, settings.GRPC, c.logger, "ListMetricDescriptors") return err }, opts...) if err != nil { @@ -462,7 +466,7 @@ func (c *metricGRPCClient) GetMetricDescriptor(ctx context.Context, req *monitor var resp *metricpb.MetricDescriptor err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.metricClient.GetMetricDescriptor(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.metricClient.GetMetricDescriptor, req, settings.GRPC, c.logger, "GetMetricDescriptor") return err }, opts...) if err != nil { @@ -480,7 +484,7 @@ func (c *metricGRPCClient) CreateMetricDescriptor(ctx context.Context, req *moni var resp *metricpb.MetricDescriptor err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.metricClient.CreateMetricDescriptor(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.metricClient.CreateMetricDescriptor, req, settings.GRPC, c.logger, "CreateMetricDescriptor") return err }, opts...) if err != nil { @@ -497,7 +501,7 @@ func (c *metricGRPCClient) DeleteMetricDescriptor(ctx context.Context, req *moni opts = append((*c.CallOptions).DeleteMetricDescriptor[0:len((*c.CallOptions).DeleteMetricDescriptor):len((*c.CallOptions).DeleteMetricDescriptor)], opts...) err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - _, err = c.metricClient.DeleteMetricDescriptor(ctx, req, settings.GRPC...) + _, err = executeRPC(ctx, c.metricClient.DeleteMetricDescriptor, req, settings.GRPC, c.logger, "DeleteMetricDescriptor") return err }, opts...) return err @@ -523,7 +527,7 @@ func (c *metricGRPCClient) ListTimeSeries(ctx context.Context, req *monitoringpb } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.metricClient.ListTimeSeries(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.metricClient.ListTimeSeries, req, settings.GRPC, c.logger, "ListTimeSeries") return err }, opts...) if err != nil { @@ -557,7 +561,7 @@ func (c *metricGRPCClient) CreateTimeSeries(ctx context.Context, req *monitoring opts = append((*c.CallOptions).CreateTimeSeries[0:len((*c.CallOptions).CreateTimeSeries):len((*c.CallOptions).CreateTimeSeries)], opts...) err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - _, err = c.metricClient.CreateTimeSeries(ctx, req, settings.GRPC...) + _, err = executeRPC(ctx, c.metricClient.CreateTimeSeries, req, settings.GRPC, c.logger, "CreateTimeSeries") return err }, opts...) return err @@ -571,7 +575,7 @@ func (c *metricGRPCClient) CreateServiceTimeSeries(ctx context.Context, req *mon opts = append((*c.CallOptions).CreateServiceTimeSeries[0:len((*c.CallOptions).CreateServiceTimeSeries):len((*c.CallOptions).CreateServiceTimeSeries)], opts...) err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - _, err = c.metricClient.CreateServiceTimeSeries(ctx, req, settings.GRPC...) + _, err = executeRPC(ctx, c.metricClient.CreateServiceTimeSeries, req, settings.GRPC, c.logger, "CreateServiceTimeSeries") return err }, opts...) return err diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/alert.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/alert.pb.go index e7b3595fa6414..222e1d170a1a9 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/alert.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/alert.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/alert.proto @@ -26,6 +26,7 @@ import ( _ "google.golang.org/genproto/googleapis/api/annotations" status "google.golang.org/genproto/googleapis/rpc/status" + timeofday "google.golang.org/genproto/googleapis/type/timeofday" protoreflect "google.golang.org/protobuf/reflect/protoreflect" protoimpl "google.golang.org/protobuf/runtime/protoimpl" durationpb "google.golang.org/protobuf/types/known/durationpb" @@ -102,7 +103,7 @@ func (AlertPolicy_ConditionCombinerType) EnumDescriptor() ([]byte, []int) { return file_google_monitoring_v3_alert_proto_rawDescGZIP(), []int{0, 0} } -// An enumeration of possible severity level for an Alert Policy. +// An enumeration of possible severity level for an alerting policy. type AlertPolicy_Severity int32 const ( @@ -225,17 +226,70 @@ func (AlertPolicy_Condition_EvaluationMissingData) EnumDescriptor() ([]byte, []i return file_google_monitoring_v3_alert_proto_rawDescGZIP(), []int{0, 1, 0} } +// Control when notifications will be sent out. +type AlertPolicy_AlertStrategy_NotificationPrompt int32 + +const ( + // No strategy specified. Treated as error. + AlertPolicy_AlertStrategy_NOTIFICATION_PROMPT_UNSPECIFIED AlertPolicy_AlertStrategy_NotificationPrompt = 0 + // Notify when an incident is opened. + AlertPolicy_AlertStrategy_OPENED AlertPolicy_AlertStrategy_NotificationPrompt = 1 + // Notify when an incident is closed. + AlertPolicy_AlertStrategy_CLOSED AlertPolicy_AlertStrategy_NotificationPrompt = 3 +) + +// Enum value maps for AlertPolicy_AlertStrategy_NotificationPrompt. +var ( + AlertPolicy_AlertStrategy_NotificationPrompt_name = map[int32]string{ + 0: "NOTIFICATION_PROMPT_UNSPECIFIED", + 1: "OPENED", + 3: "CLOSED", + } + AlertPolicy_AlertStrategy_NotificationPrompt_value = map[string]int32{ + "NOTIFICATION_PROMPT_UNSPECIFIED": 0, + "OPENED": 1, + "CLOSED": 3, + } +) + +func (x AlertPolicy_AlertStrategy_NotificationPrompt) Enum() *AlertPolicy_AlertStrategy_NotificationPrompt { + p := new(AlertPolicy_AlertStrategy_NotificationPrompt) + *p = x + return p +} + +func (x AlertPolicy_AlertStrategy_NotificationPrompt) String() string { + return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) +} + +func (AlertPolicy_AlertStrategy_NotificationPrompt) Descriptor() protoreflect.EnumDescriptor { + return file_google_monitoring_v3_alert_proto_enumTypes[3].Descriptor() +} + +func (AlertPolicy_AlertStrategy_NotificationPrompt) Type() protoreflect.EnumType { + return &file_google_monitoring_v3_alert_proto_enumTypes[3] +} + +func (x AlertPolicy_AlertStrategy_NotificationPrompt) Number() protoreflect.EnumNumber { + return protoreflect.EnumNumber(x) +} + +// Deprecated: Use AlertPolicy_AlertStrategy_NotificationPrompt.Descriptor instead. +func (AlertPolicy_AlertStrategy_NotificationPrompt) EnumDescriptor() ([]byte, []int) { + return file_google_monitoring_v3_alert_proto_rawDescGZIP(), []int{0, 2, 0} +} + // A description of the conditions under which some aspect of your system is // considered to be "unhealthy" and the ways to notify people or services about -// this state. For an overview of alert policies, see +// this state. For an overview of alerting policies, see // [Introduction to Alerting](https://cloud.google.com/monitoring/alerts/). type AlertPolicy struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache unknownFields protoimpl.UnknownFields - // Required if the policy exists. The resource name for this policy. The - // format is: + // Identifier. Required if the policy exists. The resource name for this + // policy. The format is: // // projects/[PROJECT_ID_OR_NUMBER]/alertPolicies/[ALERT_POLICY_ID] // @@ -297,9 +351,9 @@ type AlertPolicy struct { // field should always be populated on List and Get operations, unless // a field projection has been specified that strips it out. Enabled *wrapperspb.BoolValue `protobuf:"bytes,17,opt,name=enabled,proto3" json:"enabled,omitempty"` - // Read-only description of how the alert policy is invalid. This field is - // only set when the alert policy is invalid. An invalid alert policy will not - // generate incidents. + // Read-only description of how the alerting policy is invalid. This field is + // only set when the alerting policy is invalid. An invalid alerting policy + // will not generate incidents. Validity *status.Status `protobuf:"bytes,18,opt,name=validity,proto3" json:"validity,omitempty"` // Identifies the notification channels to which notifications should be sent // when incidents are opened or closed or when new violations occur on @@ -318,21 +372,19 @@ type AlertPolicy struct { // A read-only record of the most recent change to the alerting policy. If // provided in a call to create or update, this field will be ignored. MutationRecord *MutationRecord `protobuf:"bytes,11,opt,name=mutation_record,json=mutationRecord,proto3" json:"mutation_record,omitempty"` - // Control over how this alert policy's notification channels are notified. + // Control over how this alerting policy's notification channels are notified. AlertStrategy *AlertPolicy_AlertStrategy `protobuf:"bytes,21,opt,name=alert_strategy,json=alertStrategy,proto3" json:"alert_strategy,omitempty"` - // Optional. The severity of an alert policy indicates how important incidents - // generated by that policy are. The severity level will be displayed on the - // Incident detail page and in notifications. + // Optional. The severity of an alerting policy indicates how important + // incidents generated by that policy are. The severity level will be + // displayed on the Incident detail page and in notifications. Severity AlertPolicy_Severity `protobuf:"varint,22,opt,name=severity,proto3,enum=google.monitoring.v3.AlertPolicy_Severity" json:"severity,omitempty"` } func (x *AlertPolicy) Reset() { *x = AlertPolicy{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy) String() string { @@ -343,7 +395,7 @@ func (*AlertPolicy) ProtoMessage() {} func (x *AlertPolicy) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -460,7 +512,7 @@ type AlertPolicy_Documentation struct { // The content may not exceed 8,192 Unicode characters and may not exceed // more than 10,240 bytes when encoded in UTF-8 format, whichever is // smaller. This text can be [templatized by using - // variables](https://cloud.google.com/monitoring/alerts/doc-variables). + // variables](https://cloud.google.com/monitoring/alerts/doc-variables#doc-vars). Content string `protobuf:"bytes,1,opt,name=content,proto3" json:"content,omitempty"` // The format of the `content` field. Presently, only the value // `"text/markdown"` is supported. See @@ -476,7 +528,7 @@ type AlertPolicy_Documentation struct { // it is common to define textual fields in databases as VARCHAR(255). // // The contents of the subject line can be [templatized by using - // variables](https://cloud.google.com/monitoring/alerts/doc-variables). + // variables](https://cloud.google.com/monitoring/alerts/doc-variables#doc-vars). // If this field is missing or empty, a default subject line will be // generated. Subject string `protobuf:"bytes,3,opt,name=subject,proto3" json:"subject,omitempty"` @@ -487,11 +539,9 @@ type AlertPolicy_Documentation struct { func (x *AlertPolicy_Documentation) Reset() { *x = AlertPolicy_Documentation{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_Documentation) String() string { @@ -502,7 +552,7 @@ func (*AlertPolicy_Documentation) ProtoMessage() {} func (x *AlertPolicy_Documentation) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -592,16 +642,15 @@ type AlertPolicy_Condition struct { // *AlertPolicy_Condition_ConditionMatchedLog // *AlertPolicy_Condition_ConditionMonitoringQueryLanguage // *AlertPolicy_Condition_ConditionPrometheusQueryLanguage + // *AlertPolicy_Condition_ConditionSql Condition isAlertPolicy_Condition_Condition `protobuf_oneof:"condition"` } func (x *AlertPolicy_Condition) Reset() { *x = AlertPolicy_Condition{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_Condition) String() string { @@ -612,7 +661,7 @@ func (*AlertPolicy_Condition) ProtoMessage() {} func (x *AlertPolicy_Condition) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -683,6 +732,13 @@ func (x *AlertPolicy_Condition) GetConditionPrometheusQueryLanguage() *AlertPoli return nil } +func (x *AlertPolicy_Condition) GetConditionSql() *AlertPolicy_Condition_SqlCondition { + if x, ok := x.GetCondition().(*AlertPolicy_Condition_ConditionSql); ok { + return x.ConditionSql + } + return nil +} + type isAlertPolicy_Condition_Condition interface { isAlertPolicy_Condition_Condition() } @@ -715,6 +771,11 @@ type AlertPolicy_Condition_ConditionPrometheusQueryLanguage struct { ConditionPrometheusQueryLanguage *AlertPolicy_Condition_PrometheusQueryLanguageCondition `protobuf:"bytes,21,opt,name=condition_prometheus_query_language,json=conditionPrometheusQueryLanguage,proto3,oneof"` } +type AlertPolicy_Condition_ConditionSql struct { + // A condition that periodically evaluates a SQL query result. + ConditionSql *AlertPolicy_Condition_SqlCondition `protobuf:"bytes,22,opt,name=condition_sql,json=conditionSql,proto3,oneof"` +} + func (*AlertPolicy_Condition_ConditionThreshold) isAlertPolicy_Condition_Condition() {} func (*AlertPolicy_Condition_ConditionAbsent) isAlertPolicy_Condition_Condition() {} @@ -725,6 +786,8 @@ func (*AlertPolicy_Condition_ConditionMonitoringQueryLanguage) isAlertPolicy_Con func (*AlertPolicy_Condition_ConditionPrometheusQueryLanguage) isAlertPolicy_Condition_Condition() {} +func (*AlertPolicy_Condition_ConditionSql) isAlertPolicy_Condition_Condition() {} + // Control over how the notification channels in `notification_channels` // are notified when this alert fires. type AlertPolicy_AlertStrategy struct { @@ -732,11 +795,17 @@ type AlertPolicy_AlertStrategy struct { sizeCache protoimpl.SizeCache unknownFields protoimpl.UnknownFields - // Required for alert policies with a `LogMatch` condition. + // Required for log-based alerting policies, i.e. policies with a `LogMatch` + // condition. // - // This limit is not implemented for alert policies that are not log-based. + // This limit is not implemented for alerting policies that do not have + // a LogMatch condition. NotificationRateLimit *AlertPolicy_AlertStrategy_NotificationRateLimit `protobuf:"bytes,1,opt,name=notification_rate_limit,json=notificationRateLimit,proto3" json:"notification_rate_limit,omitempty"` - // If an alert policy that was active has no data for this long, any open + // For log-based alert policies, the notification prompts is always + // [OPENED]. For non log-based alert policies, the notification prompts can + // be [OPENED] or [OPENED, CLOSED]. + NotificationPrompts []AlertPolicy_AlertStrategy_NotificationPrompt `protobuf:"varint,2,rep,packed,name=notification_prompts,json=notificationPrompts,proto3,enum=google.monitoring.v3.AlertPolicy_AlertStrategy_NotificationPrompt" json:"notification_prompts,omitempty"` + // If an alerting policy that was active has no data for this long, any open // incidents will close AutoClose *durationpb.Duration `protobuf:"bytes,3,opt,name=auto_close,json=autoClose,proto3" json:"auto_close,omitempty"` // Control how notifications will be sent out, on a per-channel basis. @@ -745,11 +814,9 @@ type AlertPolicy_AlertStrategy struct { func (x *AlertPolicy_AlertStrategy) Reset() { *x = AlertPolicy_AlertStrategy{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[3] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_AlertStrategy) String() string { @@ -760,7 +827,7 @@ func (*AlertPolicy_AlertStrategy) ProtoMessage() {} func (x *AlertPolicy_AlertStrategy) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -782,6 +849,13 @@ func (x *AlertPolicy_AlertStrategy) GetNotificationRateLimit() *AlertPolicy_Aler return nil } +func (x *AlertPolicy_AlertStrategy) GetNotificationPrompts() []AlertPolicy_AlertStrategy_NotificationPrompt { + if x != nil { + return x.NotificationPrompts + } + return nil +} + func (x *AlertPolicy_AlertStrategy) GetAutoClose() *durationpb.Duration { if x != nil { return x.AutoClose @@ -815,11 +889,9 @@ type AlertPolicy_Documentation_Link struct { func (x *AlertPolicy_Documentation_Link) Reset() { *x = AlertPolicy_Documentation_Link{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[5] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[5] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_Documentation_Link) String() string { @@ -830,7 +902,7 @@ func (*AlertPolicy_Documentation_Link) ProtoMessage() {} func (x *AlertPolicy_Documentation_Link) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_proto_msgTypes[5] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -877,11 +949,9 @@ type AlertPolicy_Condition_Trigger struct { func (x *AlertPolicy_Condition_Trigger) Reset() { *x = AlertPolicy_Condition_Trigger{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[6] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[6] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_Condition_Trigger) String() string { @@ -892,7 +962,7 @@ func (*AlertPolicy_Condition_Trigger) ProtoMessage() {} func (x *AlertPolicy_Condition_Trigger) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_proto_msgTypes[6] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1041,11 +1111,9 @@ type AlertPolicy_Condition_MetricThreshold struct { func (x *AlertPolicy_Condition_MetricThreshold) Reset() { *x = AlertPolicy_Condition_MetricThreshold{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[7] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[7] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_Condition_MetricThreshold) String() string { @@ -1056,7 +1124,7 @@ func (*AlertPolicy_Condition_MetricThreshold) ProtoMessage() {} func (x *AlertPolicy_Condition_MetricThreshold) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_proto_msgTypes[7] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1192,11 +1260,9 @@ type AlertPolicy_Condition_MetricAbsence struct { func (x *AlertPolicy_Condition_MetricAbsence) Reset() { *x = AlertPolicy_Condition_MetricAbsence{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[8] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[8] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_Condition_MetricAbsence) String() string { @@ -1207,7 +1273,7 @@ func (*AlertPolicy_Condition_MetricAbsence) ProtoMessage() {} func (x *AlertPolicy_Condition_MetricAbsence) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_proto_msgTypes[8] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1279,11 +1345,9 @@ type AlertPolicy_Condition_LogMatch struct { func (x *AlertPolicy_Condition_LogMatch) Reset() { *x = AlertPolicy_Condition_LogMatch{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[9] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[9] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_Condition_LogMatch) String() string { @@ -1294,7 +1358,7 @@ func (*AlertPolicy_Condition_LogMatch) ProtoMessage() {} func (x *AlertPolicy_Condition_LogMatch) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_proto_msgTypes[9] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1323,7 +1387,7 @@ func (x *AlertPolicy_Condition_LogMatch) GetLabelExtractors() map[string]string return nil } -// A condition type that allows alert policies to be defined using +// A condition type that allows alerting policies to be defined using // [Monitoring Query Language](https://cloud.google.com/monitoring/mql). type AlertPolicy_Condition_MonitoringQueryLanguageCondition struct { state protoimpl.MessageState @@ -1358,11 +1422,9 @@ type AlertPolicy_Condition_MonitoringQueryLanguageCondition struct { func (x *AlertPolicy_Condition_MonitoringQueryLanguageCondition) Reset() { *x = AlertPolicy_Condition_MonitoringQueryLanguageCondition{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[10] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[10] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_Condition_MonitoringQueryLanguageCondition) String() string { @@ -1373,7 +1435,7 @@ func (*AlertPolicy_Condition_MonitoringQueryLanguageCondition) ProtoMessage() {} func (x *AlertPolicy_Condition_MonitoringQueryLanguageCondition) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_proto_msgTypes[10] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1416,7 +1478,7 @@ func (x *AlertPolicy_Condition_MonitoringQueryLanguageCondition) GetEvaluationMi return AlertPolicy_Condition_EVALUATION_MISSING_DATA_UNSPECIFIED } -// A condition type that allows alert policies to be defined using +// A condition type that allows alerting policies to be defined using // [Prometheus Query Language // (PromQL)](https://prometheus.io/docs/prometheus/latest/querying/basics/). // @@ -1474,7 +1536,7 @@ type AlertPolicy_Condition_PrometheusQueryLanguageCondition struct { // Label names [must be // valid](https://prometheus.io/docs/concepts/data_model/#metric-names-and-labels). // Label values can be [templatized by using - // variables](https://cloud.google.com/monitoring/alerts/doc-variables). + // variables](https://cloud.google.com/monitoring/alerts/doc-variables#doc-vars). // The only available variable names are the names of the labels in the // PromQL result, including "__name__" and "value". "labels" may be empty. Labels map[string]string `protobuf:"bytes,4,rep,name=labels,proto3" json:"labels,omitempty" protobuf_key:"bytes,1,opt,name=key,proto3" protobuf_val:"bytes,2,opt,name=value,proto3"` @@ -1505,15 +1567,23 @@ type AlertPolicy_Condition_PrometheusQueryLanguageCondition struct { // name](https://prometheus.io/docs/concepts/data_model/#metric-names-and-labels). // This field may not exceed 2048 Unicode characters in length. AlertRule string `protobuf:"bytes,6,opt,name=alert_rule,json=alertRule,proto3" json:"alert_rule,omitempty"` + // Optional. Whether to disable metric existence validation for this + // condition. + // + // This allows alerting policies to be defined on metrics that do not yet + // exist, improving advanced customer workflows such as configuring + // alerting policies using Terraform. + // + // Users with the `monitoring.alertPolicyViewer` role are able to see the + // name of the non-existent metric in the alerting policy condition. + DisableMetricValidation bool `protobuf:"varint,7,opt,name=disable_metric_validation,json=disableMetricValidation,proto3" json:"disable_metric_validation,omitempty"` } func (x *AlertPolicy_Condition_PrometheusQueryLanguageCondition) Reset() { *x = AlertPolicy_Condition_PrometheusQueryLanguageCondition{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[11] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[11] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_Condition_PrometheusQueryLanguageCondition) String() string { @@ -1524,7 +1594,7 @@ func (*AlertPolicy_Condition_PrometheusQueryLanguageCondition) ProtoMessage() {} func (x *AlertPolicy_Condition_PrometheusQueryLanguageCondition) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_proto_msgTypes[11] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1581,6 +1651,185 @@ func (x *AlertPolicy_Condition_PrometheusQueryLanguageCondition) GetAlertRule() return "" } +func (x *AlertPolicy_Condition_PrometheusQueryLanguageCondition) GetDisableMetricValidation() bool { + if x != nil { + return x.DisableMetricValidation + } + return false +} + +// A condition that allows alerting policies to be defined using GoogleSQL. +// SQL conditions examine a sliding window of logs using GoogleSQL. +// Alert policies with SQL conditions may incur additional billing. +type AlertPolicy_Condition_SqlCondition struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Required. The Log Analytics SQL query to run, as a string. The query + // must conform to the required shape. Specifically, the query must not + // try to filter the input by time. A filter will automatically be + // applied to filter the input so that the query receives all rows + // received since the last time the query was run. + // + // For example, the following query extracts all log entries containing an + // HTTP request: + // + // SELECT + // timestamp, log_name, severity, http_request, resource, labels + // FROM + // my-project.global._Default._AllLogs + // WHERE + // http_request IS NOT NULL + Query string `protobuf:"bytes,1,opt,name=query,proto3" json:"query,omitempty"` + // The schedule indicates how often the query should be run. + // + // Types that are assignable to Schedule: + // + // *AlertPolicy_Condition_SqlCondition_Minutes_ + // *AlertPolicy_Condition_SqlCondition_Hourly_ + // *AlertPolicy_Condition_SqlCondition_Daily_ + Schedule isAlertPolicy_Condition_SqlCondition_Schedule `protobuf_oneof:"schedule"` + // The test to be run against the SQL result set. + // + // Types that are assignable to Evaluate: + // + // *AlertPolicy_Condition_SqlCondition_RowCountTest_ + // *AlertPolicy_Condition_SqlCondition_BooleanTest_ + Evaluate isAlertPolicy_Condition_SqlCondition_Evaluate `protobuf_oneof:"evaluate"` +} + +func (x *AlertPolicy_Condition_SqlCondition) Reset() { + *x = AlertPolicy_Condition_SqlCondition{} + mi := &file_google_monitoring_v3_alert_proto_msgTypes[12] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *AlertPolicy_Condition_SqlCondition) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*AlertPolicy_Condition_SqlCondition) ProtoMessage() {} + +func (x *AlertPolicy_Condition_SqlCondition) ProtoReflect() protoreflect.Message { + mi := &file_google_monitoring_v3_alert_proto_msgTypes[12] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use AlertPolicy_Condition_SqlCondition.ProtoReflect.Descriptor instead. +func (*AlertPolicy_Condition_SqlCondition) Descriptor() ([]byte, []int) { + return file_google_monitoring_v3_alert_proto_rawDescGZIP(), []int{0, 1, 6} +} + +func (x *AlertPolicy_Condition_SqlCondition) GetQuery() string { + if x != nil { + return x.Query + } + return "" +} + +func (m *AlertPolicy_Condition_SqlCondition) GetSchedule() isAlertPolicy_Condition_SqlCondition_Schedule { + if m != nil { + return m.Schedule + } + return nil +} + +func (x *AlertPolicy_Condition_SqlCondition) GetMinutes() *AlertPolicy_Condition_SqlCondition_Minutes { + if x, ok := x.GetSchedule().(*AlertPolicy_Condition_SqlCondition_Minutes_); ok { + return x.Minutes + } + return nil +} + +func (x *AlertPolicy_Condition_SqlCondition) GetHourly() *AlertPolicy_Condition_SqlCondition_Hourly { + if x, ok := x.GetSchedule().(*AlertPolicy_Condition_SqlCondition_Hourly_); ok { + return x.Hourly + } + return nil +} + +func (x *AlertPolicy_Condition_SqlCondition) GetDaily() *AlertPolicy_Condition_SqlCondition_Daily { + if x, ok := x.GetSchedule().(*AlertPolicy_Condition_SqlCondition_Daily_); ok { + return x.Daily + } + return nil +} + +func (m *AlertPolicy_Condition_SqlCondition) GetEvaluate() isAlertPolicy_Condition_SqlCondition_Evaluate { + if m != nil { + return m.Evaluate + } + return nil +} + +func (x *AlertPolicy_Condition_SqlCondition) GetRowCountTest() *AlertPolicy_Condition_SqlCondition_RowCountTest { + if x, ok := x.GetEvaluate().(*AlertPolicy_Condition_SqlCondition_RowCountTest_); ok { + return x.RowCountTest + } + return nil +} + +func (x *AlertPolicy_Condition_SqlCondition) GetBooleanTest() *AlertPolicy_Condition_SqlCondition_BooleanTest { + if x, ok := x.GetEvaluate().(*AlertPolicy_Condition_SqlCondition_BooleanTest_); ok { + return x.BooleanTest + } + return nil +} + +type isAlertPolicy_Condition_SqlCondition_Schedule interface { + isAlertPolicy_Condition_SqlCondition_Schedule() +} + +type AlertPolicy_Condition_SqlCondition_Minutes_ struct { + // Schedule the query to execute every so many minutes. + Minutes *AlertPolicy_Condition_SqlCondition_Minutes `protobuf:"bytes,2,opt,name=minutes,proto3,oneof"` +} + +type AlertPolicy_Condition_SqlCondition_Hourly_ struct { + // Schedule the query to execute every so many hours. + Hourly *AlertPolicy_Condition_SqlCondition_Hourly `protobuf:"bytes,3,opt,name=hourly,proto3,oneof"` +} + +type AlertPolicy_Condition_SqlCondition_Daily_ struct { + // Schedule the query to execute every so many days. + Daily *AlertPolicy_Condition_SqlCondition_Daily `protobuf:"bytes,4,opt,name=daily,proto3,oneof"` +} + +func (*AlertPolicy_Condition_SqlCondition_Minutes_) isAlertPolicy_Condition_SqlCondition_Schedule() {} + +func (*AlertPolicy_Condition_SqlCondition_Hourly_) isAlertPolicy_Condition_SqlCondition_Schedule() {} + +func (*AlertPolicy_Condition_SqlCondition_Daily_) isAlertPolicy_Condition_SqlCondition_Schedule() {} + +type isAlertPolicy_Condition_SqlCondition_Evaluate interface { + isAlertPolicy_Condition_SqlCondition_Evaluate() +} + +type AlertPolicy_Condition_SqlCondition_RowCountTest_ struct { + // Test the row count against a threshold. + RowCountTest *AlertPolicy_Condition_SqlCondition_RowCountTest `protobuf:"bytes,5,opt,name=row_count_test,json=rowCountTest,proto3,oneof"` +} + +type AlertPolicy_Condition_SqlCondition_BooleanTest_ struct { + // Test the boolean value in the indicated column. + BooleanTest *AlertPolicy_Condition_SqlCondition_BooleanTest `protobuf:"bytes,6,opt,name=boolean_test,json=booleanTest,proto3,oneof"` +} + +func (*AlertPolicy_Condition_SqlCondition_RowCountTest_) isAlertPolicy_Condition_SqlCondition_Evaluate() { +} + +func (*AlertPolicy_Condition_SqlCondition_BooleanTest_) isAlertPolicy_Condition_SqlCondition_Evaluate() { +} + // Options used when forecasting the time series and testing // the predicted value against the threshold. type AlertPolicy_Condition_MetricThreshold_ForecastOptions struct { @@ -1599,11 +1848,9 @@ type AlertPolicy_Condition_MetricThreshold_ForecastOptions struct { func (x *AlertPolicy_Condition_MetricThreshold_ForecastOptions) Reset() { *x = AlertPolicy_Condition_MetricThreshold_ForecastOptions{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[12] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[13] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_Condition_MetricThreshold_ForecastOptions) String() string { @@ -1613,8 +1860,8 @@ func (x *AlertPolicy_Condition_MetricThreshold_ForecastOptions) String() string func (*AlertPolicy_Condition_MetricThreshold_ForecastOptions) ProtoMessage() {} func (x *AlertPolicy_Condition_MetricThreshold_ForecastOptions) ProtoReflect() protoreflect.Message { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[12] - if protoimpl.UnsafeEnabled && x != nil { + mi := &file_google_monitoring_v3_alert_proto_msgTypes[13] + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1636,7 +1883,282 @@ func (x *AlertPolicy_Condition_MetricThreshold_ForecastOptions) GetForecastHoriz return nil } -// Control over the rate of notifications sent to this alert policy's +// Used to schedule the query to run every so many minutes. +type AlertPolicy_Condition_SqlCondition_Minutes struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Required. Number of minutes between runs. The interval must be + // greater than or equal to 5 minutes and less than or equal to 1440 + // minutes. + Periodicity int32 `protobuf:"varint,1,opt,name=periodicity,proto3" json:"periodicity,omitempty"` +} + +func (x *AlertPolicy_Condition_SqlCondition_Minutes) Reset() { + *x = AlertPolicy_Condition_SqlCondition_Minutes{} + mi := &file_google_monitoring_v3_alert_proto_msgTypes[16] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *AlertPolicy_Condition_SqlCondition_Minutes) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*AlertPolicy_Condition_SqlCondition_Minutes) ProtoMessage() {} + +func (x *AlertPolicy_Condition_SqlCondition_Minutes) ProtoReflect() protoreflect.Message { + mi := &file_google_monitoring_v3_alert_proto_msgTypes[16] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use AlertPolicy_Condition_SqlCondition_Minutes.ProtoReflect.Descriptor instead. +func (*AlertPolicy_Condition_SqlCondition_Minutes) Descriptor() ([]byte, []int) { + return file_google_monitoring_v3_alert_proto_rawDescGZIP(), []int{0, 1, 6, 0} +} + +func (x *AlertPolicy_Condition_SqlCondition_Minutes) GetPeriodicity() int32 { + if x != nil { + return x.Periodicity + } + return 0 +} + +// Used to schedule the query to run every so many hours. +type AlertPolicy_Condition_SqlCondition_Hourly struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Required. The number of hours between runs. Must be greater than or + // equal to 1 hour and less than or equal to 48 hours. + Periodicity int32 `protobuf:"varint,1,opt,name=periodicity,proto3" json:"periodicity,omitempty"` + // Optional. The number of minutes after the hour (in UTC) to run the + // query. Must be greater than or equal to 0 minutes and less than or + // equal to 59 minutes. If left unspecified, then an arbitrary offset + // is used. + MinuteOffset *int32 `protobuf:"varint,2,opt,name=minute_offset,json=minuteOffset,proto3,oneof" json:"minute_offset,omitempty"` +} + +func (x *AlertPolicy_Condition_SqlCondition_Hourly) Reset() { + *x = AlertPolicy_Condition_SqlCondition_Hourly{} + mi := &file_google_monitoring_v3_alert_proto_msgTypes[17] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *AlertPolicy_Condition_SqlCondition_Hourly) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*AlertPolicy_Condition_SqlCondition_Hourly) ProtoMessage() {} + +func (x *AlertPolicy_Condition_SqlCondition_Hourly) ProtoReflect() protoreflect.Message { + mi := &file_google_monitoring_v3_alert_proto_msgTypes[17] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use AlertPolicy_Condition_SqlCondition_Hourly.ProtoReflect.Descriptor instead. +func (*AlertPolicy_Condition_SqlCondition_Hourly) Descriptor() ([]byte, []int) { + return file_google_monitoring_v3_alert_proto_rawDescGZIP(), []int{0, 1, 6, 1} +} + +func (x *AlertPolicy_Condition_SqlCondition_Hourly) GetPeriodicity() int32 { + if x != nil { + return x.Periodicity + } + return 0 +} + +func (x *AlertPolicy_Condition_SqlCondition_Hourly) GetMinuteOffset() int32 { + if x != nil && x.MinuteOffset != nil { + return *x.MinuteOffset + } + return 0 +} + +// Used to schedule the query to run every so many days. +type AlertPolicy_Condition_SqlCondition_Daily struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Required. The number of days between runs. Must be greater than or + // equal to 1 day and less than or equal to 31 days. + Periodicity int32 `protobuf:"varint,1,opt,name=periodicity,proto3" json:"periodicity,omitempty"` + // Optional. The time of day (in UTC) at which the query should run. If + // left unspecified, the server picks an arbitrary time of day and runs + // the query at the same time each day. + ExecutionTime *timeofday.TimeOfDay `protobuf:"bytes,2,opt,name=execution_time,json=executionTime,proto3" json:"execution_time,omitempty"` +} + +func (x *AlertPolicy_Condition_SqlCondition_Daily) Reset() { + *x = AlertPolicy_Condition_SqlCondition_Daily{} + mi := &file_google_monitoring_v3_alert_proto_msgTypes[18] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *AlertPolicy_Condition_SqlCondition_Daily) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*AlertPolicy_Condition_SqlCondition_Daily) ProtoMessage() {} + +func (x *AlertPolicy_Condition_SqlCondition_Daily) ProtoReflect() protoreflect.Message { + mi := &file_google_monitoring_v3_alert_proto_msgTypes[18] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use AlertPolicy_Condition_SqlCondition_Daily.ProtoReflect.Descriptor instead. +func (*AlertPolicy_Condition_SqlCondition_Daily) Descriptor() ([]byte, []int) { + return file_google_monitoring_v3_alert_proto_rawDescGZIP(), []int{0, 1, 6, 2} +} + +func (x *AlertPolicy_Condition_SqlCondition_Daily) GetPeriodicity() int32 { + if x != nil { + return x.Periodicity + } + return 0 +} + +func (x *AlertPolicy_Condition_SqlCondition_Daily) GetExecutionTime() *timeofday.TimeOfDay { + if x != nil { + return x.ExecutionTime + } + return nil +} + +// A test that checks if the number of rows in the result set +// violates some threshold. +type AlertPolicy_Condition_SqlCondition_RowCountTest struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Required. The comparison to apply between the number of rows returned + // by the query and the threshold. + Comparison ComparisonType `protobuf:"varint,1,opt,name=comparison,proto3,enum=google.monitoring.v3.ComparisonType" json:"comparison,omitempty"` + // Required. The value against which to compare the row count. + Threshold int64 `protobuf:"varint,2,opt,name=threshold,proto3" json:"threshold,omitempty"` +} + +func (x *AlertPolicy_Condition_SqlCondition_RowCountTest) Reset() { + *x = AlertPolicy_Condition_SqlCondition_RowCountTest{} + mi := &file_google_monitoring_v3_alert_proto_msgTypes[19] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *AlertPolicy_Condition_SqlCondition_RowCountTest) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*AlertPolicy_Condition_SqlCondition_RowCountTest) ProtoMessage() {} + +func (x *AlertPolicy_Condition_SqlCondition_RowCountTest) ProtoReflect() protoreflect.Message { + mi := &file_google_monitoring_v3_alert_proto_msgTypes[19] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use AlertPolicy_Condition_SqlCondition_RowCountTest.ProtoReflect.Descriptor instead. +func (*AlertPolicy_Condition_SqlCondition_RowCountTest) Descriptor() ([]byte, []int) { + return file_google_monitoring_v3_alert_proto_rawDescGZIP(), []int{0, 1, 6, 3} +} + +func (x *AlertPolicy_Condition_SqlCondition_RowCountTest) GetComparison() ComparisonType { + if x != nil { + return x.Comparison + } + return ComparisonType_COMPARISON_UNSPECIFIED +} + +func (x *AlertPolicy_Condition_SqlCondition_RowCountTest) GetThreshold() int64 { + if x != nil { + return x.Threshold + } + return 0 +} + +// A test that uses an alerting result in a boolean column produced by +// the SQL query. +type AlertPolicy_Condition_SqlCondition_BooleanTest struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Required. The name of the column containing the boolean value. If the + // value in a row is NULL, that row is ignored. + Column string `protobuf:"bytes,1,opt,name=column,proto3" json:"column,omitempty"` +} + +func (x *AlertPolicy_Condition_SqlCondition_BooleanTest) Reset() { + *x = AlertPolicy_Condition_SqlCondition_BooleanTest{} + mi := &file_google_monitoring_v3_alert_proto_msgTypes[20] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *AlertPolicy_Condition_SqlCondition_BooleanTest) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*AlertPolicy_Condition_SqlCondition_BooleanTest) ProtoMessage() {} + +func (x *AlertPolicy_Condition_SqlCondition_BooleanTest) ProtoReflect() protoreflect.Message { + mi := &file_google_monitoring_v3_alert_proto_msgTypes[20] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use AlertPolicy_Condition_SqlCondition_BooleanTest.ProtoReflect.Descriptor instead. +func (*AlertPolicy_Condition_SqlCondition_BooleanTest) Descriptor() ([]byte, []int) { + return file_google_monitoring_v3_alert_proto_rawDescGZIP(), []int{0, 1, 6, 4} +} + +func (x *AlertPolicy_Condition_SqlCondition_BooleanTest) GetColumn() string { + if x != nil { + return x.Column + } + return "" +} + +// Control over the rate of notifications sent to this alerting policy's // notification channels. type AlertPolicy_AlertStrategy_NotificationRateLimit struct { state protoimpl.MessageState @@ -1649,11 +2171,9 @@ type AlertPolicy_AlertStrategy_NotificationRateLimit struct { func (x *AlertPolicy_AlertStrategy_NotificationRateLimit) Reset() { *x = AlertPolicy_AlertStrategy_NotificationRateLimit{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[15] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[21] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_AlertStrategy_NotificationRateLimit) String() string { @@ -1663,8 +2183,8 @@ func (x *AlertPolicy_AlertStrategy_NotificationRateLimit) String() string { func (*AlertPolicy_AlertStrategy_NotificationRateLimit) ProtoMessage() {} func (x *AlertPolicy_AlertStrategy_NotificationRateLimit) ProtoReflect() protoreflect.Message { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[15] - if protoimpl.UnsafeEnabled && x != nil { + mi := &file_google_monitoring_v3_alert_proto_msgTypes[21] + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1708,11 +2228,9 @@ type AlertPolicy_AlertStrategy_NotificationChannelStrategy struct { func (x *AlertPolicy_AlertStrategy_NotificationChannelStrategy) Reset() { *x = AlertPolicy_AlertStrategy_NotificationChannelStrategy{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[16] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_proto_msgTypes[22] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *AlertPolicy_AlertStrategy_NotificationChannelStrategy) String() string { @@ -1722,8 +2240,8 @@ func (x *AlertPolicy_AlertStrategy_NotificationChannelStrategy) String() string func (*AlertPolicy_AlertStrategy_NotificationChannelStrategy) ProtoMessage() {} func (x *AlertPolicy_AlertStrategy_NotificationChannelStrategy) ProtoReflect() protoreflect.Message { - mi := &file_google_monitoring_v3_alert_proto_msgTypes[16] - if protoimpl.UnsafeEnabled && x != nil { + mi := &file_google_monitoring_v3_alert_proto_msgTypes[22] + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1772,365 +2290,453 @@ var file_google_monitoring_v3_alert_proto_rawDesc = []byte{ 0x6f, 0x74, 0x6f, 0x1a, 0x1e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x77, 0x72, 0x61, 0x70, 0x70, 0x65, 0x72, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x17, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x72, 0x70, 0x63, 0x2f, - 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0x83, 0x2b, 0x0a, - 0x0b, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x12, 0x0a, 0x04, - 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, - 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x5f, 0x6e, 0x61, 0x6d, 0x65, - 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x4e, - 0x61, 0x6d, 0x65, 0x12, 0x55, 0x0a, 0x0d, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x0d, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x44, 0x6f, - 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0d, 0x64, 0x6f, 0x63, - 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x52, 0x0a, 0x0b, 0x75, 0x73, - 0x65, 0x72, 0x5f, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x10, 0x20, 0x03, 0x28, 0x0b, 0x32, - 0x31, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x1b, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x74, 0x79, 0x70, 0x65, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x66, + 0x64, 0x61, 0x79, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0xe5, 0x35, 0x0a, 0x0b, 0x41, 0x6c, + 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x17, 0x0a, 0x04, 0x6e, 0x61, 0x6d, + 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x08, 0x52, 0x04, 0x6e, 0x61, + 0x6d, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x5f, 0x6e, 0x61, + 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, + 0x79, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x55, 0x0a, 0x0d, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, + 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x0d, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, + 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, + 0x44, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0d, 0x64, + 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x52, 0x0a, 0x0b, + 0x75, 0x73, 0x65, 0x72, 0x5f, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x10, 0x20, 0x03, 0x28, + 0x0b, 0x32, 0x31, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, + 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x55, 0x73, 0x65, 0x72, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, + 0x6e, 0x74, 0x72, 0x79, 0x52, 0x0a, 0x75, 0x73, 0x65, 0x72, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, + 0x12, 0x4b, 0x0a, 0x0a, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x0c, + 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, + 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, + 0x6e, 0x52, 0x0a, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x53, 0x0a, + 0x08, 0x63, 0x6f, 0x6d, 0x62, 0x69, 0x6e, 0x65, 0x72, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0e, 0x32, + 0x37, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, - 0x63, 0x79, 0x2e, 0x55, 0x73, 0x65, 0x72, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, - 0x72, 0x79, 0x52, 0x0a, 0x75, 0x73, 0x65, 0x72, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x12, 0x4b, - 0x0a, 0x0a, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x0c, 0x20, 0x03, - 0x28, 0x0b, 0x32, 0x2b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, + 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6d, 0x62, + 0x69, 0x6e, 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, 0x52, 0x08, 0x63, 0x6f, 0x6d, 0x62, 0x69, 0x6e, + 0x65, 0x72, 0x12, 0x34, 0x0a, 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x11, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, + 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, + 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x12, 0x2e, 0x0a, 0x08, 0x76, 0x61, 0x6c, 0x69, + 0x64, 0x69, 0x74, 0x79, 0x18, 0x12, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, 0x08, + 0x76, 0x61, 0x6c, 0x69, 0x64, 0x69, 0x74, 0x79, 0x12, 0x33, 0x0a, 0x15, 0x6e, 0x6f, 0x74, 0x69, + 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, + 0x73, 0x18, 0x0e, 0x20, 0x03, 0x28, 0x09, 0x52, 0x14, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x12, 0x4d, 0x0a, + 0x0f, 0x63, 0x72, 0x65, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, + 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x75, + 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x52, 0x0e, 0x63, 0x72, + 0x65, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x12, 0x4d, 0x0a, 0x0f, + 0x6d, 0x75, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x18, + 0x0b, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x75, 0x74, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x52, 0x0e, 0x6d, 0x75, 0x74, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x12, 0x56, 0x0a, 0x0e, 0x61, + 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x73, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x18, 0x15, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, + 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x53, 0x74, 0x72, 0x61, + 0x74, 0x65, 0x67, 0x79, 0x52, 0x0d, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x53, 0x74, 0x72, 0x61, 0x74, + 0x65, 0x67, 0x79, 0x12, 0x4b, 0x0a, 0x08, 0x73, 0x65, 0x76, 0x65, 0x72, 0x69, 0x74, 0x79, 0x18, + 0x16, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, + 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x53, 0x65, 0x76, 0x65, 0x72, 0x69, 0x74, + 0x79, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x08, 0x73, 0x65, 0x76, 0x65, 0x72, 0x69, 0x74, 0x79, + 0x1a, 0xf3, 0x01, 0x0a, 0x0d, 0x44, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x12, 0x18, 0x0a, 0x07, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x18, 0x01, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x07, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x12, 0x1b, 0x0a, 0x09, + 0x6d, 0x69, 0x6d, 0x65, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x08, 0x6d, 0x69, 0x6d, 0x65, 0x54, 0x79, 0x70, 0x65, 0x12, 0x1d, 0x0a, 0x07, 0x73, 0x75, 0x62, + 0x6a, 0x65, 0x63, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, + 0x07, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x4f, 0x0a, 0x05, 0x6c, 0x69, 0x6e, 0x6b, + 0x73, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x34, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, + 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x44, 0x6f, 0x63, 0x75, 0x6d, + 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4c, 0x69, 0x6e, 0x6b, 0x42, 0x03, 0xe0, + 0x41, 0x01, 0x52, 0x05, 0x6c, 0x69, 0x6e, 0x6b, 0x73, 0x1a, 0x3b, 0x0a, 0x04, 0x4c, 0x69, 0x6e, + 0x6b, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x5f, 0x6e, 0x61, 0x6d, + 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, + 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x10, 0x0a, 0x03, 0x75, 0x72, 0x6c, 0x18, 0x02, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x03, 0x75, 0x72, 0x6c, 0x1a, 0xa5, 0x23, 0x0a, 0x09, 0x43, 0x6f, 0x6e, 0x64, 0x69, + 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x0c, 0x20, 0x01, + 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, 0x70, + 0x6c, 0x61, 0x79, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, + 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x6e, 0x0a, 0x13, 0x63, + 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x74, 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, + 0x6c, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x3b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, + 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, + 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x54, 0x68, 0x72, 0x65, + 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x48, 0x00, 0x52, 0x12, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, + 0x6f, 0x6e, 0x54, 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x12, 0x66, 0x0a, 0x10, 0x63, + 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x61, 0x62, 0x73, 0x65, 0x6e, 0x74, 0x18, + 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x39, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, + 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, + 0x6f, 0x6e, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x41, 0x62, 0x73, 0x65, 0x6e, 0x63, 0x65, + 0x48, 0x00, 0x52, 0x0f, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x41, 0x62, 0x73, + 0x65, 0x6e, 0x74, 0x12, 0x6a, 0x0a, 0x15, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, + 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x64, 0x5f, 0x6c, 0x6f, 0x67, 0x18, 0x14, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x34, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, - 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, - 0x0a, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x53, 0x0a, 0x08, 0x63, - 0x6f, 0x6d, 0x62, 0x69, 0x6e, 0x65, 0x72, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x37, 0x2e, + 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, + 0x4c, 0x6f, 0x67, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x48, 0x00, 0x52, 0x13, 0x63, 0x6f, 0x6e, 0x64, + 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x64, 0x4c, 0x6f, 0x67, 0x12, + 0x9d, 0x01, 0x0a, 0x23, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5f, 0x71, 0x75, 0x65, 0x72, 0x79, 0x5f, 0x6c, + 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x18, 0x13, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x4c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, - 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6d, 0x62, 0x69, 0x6e, - 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, 0x52, 0x08, 0x63, 0x6f, 0x6d, 0x62, 0x69, 0x6e, 0x65, 0x72, - 0x12, 0x34, 0x0a, 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x11, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x07, 0x65, - 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x12, 0x2e, 0x0a, 0x08, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x69, - 0x74, 0x79, 0x18, 0x12, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, 0x08, 0x76, 0x61, - 0x6c, 0x69, 0x64, 0x69, 0x74, 0x79, 0x12, 0x33, 0x0a, 0x15, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, - 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x18, - 0x0e, 0x20, 0x03, 0x28, 0x09, 0x52, 0x14, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x12, 0x4d, 0x0a, 0x0f, 0x63, - 0x72, 0x65, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x18, 0x0a, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x75, 0x74, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x52, 0x0e, 0x63, 0x72, 0x65, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x12, 0x4d, 0x0a, 0x0f, 0x6d, 0x75, - 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x18, 0x0b, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x75, 0x74, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x52, 0x0e, 0x6d, 0x75, 0x74, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x12, 0x56, 0x0a, 0x0e, 0x61, 0x6c, 0x65, - 0x72, 0x74, 0x5f, 0x73, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x18, 0x15, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, - 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, - 0x67, 0x79, 0x52, 0x0d, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, - 0x79, 0x12, 0x4b, 0x0a, 0x08, 0x73, 0x65, 0x76, 0x65, 0x72, 0x69, 0x74, 0x79, 0x18, 0x16, 0x20, - 0x01, 0x28, 0x0e, 0x32, 0x2a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, - 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x53, 0x65, 0x76, 0x65, 0x72, 0x69, 0x74, 0x79, 0x42, - 0x03, 0xe0, 0x41, 0x01, 0x52, 0x08, 0x73, 0x65, 0x76, 0x65, 0x72, 0x69, 0x74, 0x79, 0x1a, 0xf3, - 0x01, 0x0a, 0x0d, 0x44, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x12, 0x18, 0x0a, 0x07, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x07, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x12, 0x1b, 0x0a, 0x09, 0x6d, 0x69, - 0x6d, 0x65, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x6d, - 0x69, 0x6d, 0x65, 0x54, 0x79, 0x70, 0x65, 0x12, 0x1d, 0x0a, 0x07, 0x73, 0x75, 0x62, 0x6a, 0x65, - 0x63, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x07, 0x73, - 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x4f, 0x0a, 0x05, 0x6c, 0x69, 0x6e, 0x6b, 0x73, 0x18, - 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x34, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, - 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, - 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x44, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, - 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4c, 0x69, 0x6e, 0x6b, 0x42, 0x03, 0xe0, 0x41, 0x01, - 0x52, 0x05, 0x6c, 0x69, 0x6e, 0x6b, 0x73, 0x1a, 0x3b, 0x0a, 0x04, 0x4c, 0x69, 0x6e, 0x6b, 0x12, - 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, - 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x4e, 0x61, - 0x6d, 0x65, 0x12, 0x10, 0x0a, 0x03, 0x75, 0x72, 0x6c, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x03, 0x75, 0x72, 0x6c, 0x1a, 0x92, 0x1a, 0x0a, 0x09, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, - 0x6f, 0x6e, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, - 0x79, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x69, - 0x73, 0x70, 0x6c, 0x61, 0x79, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x6e, 0x0a, 0x13, 0x63, 0x6f, 0x6e, - 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x74, 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, 0x64, - 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x3b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x51, 0x75, 0x65, 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, + 0x67, 0x65, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x48, 0x00, 0x52, 0x20, 0x63, + 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, + 0x6e, 0x67, 0x51, 0x75, 0x65, 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x12, + 0x9d, 0x01, 0x0a, 0x23, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x70, 0x72, + 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, 0x5f, 0x71, 0x75, 0x65, 0x72, 0x79, 0x5f, 0x6c, + 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x18, 0x15, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x4c, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, + 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x50, 0x72, 0x6f, 0x6d, 0x65, + 0x74, 0x68, 0x65, 0x75, 0x73, 0x51, 0x75, 0x65, 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, + 0x67, 0x65, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x48, 0x00, 0x52, 0x20, 0x63, + 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, + 0x75, 0x73, 0x51, 0x75, 0x65, 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x12, + 0x5f, 0x0a, 0x0d, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x73, 0x71, 0x6c, + 0x18, 0x16, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x38, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, + 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, + 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x71, 0x6c, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, + 0x48, 0x00, 0x52, 0x0c, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x53, 0x71, 0x6c, + 0x1a, 0x45, 0x0a, 0x07, 0x54, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x12, 0x16, 0x0a, 0x05, 0x63, + 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x48, 0x00, 0x52, 0x05, 0x63, 0x6f, + 0x75, 0x6e, 0x74, 0x12, 0x1a, 0x0a, 0x07, 0x70, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74, 0x18, 0x02, + 0x20, 0x01, 0x28, 0x01, 0x48, 0x00, 0x52, 0x07, 0x70, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74, 0x42, + 0x06, 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, 0x1a, 0xc8, 0x06, 0x0a, 0x0f, 0x4d, 0x65, 0x74, 0x72, + 0x69, 0x63, 0x54, 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x12, 0x1b, 0x0a, 0x06, 0x66, + 0x69, 0x6c, 0x74, 0x65, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, + 0x52, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, 0x45, 0x0a, 0x0c, 0x61, 0x67, 0x67, 0x72, + 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x08, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x21, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, + 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x52, 0x0c, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, + 0x2d, 0x0a, 0x12, 0x64, 0x65, 0x6e, 0x6f, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x6f, 0x72, 0x5f, 0x66, + 0x69, 0x6c, 0x74, 0x65, 0x72, 0x18, 0x09, 0x20, 0x01, 0x28, 0x09, 0x52, 0x11, 0x64, 0x65, 0x6e, + 0x6f, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x6f, 0x72, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, 0x5c, + 0x0a, 0x18, 0x64, 0x65, 0x6e, 0x6f, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x6f, 0x72, 0x5f, 0x61, 0x67, + 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x0a, 0x20, 0x03, 0x28, 0x0b, + 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, + 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x52, 0x17, 0x64, 0x65, 0x6e, 0x6f, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x6f, 0x72, + 0x41, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x76, 0x0a, 0x10, + 0x66, 0x6f, 0x72, 0x65, 0x63, 0x61, 0x73, 0x74, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, + 0x18, 0x0c, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x4b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x54, 0x68, 0x72, 0x65, 0x73, 0x68, - 0x6f, 0x6c, 0x64, 0x48, 0x00, 0x52, 0x12, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, - 0x54, 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x12, 0x66, 0x0a, 0x10, 0x63, 0x6f, 0x6e, - 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x61, 0x62, 0x73, 0x65, 0x6e, 0x74, 0x18, 0x02, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x39, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, - 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, - 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x41, 0x62, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x48, 0x00, - 0x52, 0x0f, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x41, 0x62, 0x73, 0x65, 0x6e, - 0x74, 0x12, 0x6a, 0x0a, 0x15, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, - 0x61, 0x74, 0x63, 0x68, 0x65, 0x64, 0x5f, 0x6c, 0x6f, 0x67, 0x18, 0x14, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x34, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, - 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4c, 0x6f, - 0x67, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x48, 0x00, 0x52, 0x13, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, - 0x69, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x64, 0x4c, 0x6f, 0x67, 0x12, 0x9d, 0x01, - 0x0a, 0x23, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5f, 0x71, 0x75, 0x65, 0x72, 0x79, 0x5f, 0x6c, 0x61, 0x6e, - 0x67, 0x75, 0x61, 0x67, 0x65, 0x18, 0x13, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x4c, 0x2e, 0x67, 0x6f, + 0x6f, 0x6c, 0x64, 0x2e, 0x46, 0x6f, 0x72, 0x65, 0x63, 0x61, 0x73, 0x74, 0x4f, 0x70, 0x74, 0x69, + 0x6f, 0x6e, 0x73, 0x52, 0x0f, 0x66, 0x6f, 0x72, 0x65, 0x63, 0x61, 0x73, 0x74, 0x4f, 0x70, 0x74, + 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x44, 0x0a, 0x0a, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x69, 0x73, + 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, + 0x43, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x69, 0x73, 0x6f, 0x6e, 0x54, 0x79, 0x70, 0x65, 0x52, 0x0a, + 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x69, 0x73, 0x6f, 0x6e, 0x12, 0x27, 0x0a, 0x0f, 0x74, 0x68, + 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x05, 0x20, + 0x01, 0x28, 0x01, 0x52, 0x0e, 0x74, 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x56, 0x61, + 0x6c, 0x75, 0x65, 0x12, 0x35, 0x0a, 0x08, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, + 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, + 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x52, 0x08, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4d, 0x0a, 0x07, 0x74, 0x72, + 0x69, 0x67, 0x67, 0x65, 0x72, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, - 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x69, 0x6e, 0x67, 0x51, 0x75, 0x65, 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, - 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x48, 0x00, 0x52, 0x20, 0x63, 0x6f, 0x6e, - 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, - 0x51, 0x75, 0x65, 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x12, 0x9d, 0x01, - 0x0a, 0x23, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x70, 0x72, 0x6f, 0x6d, - 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, 0x5f, 0x71, 0x75, 0x65, 0x72, 0x79, 0x5f, 0x6c, 0x61, 0x6e, - 0x67, 0x75, 0x61, 0x67, 0x65, 0x18, 0x15, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x4c, 0x2e, 0x67, 0x6f, + 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x54, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, + 0x52, 0x07, 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x12, 0x79, 0x0a, 0x17, 0x65, 0x76, 0x61, + 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x5f, + 0x64, 0x61, 0x74, 0x61, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x41, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, + 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, + 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x45, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x4d, 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x44, 0x61, 0x74, 0x61, 0x52, 0x15, 0x65, + 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, + 0x44, 0x61, 0x74, 0x61, 0x1a, 0x5c, 0x0a, 0x0f, 0x46, 0x6f, 0x72, 0x65, 0x63, 0x61, 0x73, 0x74, + 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x49, 0x0a, 0x10, 0x66, 0x6f, 0x72, 0x65, 0x63, + 0x61, 0x73, 0x74, 0x5f, 0x68, 0x6f, 0x72, 0x69, 0x7a, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x03, 0xe0, 0x41, + 0x02, 0x52, 0x0f, 0x66, 0x6f, 0x72, 0x65, 0x63, 0x61, 0x73, 0x74, 0x48, 0x6f, 0x72, 0x69, 0x7a, + 0x6f, 0x6e, 0x1a, 0xf9, 0x01, 0x0a, 0x0d, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x41, 0x62, 0x73, + 0x65, 0x6e, 0x63, 0x65, 0x12, 0x1b, 0x0a, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x18, 0x01, + 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, + 0x72, 0x12, 0x45, 0x0a, 0x0c, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x73, 0x18, 0x05, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, + 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0c, 0x61, 0x67, 0x67, 0x72, + 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x35, 0x0a, 0x08, 0x64, 0x75, 0x72, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x08, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, + 0x4d, 0x0a, 0x07, 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, + 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, + 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x54, 0x72, + 0x69, 0x67, 0x67, 0x65, 0x72, 0x52, 0x07, 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x1a, 0xe1, + 0x01, 0x0a, 0x08, 0x4c, 0x6f, 0x67, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x1b, 0x0a, 0x06, 0x66, + 0x69, 0x6c, 0x74, 0x65, 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, + 0x52, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, 0x74, 0x0a, 0x10, 0x6c, 0x61, 0x62, 0x65, + 0x6c, 0x5f, 0x65, 0x78, 0x74, 0x72, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x73, 0x18, 0x02, 0x20, 0x03, + 0x28, 0x0b, 0x32, 0x49, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, + 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, + 0x4c, 0x6f, 0x67, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x45, 0x78, + 0x74, 0x72, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x0f, 0x6c, + 0x61, 0x62, 0x65, 0x6c, 0x45, 0x78, 0x74, 0x72, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x73, 0x1a, 0x42, + 0x0a, 0x14, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x45, 0x78, 0x74, 0x72, 0x61, 0x63, 0x74, 0x6f, 0x72, + 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, + 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, + 0x38, 0x01, 0x1a, 0xb9, 0x02, 0x0a, 0x20, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x51, 0x75, 0x65, 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x43, 0x6f, + 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x14, 0x0a, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, 0x12, 0x35, 0x0a, + 0x08, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x08, 0x64, 0x75, 0x72, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4d, 0x0a, 0x07, 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x18, + 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, + 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, + 0x6f, 0x6e, 0x2e, 0x54, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x52, 0x07, 0x74, 0x72, 0x69, 0x67, + 0x67, 0x65, 0x72, 0x12, 0x79, 0x0a, 0x17, 0x65, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x5f, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x5f, 0x64, 0x61, 0x74, 0x61, 0x18, 0x04, + 0x20, 0x01, 0x28, 0x0e, 0x32, 0x41, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, + 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, + 0x6e, 0x2e, 0x45, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x69, 0x73, 0x73, + 0x69, 0x6e, 0x67, 0x44, 0x61, 0x74, 0x61, 0x52, 0x15, 0x65, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x4d, 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x44, 0x61, 0x74, 0x61, 0x1a, 0x85, + 0x04, 0x0a, 0x20, 0x50, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, 0x51, 0x75, 0x65, + 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, + 0x69, 0x6f, 0x6e, 0x12, 0x19, 0x0a, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, 0x18, 0x01, 0x20, 0x01, + 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, 0x12, 0x3a, + 0x0a, 0x08, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, + 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x03, 0xe0, 0x41, 0x01, + 0x52, 0x08, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4f, 0x0a, 0x13, 0x65, 0x76, + 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, + 0x6c, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x12, 0x65, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x12, 0x75, 0x0a, 0x06, 0x6c, + 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x58, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x50, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, 0x51, 0x75, 0x65, 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, - 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x48, 0x00, 0x52, 0x20, 0x63, 0x6f, 0x6e, - 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, - 0x51, 0x75, 0x65, 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x1a, 0x45, 0x0a, - 0x07, 0x54, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x12, 0x16, 0x0a, 0x05, 0x63, 0x6f, 0x75, 0x6e, - 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x48, 0x00, 0x52, 0x05, 0x63, 0x6f, 0x75, 0x6e, 0x74, - 0x12, 0x1a, 0x0a, 0x07, 0x70, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x01, 0x48, 0x00, 0x52, 0x07, 0x70, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74, 0x42, 0x06, 0x0a, 0x04, - 0x74, 0x79, 0x70, 0x65, 0x1a, 0xc8, 0x06, 0x0a, 0x0f, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x54, - 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x12, 0x1b, 0x0a, 0x06, 0x66, 0x69, 0x6c, 0x74, - 0x65, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x66, - 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, 0x45, 0x0a, 0x0c, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x08, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, - 0x76, 0x33, 0x2e, 0x41, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0c, - 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x2d, 0x0a, 0x12, - 0x64, 0x65, 0x6e, 0x6f, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x6f, 0x72, 0x5f, 0x66, 0x69, 0x6c, 0x74, - 0x65, 0x72, 0x18, 0x09, 0x20, 0x01, 0x28, 0x09, 0x52, 0x11, 0x64, 0x65, 0x6e, 0x6f, 0x6d, 0x69, - 0x6e, 0x61, 0x74, 0x6f, 0x72, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, 0x5c, 0x0a, 0x18, 0x64, - 0x65, 0x6e, 0x6f, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x6f, 0x72, 0x5f, 0x61, 0x67, 0x67, 0x72, 0x65, - 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x0a, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x21, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, - 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x52, 0x17, 0x64, 0x65, 0x6e, 0x6f, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x6f, 0x72, 0x41, 0x67, 0x67, - 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x76, 0x0a, 0x10, 0x66, 0x6f, 0x72, - 0x65, 0x63, 0x61, 0x73, 0x74, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x0c, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x4b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, + 0x45, 0x6e, 0x74, 0x72, 0x79, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x06, 0x6c, 0x61, 0x62, 0x65, + 0x6c, 0x73, 0x12, 0x22, 0x0a, 0x0a, 0x72, 0x75, 0x6c, 0x65, 0x5f, 0x67, 0x72, 0x6f, 0x75, 0x70, + 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x09, 0x72, 0x75, 0x6c, + 0x65, 0x47, 0x72, 0x6f, 0x75, 0x70, 0x12, 0x22, 0x0a, 0x0a, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, + 0x72, 0x75, 0x6c, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, + 0x09, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x52, 0x75, 0x6c, 0x65, 0x12, 0x3f, 0x0a, 0x19, 0x64, 0x69, + 0x73, 0x61, 0x62, 0x6c, 0x65, 0x5f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x76, 0x61, 0x6c, + 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x07, 0x20, 0x01, 0x28, 0x08, 0x42, 0x03, 0xe0, + 0x41, 0x01, 0x52, 0x17, 0x64, 0x69, 0x73, 0x61, 0x62, 0x6c, 0x65, 0x4d, 0x65, 0x74, 0x72, 0x69, + 0x63, 0x56, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0x39, 0x0a, 0x0b, 0x4c, + 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, + 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, + 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, + 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x1a, 0xee, 0x07, 0x0a, 0x0c, 0x53, 0x71, 0x6c, 0x43, 0x6f, + 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x19, 0x0a, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x05, 0x71, 0x75, 0x65, + 0x72, 0x79, 0x12, 0x5c, 0x0a, 0x07, 0x6d, 0x69, 0x6e, 0x75, 0x74, 0x65, 0x73, 0x18, 0x02, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x40, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, - 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x54, 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, 0x64, - 0x2e, 0x46, 0x6f, 0x72, 0x65, 0x63, 0x61, 0x73, 0x74, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, - 0x52, 0x0f, 0x66, 0x6f, 0x72, 0x65, 0x63, 0x61, 0x73, 0x74, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, - 0x73, 0x12, 0x44, 0x0a, 0x0a, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x69, 0x73, 0x6f, 0x6e, 0x18, - 0x04, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, - 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6f, 0x6d, - 0x70, 0x61, 0x72, 0x69, 0x73, 0x6f, 0x6e, 0x54, 0x79, 0x70, 0x65, 0x52, 0x0a, 0x63, 0x6f, 0x6d, - 0x70, 0x61, 0x72, 0x69, 0x73, 0x6f, 0x6e, 0x12, 0x27, 0x0a, 0x0f, 0x74, 0x68, 0x72, 0x65, 0x73, - 0x68, 0x6f, 0x6c, 0x64, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x01, - 0x52, 0x0e, 0x74, 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x56, 0x61, 0x6c, 0x75, 0x65, - 0x12, 0x35, 0x0a, 0x08, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x06, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x08, 0x64, - 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4d, 0x0a, 0x07, 0x74, 0x72, 0x69, 0x67, 0x67, - 0x65, 0x72, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x2e, 0x53, 0x71, 0x6c, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4d, 0x69, + 0x6e, 0x75, 0x74, 0x65, 0x73, 0x48, 0x00, 0x52, 0x07, 0x6d, 0x69, 0x6e, 0x75, 0x74, 0x65, 0x73, + 0x12, 0x59, 0x0a, 0x06, 0x68, 0x6f, 0x75, 0x72, 0x6c, 0x79, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x3f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, + 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, + 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x71, + 0x6c, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x48, 0x6f, 0x75, 0x72, 0x6c, + 0x79, 0x48, 0x00, 0x52, 0x06, 0x68, 0x6f, 0x75, 0x72, 0x6c, 0x79, 0x12, 0x56, 0x0a, 0x05, 0x64, + 0x61, 0x69, 0x6c, 0x79, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x3e, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, + 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, + 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x71, 0x6c, 0x43, 0x6f, 0x6e, 0x64, 0x69, + 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x44, 0x61, 0x69, 0x6c, 0x79, 0x48, 0x00, 0x52, 0x05, 0x64, 0x61, + 0x69, 0x6c, 0x79, 0x12, 0x6d, 0x0a, 0x0e, 0x72, 0x6f, 0x77, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, + 0x5f, 0x74, 0x65, 0x73, 0x74, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x45, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, + 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, + 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x71, 0x6c, 0x43, 0x6f, 0x6e, 0x64, + 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x52, 0x6f, 0x77, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x54, 0x65, + 0x73, 0x74, 0x48, 0x01, 0x52, 0x0c, 0x72, 0x6f, 0x77, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x54, 0x65, + 0x73, 0x74, 0x12, 0x69, 0x0a, 0x0c, 0x62, 0x6f, 0x6f, 0x6c, 0x65, 0x61, 0x6e, 0x5f, 0x74, 0x65, + 0x73, 0x74, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x44, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, - 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x54, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x52, 0x07, 0x74, - 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x12, 0x79, 0x0a, 0x17, 0x65, 0x76, 0x61, 0x6c, 0x75, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x5f, 0x64, 0x61, 0x74, - 0x61, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x41, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, - 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, - 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x45, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, - 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x44, 0x61, 0x74, 0x61, 0x52, 0x15, 0x65, 0x76, 0x61, 0x6c, + 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x71, 0x6c, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, + 0x6f, 0x6e, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x65, 0x61, 0x6e, 0x54, 0x65, 0x73, 0x74, 0x48, 0x01, + 0x52, 0x0b, 0x62, 0x6f, 0x6f, 0x6c, 0x65, 0x61, 0x6e, 0x54, 0x65, 0x73, 0x74, 0x1a, 0x30, 0x0a, + 0x07, 0x4d, 0x69, 0x6e, 0x75, 0x74, 0x65, 0x73, 0x12, 0x25, 0x0a, 0x0b, 0x70, 0x65, 0x72, 0x69, + 0x6f, 0x64, 0x69, 0x63, 0x69, 0x74, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x42, 0x03, 0xe0, + 0x41, 0x02, 0x52, 0x0b, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, 0x69, 0x63, 0x69, 0x74, 0x79, 0x1a, + 0x70, 0x0a, 0x06, 0x48, 0x6f, 0x75, 0x72, 0x6c, 0x79, 0x12, 0x25, 0x0a, 0x0b, 0x70, 0x65, 0x72, + 0x69, 0x6f, 0x64, 0x69, 0x63, 0x69, 0x74, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x42, 0x03, + 0xe0, 0x41, 0x02, 0x52, 0x0b, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, 0x69, 0x63, 0x69, 0x74, 0x79, + 0x12, 0x2d, 0x0a, 0x0d, 0x6d, 0x69, 0x6e, 0x75, 0x74, 0x65, 0x5f, 0x6f, 0x66, 0x66, 0x73, 0x65, + 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x48, 0x00, 0x52, 0x0c, + 0x6d, 0x69, 0x6e, 0x75, 0x74, 0x65, 0x4f, 0x66, 0x66, 0x73, 0x65, 0x74, 0x88, 0x01, 0x01, 0x42, + 0x10, 0x0a, 0x0e, 0x5f, 0x6d, 0x69, 0x6e, 0x75, 0x74, 0x65, 0x5f, 0x6f, 0x66, 0x66, 0x73, 0x65, + 0x74, 0x1a, 0x72, 0x0a, 0x05, 0x44, 0x61, 0x69, 0x6c, 0x79, 0x12, 0x25, 0x0a, 0x0b, 0x70, 0x65, + 0x72, 0x69, 0x6f, 0x64, 0x69, 0x63, 0x69, 0x74, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x42, + 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0b, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, 0x69, 0x63, 0x69, 0x74, + 0x79, 0x12, 0x42, 0x0a, 0x0e, 0x65, 0x78, 0x65, 0x63, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x74, + 0x69, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x4f, 0x66, 0x44, 0x61, + 0x79, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x0d, 0x65, 0x78, 0x65, 0x63, 0x75, 0x74, 0x69, 0x6f, + 0x6e, 0x54, 0x69, 0x6d, 0x65, 0x1a, 0x7c, 0x0a, 0x0c, 0x52, 0x6f, 0x77, 0x43, 0x6f, 0x75, 0x6e, + 0x74, 0x54, 0x65, 0x73, 0x74, 0x12, 0x49, 0x0a, 0x0a, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x69, + 0x73, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, + 0x2e, 0x43, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x69, 0x73, 0x6f, 0x6e, 0x54, 0x79, 0x70, 0x65, 0x42, + 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0a, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x69, 0x73, 0x6f, 0x6e, + 0x12, 0x21, 0x0a, 0x09, 0x74, 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x18, 0x02, 0x20, + 0x01, 0x28, 0x03, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x09, 0x74, 0x68, 0x72, 0x65, 0x73, 0x68, + 0x6f, 0x6c, 0x64, 0x1a, 0x2a, 0x0a, 0x0b, 0x42, 0x6f, 0x6f, 0x6c, 0x65, 0x61, 0x6e, 0x54, 0x65, + 0x73, 0x74, 0x12, 0x1b, 0x0a, 0x06, 0x63, 0x6f, 0x6c, 0x75, 0x6d, 0x6e, 0x18, 0x01, 0x20, 0x01, + 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x63, 0x6f, 0x6c, 0x75, 0x6d, 0x6e, 0x42, + 0x0a, 0x0a, 0x08, 0x73, 0x63, 0x68, 0x65, 0x64, 0x75, 0x6c, 0x65, 0x42, 0x0a, 0x0a, 0x08, 0x65, + 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x65, 0x22, 0xad, 0x01, 0x0a, 0x15, 0x45, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x44, 0x61, 0x74, - 0x61, 0x1a, 0x5c, 0x0a, 0x0f, 0x46, 0x6f, 0x72, 0x65, 0x63, 0x61, 0x73, 0x74, 0x4f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x49, 0x0a, 0x10, 0x66, 0x6f, 0x72, 0x65, 0x63, 0x61, 0x73, 0x74, - 0x5f, 0x68, 0x6f, 0x72, 0x69, 0x7a, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, - 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0f, - 0x66, 0x6f, 0x72, 0x65, 0x63, 0x61, 0x73, 0x74, 0x48, 0x6f, 0x72, 0x69, 0x7a, 0x6f, 0x6e, 0x1a, - 0xf9, 0x01, 0x0a, 0x0d, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x41, 0x62, 0x73, 0x65, 0x6e, 0x63, - 0x65, 0x12, 0x1b, 0x0a, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, - 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, 0x45, - 0x0a, 0x0c, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x05, - 0x20, 0x03, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x67, 0x67, 0x72, - 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0c, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x35, 0x0a, 0x08, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x52, 0x08, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4d, 0x0a, 0x07, - 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x33, 0x2e, + 0x61, 0x12, 0x27, 0x0a, 0x23, 0x45, 0x56, 0x41, 0x4c, 0x55, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, + 0x4d, 0x49, 0x53, 0x53, 0x49, 0x4e, 0x47, 0x5f, 0x44, 0x41, 0x54, 0x41, 0x5f, 0x55, 0x4e, 0x53, + 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x24, 0x0a, 0x20, 0x45, 0x56, + 0x41, 0x4c, 0x55, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x4d, 0x49, 0x53, 0x53, 0x49, 0x4e, 0x47, + 0x5f, 0x44, 0x41, 0x54, 0x41, 0x5f, 0x49, 0x4e, 0x41, 0x43, 0x54, 0x49, 0x56, 0x45, 0x10, 0x01, + 0x12, 0x22, 0x0a, 0x1e, 0x45, 0x56, 0x41, 0x4c, 0x55, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x4d, + 0x49, 0x53, 0x53, 0x49, 0x4e, 0x47, 0x5f, 0x44, 0x41, 0x54, 0x41, 0x5f, 0x41, 0x43, 0x54, 0x49, + 0x56, 0x45, 0x10, 0x02, 0x12, 0x21, 0x0a, 0x1d, 0x45, 0x56, 0x41, 0x4c, 0x55, 0x41, 0x54, 0x49, + 0x4f, 0x4e, 0x5f, 0x4d, 0x49, 0x53, 0x53, 0x49, 0x4e, 0x47, 0x5f, 0x44, 0x41, 0x54, 0x41, 0x5f, + 0x4e, 0x4f, 0x5f, 0x4f, 0x50, 0x10, 0x03, 0x3a, 0x97, 0x02, 0xea, 0x41, 0x93, 0x02, 0x0a, 0x2e, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, + 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x46, + 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, + 0x74, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, + 0x2f, 0x7b, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x7d, 0x2f, + 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x63, 0x6f, 0x6e, 0x64, + 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x12, 0x50, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, + 0x65, 0x73, 0x2f, 0x7b, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, + 0x7d, 0x2f, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x63, 0x6f, + 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x12, 0x44, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, + 0x73, 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, + 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, 0x7b, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, + 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x7d, 0x2f, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, + 0x6e, 0x73, 0x2f, 0x7b, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x12, 0x01, + 0x2a, 0x42, 0x0b, 0x0a, 0x09, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0x96, + 0x06, 0x0a, 0x0d, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, + 0x12, 0x7d, 0x0a, 0x17, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x5f, 0x72, 0x61, 0x74, 0x65, 0x5f, 0x6c, 0x69, 0x6d, 0x69, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x45, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, + 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, + 0x67, 0x79, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, + 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x52, 0x15, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, + 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x12, + 0x75, 0x0a, 0x14, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, + 0x70, 0x72, 0x6f, 0x6d, 0x70, 0x74, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0e, 0x32, 0x42, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, - 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x54, 0x72, 0x69, 0x67, 0x67, - 0x65, 0x72, 0x52, 0x07, 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x1a, 0xe1, 0x01, 0x0a, 0x08, - 0x4c, 0x6f, 0x67, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x1b, 0x0a, 0x06, 0x66, 0x69, 0x6c, 0x74, - 0x65, 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x66, - 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, 0x74, 0x0a, 0x10, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x5f, 0x65, - 0x78, 0x74, 0x72, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, - 0x49, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, - 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4c, 0x6f, 0x67, - 0x4d, 0x61, 0x74, 0x63, 0x68, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x45, 0x78, 0x74, 0x72, 0x61, - 0x63, 0x74, 0x6f, 0x72, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x0f, 0x6c, 0x61, 0x62, 0x65, - 0x6c, 0x45, 0x78, 0x74, 0x72, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x73, 0x1a, 0x42, 0x0a, 0x14, 0x4c, - 0x61, 0x62, 0x65, 0x6c, 0x45, 0x78, 0x74, 0x72, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x73, 0x45, 0x6e, - 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, - 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x1a, - 0xb9, 0x02, 0x0a, 0x20, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x51, 0x75, - 0x65, 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x43, 0x6f, 0x6e, 0x64, 0x69, - 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x14, 0x0a, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, 0x12, 0x35, 0x0a, 0x08, 0x64, 0x75, - 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, - 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x08, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x12, 0x4d, 0x0a, 0x07, 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x18, 0x03, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, - 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, - 0x54, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x52, 0x07, 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, - 0x12, 0x79, 0x0a, 0x17, 0x65, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6d, - 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x5f, 0x64, 0x61, 0x74, 0x61, 0x18, 0x04, 0x20, 0x01, 0x28, - 0x0e, 0x32, 0x41, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, - 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x45, - 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4d, 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, - 0x44, 0x61, 0x74, 0x61, 0x52, 0x15, 0x65, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x4d, 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x44, 0x61, 0x74, 0x61, 0x1a, 0xc4, 0x03, 0x0a, 0x20, - 0x50, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, 0x51, 0x75, 0x65, 0x72, 0x79, 0x4c, - 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, - 0x12, 0x19, 0x0a, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, - 0x03, 0xe0, 0x41, 0x02, 0x52, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, 0x12, 0x3a, 0x0a, 0x08, 0x64, - 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, - 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x08, 0x64, - 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4f, 0x0a, 0x13, 0x65, 0x76, 0x61, 0x6c, 0x75, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x18, 0x03, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, - 0x03, 0xe0, 0x41, 0x01, 0x52, 0x12, 0x65, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x12, 0x75, 0x0a, 0x06, 0x6c, 0x61, 0x62, 0x65, - 0x6c, 0x73, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x58, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x2e, 0x4e, + 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x6f, 0x6d, 0x70, + 0x74, 0x52, 0x13, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x50, + 0x72, 0x6f, 0x6d, 0x70, 0x74, 0x73, 0x12, 0x38, 0x0a, 0x0a, 0x61, 0x75, 0x74, 0x6f, 0x5f, 0x63, + 0x6c, 0x6f, 0x73, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x09, 0x61, 0x75, 0x74, 0x6f, 0x43, 0x6c, 0x6f, 0x73, 0x65, + 0x12, 0x8f, 0x01, 0x0a, 0x1d, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x5f, 0x73, 0x74, 0x72, 0x61, 0x74, 0x65, + 0x67, 0x79, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x4b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, - 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x43, 0x6f, 0x6e, 0x64, - 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x50, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, - 0x51, 0x75, 0x65, 0x72, 0x79, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x43, 0x6f, 0x6e, - 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, - 0x72, 0x79, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x06, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x12, - 0x22, 0x0a, 0x0a, 0x72, 0x75, 0x6c, 0x65, 0x5f, 0x67, 0x72, 0x6f, 0x75, 0x70, 0x18, 0x05, 0x20, - 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x09, 0x72, 0x75, 0x6c, 0x65, 0x47, 0x72, - 0x6f, 0x75, 0x70, 0x12, 0x22, 0x0a, 0x0a, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x72, 0x75, 0x6c, - 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x09, 0x61, 0x6c, - 0x65, 0x72, 0x74, 0x52, 0x75, 0x6c, 0x65, 0x1a, 0x39, 0x0a, 0x0b, 0x4c, 0x61, 0x62, 0x65, 0x6c, - 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, - 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, - 0x38, 0x01, 0x22, 0xad, 0x01, 0x0a, 0x15, 0x45, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x4d, 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x44, 0x61, 0x74, 0x61, 0x12, 0x27, 0x0a, 0x23, - 0x45, 0x56, 0x41, 0x4c, 0x55, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x4d, 0x49, 0x53, 0x53, 0x49, - 0x4e, 0x47, 0x5f, 0x44, 0x41, 0x54, 0x41, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, - 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x24, 0x0a, 0x20, 0x45, 0x56, 0x41, 0x4c, 0x55, 0x41, 0x54, - 0x49, 0x4f, 0x4e, 0x5f, 0x4d, 0x49, 0x53, 0x53, 0x49, 0x4e, 0x47, 0x5f, 0x44, 0x41, 0x54, 0x41, - 0x5f, 0x49, 0x4e, 0x41, 0x43, 0x54, 0x49, 0x56, 0x45, 0x10, 0x01, 0x12, 0x22, 0x0a, 0x1e, 0x45, - 0x56, 0x41, 0x4c, 0x55, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x4d, 0x49, 0x53, 0x53, 0x49, 0x4e, - 0x47, 0x5f, 0x44, 0x41, 0x54, 0x41, 0x5f, 0x41, 0x43, 0x54, 0x49, 0x56, 0x45, 0x10, 0x02, 0x12, - 0x21, 0x0a, 0x1d, 0x45, 0x56, 0x41, 0x4c, 0x55, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x4d, 0x49, - 0x53, 0x53, 0x49, 0x4e, 0x47, 0x5f, 0x44, 0x41, 0x54, 0x41, 0x5f, 0x4e, 0x4f, 0x5f, 0x4f, 0x50, - 0x10, 0x03, 0x3a, 0x97, 0x02, 0xea, 0x41, 0x93, 0x02, 0x0a, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, - 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, - 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x46, 0x70, 0x72, 0x6f, 0x6a, 0x65, - 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x61, 0x6c, - 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, 0x7b, 0x61, 0x6c, 0x65, - 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x7d, 0x2f, 0x63, 0x6f, 0x6e, 0x64, 0x69, - 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, - 0x7d, 0x12, 0x50, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, - 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x2f, - 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, 0x7b, 0x61, - 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x7d, 0x2f, 0x63, 0x6f, 0x6e, - 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, - 0x6f, 0x6e, 0x7d, 0x12, 0x44, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x7b, 0x66, 0x6f, - 0x6c, 0x64, 0x65, 0x72, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, - 0x69, 0x65, 0x73, 0x2f, 0x7b, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, - 0x79, 0x7d, 0x2f, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x63, - 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x12, 0x01, 0x2a, 0x42, 0x0b, 0x0a, 0x09, - 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0xcc, 0x04, 0x0a, 0x0d, 0x41, 0x6c, - 0x65, 0x72, 0x74, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x12, 0x7d, 0x0a, 0x17, 0x6e, - 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x61, 0x74, 0x65, - 0x5f, 0x6c, 0x69, 0x6d, 0x69, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x45, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, - 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, - 0x41, 0x6c, 0x65, 0x72, 0x74, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x2e, 0x4e, 0x6f, - 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, - 0x6d, 0x69, 0x74, 0x52, 0x15, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x12, 0x38, 0x0a, 0x0a, 0x61, 0x75, - 0x74, 0x6f, 0x5f, 0x63, 0x6c, 0x6f, 0x73, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, - 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x09, 0x61, 0x75, 0x74, 0x6f, 0x43, - 0x6c, 0x6f, 0x73, 0x65, 0x12, 0x8f, 0x01, 0x0a, 0x1d, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x5f, 0x73, 0x74, - 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x4b, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, - 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, - 0x41, 0x6c, 0x65, 0x72, 0x74, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x2e, 0x4e, 0x6f, - 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, - 0x6c, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x52, 0x1b, 0x6e, 0x6f, 0x74, 0x69, 0x66, - 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x53, 0x74, - 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x1a, 0x4a, 0x0a, 0x15, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, - 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x12, - 0x31, 0x0a, 0x06, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x06, 0x70, 0x65, 0x72, 0x69, - 0x6f, 0x64, 0x1a, 0xa3, 0x01, 0x0a, 0x1b, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, + 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x41, 0x6c, 0x65, 0x72, + 0x74, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, + 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x53, 0x74, 0x72, + 0x61, 0x74, 0x65, 0x67, 0x79, 0x52, 0x1b, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, - 0x67, 0x79, 0x12, 0x3c, 0x0a, 0x1a, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x73, - 0x18, 0x01, 0x20, 0x03, 0x28, 0x09, 0x52, 0x18, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x4e, 0x61, 0x6d, 0x65, 0x73, - 0x12, 0x46, 0x0a, 0x11, 0x72, 0x65, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x79, 0x5f, 0x69, 0x6e, 0x74, - 0x65, 0x72, 0x76, 0x61, 0x6c, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, + 0x67, 0x79, 0x1a, 0x4a, 0x0a, 0x15, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x12, 0x31, 0x0a, 0x06, 0x70, + 0x65, 0x72, 0x69, 0x6f, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, - 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x10, 0x72, 0x65, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x79, - 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x1a, 0x3d, 0x0a, 0x0f, 0x55, 0x73, 0x65, 0x72, - 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, - 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, - 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, - 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x61, 0x0a, 0x15, 0x43, 0x6f, 0x6e, 0x64, 0x69, - 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6d, 0x62, 0x69, 0x6e, 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, - 0x12, 0x17, 0x0a, 0x13, 0x43, 0x4f, 0x4d, 0x42, 0x49, 0x4e, 0x45, 0x5f, 0x55, 0x4e, 0x53, 0x50, - 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x07, 0x0a, 0x03, 0x41, 0x4e, 0x44, - 0x10, 0x01, 0x12, 0x06, 0x0a, 0x02, 0x4f, 0x52, 0x10, 0x02, 0x12, 0x1e, 0x0a, 0x1a, 0x41, 0x4e, - 0x44, 0x5f, 0x57, 0x49, 0x54, 0x48, 0x5f, 0x4d, 0x41, 0x54, 0x43, 0x48, 0x49, 0x4e, 0x47, 0x5f, - 0x52, 0x45, 0x53, 0x4f, 0x55, 0x52, 0x43, 0x45, 0x10, 0x03, 0x22, 0x4a, 0x0a, 0x08, 0x53, 0x65, - 0x76, 0x65, 0x72, 0x69, 0x74, 0x79, 0x12, 0x18, 0x0a, 0x14, 0x53, 0x45, 0x56, 0x45, 0x52, 0x49, - 0x54, 0x59, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, - 0x12, 0x0c, 0x0a, 0x08, 0x43, 0x52, 0x49, 0x54, 0x49, 0x43, 0x41, 0x4c, 0x10, 0x01, 0x12, 0x09, - 0x0a, 0x05, 0x45, 0x52, 0x52, 0x4f, 0x52, 0x10, 0x02, 0x12, 0x0b, 0x0a, 0x07, 0x57, 0x41, 0x52, - 0x4e, 0x49, 0x4e, 0x47, 0x10, 0x03, 0x3a, 0xc9, 0x01, 0xea, 0x41, 0xc5, 0x01, 0x0a, 0x25, 0x6d, - 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, - 0x6c, 0x69, 0x63, 0x79, 0x12, 0x2f, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, - 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, - 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, 0x7b, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, - 0x6c, 0x69, 0x63, 0x79, 0x7d, 0x12, 0x39, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, - 0x73, 0x2f, 0x7b, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x7d, - 0x12, 0x2d, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, - 0x72, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, + 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x06, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, 0x1a, 0xa3, + 0x01, 0x0a, 0x1b, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, + 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x53, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x12, 0x3c, + 0x0a, 0x1a, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, + 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x73, 0x18, 0x01, 0x20, 0x03, + 0x28, 0x09, 0x52, 0x18, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x12, 0x46, 0x0a, 0x11, + 0x72, 0x65, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x79, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, + 0x6c, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x52, 0x10, 0x72, 0x65, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x79, 0x49, 0x6e, 0x74, 0x65, + 0x72, 0x76, 0x61, 0x6c, 0x22, 0x51, 0x0a, 0x12, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x6f, 0x6d, 0x70, 0x74, 0x12, 0x23, 0x0a, 0x1f, 0x4e, 0x4f, + 0x54, 0x49, 0x46, 0x49, 0x43, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x50, 0x52, 0x4f, 0x4d, 0x50, + 0x54, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, + 0x0a, 0x0a, 0x06, 0x4f, 0x50, 0x45, 0x4e, 0x45, 0x44, 0x10, 0x01, 0x12, 0x0a, 0x0a, 0x06, 0x43, + 0x4c, 0x4f, 0x53, 0x45, 0x44, 0x10, 0x03, 0x1a, 0x3d, 0x0a, 0x0f, 0x55, 0x73, 0x65, 0x72, 0x4c, + 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, + 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, + 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, + 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x61, 0x0a, 0x15, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, + 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6d, 0x62, 0x69, 0x6e, 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, 0x12, + 0x17, 0x0a, 0x13, 0x43, 0x4f, 0x4d, 0x42, 0x49, 0x4e, 0x45, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, + 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x07, 0x0a, 0x03, 0x41, 0x4e, 0x44, 0x10, + 0x01, 0x12, 0x06, 0x0a, 0x02, 0x4f, 0x52, 0x10, 0x02, 0x12, 0x1e, 0x0a, 0x1a, 0x41, 0x4e, 0x44, + 0x5f, 0x57, 0x49, 0x54, 0x48, 0x5f, 0x4d, 0x41, 0x54, 0x43, 0x48, 0x49, 0x4e, 0x47, 0x5f, 0x52, + 0x45, 0x53, 0x4f, 0x55, 0x52, 0x43, 0x45, 0x10, 0x03, 0x22, 0x4a, 0x0a, 0x08, 0x53, 0x65, 0x76, + 0x65, 0x72, 0x69, 0x74, 0x79, 0x12, 0x18, 0x0a, 0x14, 0x53, 0x45, 0x56, 0x45, 0x52, 0x49, 0x54, + 0x59, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, + 0x0c, 0x0a, 0x08, 0x43, 0x52, 0x49, 0x54, 0x49, 0x43, 0x41, 0x4c, 0x10, 0x01, 0x12, 0x09, 0x0a, + 0x05, 0x45, 0x52, 0x52, 0x4f, 0x52, 0x10, 0x02, 0x12, 0x0b, 0x0a, 0x07, 0x57, 0x41, 0x52, 0x4e, + 0x49, 0x4e, 0x47, 0x10, 0x03, 0x3a, 0xc9, 0x01, 0xea, 0x41, 0xc5, 0x01, 0x0a, 0x25, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, + 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, + 0x69, 0x63, 0x79, 0x12, 0x2f, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, + 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, + 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, 0x7b, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, + 0x69, 0x63, 0x79, 0x7d, 0x12, 0x39, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, 0x7b, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x7d, 0x12, - 0x01, 0x2a, 0x42, 0xc5, 0x01, 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x42, - 0x0a, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, - 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, - 0x67, 0x6f, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, - 0x69, 0x76, 0x33, 0x2f, 0x76, 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, - 0x67, 0x70, 0x62, 0x3b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, - 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, - 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, - 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x3a, 0x3a, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x33, + 0x2d, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, + 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, + 0x7b, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x7d, 0x12, 0x01, + 0x2a, 0x42, 0xc5, 0x01, 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x42, 0x0a, + 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, 0x6c, + 0x6f, 0x75, 0x64, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x67, + 0x6f, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, 0x69, + 0x76, 0x33, 0x2f, 0x76, 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, + 0x70, 0x62, 0x3b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0xaa, + 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x4d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, 0x47, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x3a, 0x3a, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x33, } var ( @@ -2145,81 +2751,98 @@ func file_google_monitoring_v3_alert_proto_rawDescGZIP() []byte { return file_google_monitoring_v3_alert_proto_rawDescData } -var file_google_monitoring_v3_alert_proto_enumTypes = make([]protoimpl.EnumInfo, 3) -var file_google_monitoring_v3_alert_proto_msgTypes = make([]protoimpl.MessageInfo, 17) +var file_google_monitoring_v3_alert_proto_enumTypes = make([]protoimpl.EnumInfo, 4) +var file_google_monitoring_v3_alert_proto_msgTypes = make([]protoimpl.MessageInfo, 23) var file_google_monitoring_v3_alert_proto_goTypes = []any{ (AlertPolicy_ConditionCombinerType)(0), // 0: google.monitoring.v3.AlertPolicy.ConditionCombinerType (AlertPolicy_Severity)(0), // 1: google.monitoring.v3.AlertPolicy.Severity (AlertPolicy_Condition_EvaluationMissingData)(0), // 2: google.monitoring.v3.AlertPolicy.Condition.EvaluationMissingData - (*AlertPolicy)(nil), // 3: google.monitoring.v3.AlertPolicy - (*AlertPolicy_Documentation)(nil), // 4: google.monitoring.v3.AlertPolicy.Documentation - (*AlertPolicy_Condition)(nil), // 5: google.monitoring.v3.AlertPolicy.Condition - (*AlertPolicy_AlertStrategy)(nil), // 6: google.monitoring.v3.AlertPolicy.AlertStrategy - nil, // 7: google.monitoring.v3.AlertPolicy.UserLabelsEntry - (*AlertPolicy_Documentation_Link)(nil), // 8: google.monitoring.v3.AlertPolicy.Documentation.Link - (*AlertPolicy_Condition_Trigger)(nil), // 9: google.monitoring.v3.AlertPolicy.Condition.Trigger - (*AlertPolicy_Condition_MetricThreshold)(nil), // 10: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold - (*AlertPolicy_Condition_MetricAbsence)(nil), // 11: google.monitoring.v3.AlertPolicy.Condition.MetricAbsence - (*AlertPolicy_Condition_LogMatch)(nil), // 12: google.monitoring.v3.AlertPolicy.Condition.LogMatch - (*AlertPolicy_Condition_MonitoringQueryLanguageCondition)(nil), // 13: google.monitoring.v3.AlertPolicy.Condition.MonitoringQueryLanguageCondition - (*AlertPolicy_Condition_PrometheusQueryLanguageCondition)(nil), // 14: google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition - (*AlertPolicy_Condition_MetricThreshold_ForecastOptions)(nil), // 15: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.ForecastOptions - nil, // 16: google.monitoring.v3.AlertPolicy.Condition.LogMatch.LabelExtractorsEntry - nil, // 17: google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition.LabelsEntry - (*AlertPolicy_AlertStrategy_NotificationRateLimit)(nil), // 18: google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationRateLimit - (*AlertPolicy_AlertStrategy_NotificationChannelStrategy)(nil), // 19: google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationChannelStrategy - (*wrapperspb.BoolValue)(nil), // 20: google.protobuf.BoolValue - (*status.Status)(nil), // 21: google.rpc.Status - (*MutationRecord)(nil), // 22: google.monitoring.v3.MutationRecord - (*durationpb.Duration)(nil), // 23: google.protobuf.Duration - (*Aggregation)(nil), // 24: google.monitoring.v3.Aggregation - (ComparisonType)(0), // 25: google.monitoring.v3.ComparisonType + (AlertPolicy_AlertStrategy_NotificationPrompt)(0), // 3: google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationPrompt + (*AlertPolicy)(nil), // 4: google.monitoring.v3.AlertPolicy + (*AlertPolicy_Documentation)(nil), // 5: google.monitoring.v3.AlertPolicy.Documentation + (*AlertPolicy_Condition)(nil), // 6: google.monitoring.v3.AlertPolicy.Condition + (*AlertPolicy_AlertStrategy)(nil), // 7: google.monitoring.v3.AlertPolicy.AlertStrategy + nil, // 8: google.monitoring.v3.AlertPolicy.UserLabelsEntry + (*AlertPolicy_Documentation_Link)(nil), // 9: google.monitoring.v3.AlertPolicy.Documentation.Link + (*AlertPolicy_Condition_Trigger)(nil), // 10: google.monitoring.v3.AlertPolicy.Condition.Trigger + (*AlertPolicy_Condition_MetricThreshold)(nil), // 11: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold + (*AlertPolicy_Condition_MetricAbsence)(nil), // 12: google.monitoring.v3.AlertPolicy.Condition.MetricAbsence + (*AlertPolicy_Condition_LogMatch)(nil), // 13: google.monitoring.v3.AlertPolicy.Condition.LogMatch + (*AlertPolicy_Condition_MonitoringQueryLanguageCondition)(nil), // 14: google.monitoring.v3.AlertPolicy.Condition.MonitoringQueryLanguageCondition + (*AlertPolicy_Condition_PrometheusQueryLanguageCondition)(nil), // 15: google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition + (*AlertPolicy_Condition_SqlCondition)(nil), // 16: google.monitoring.v3.AlertPolicy.Condition.SqlCondition + (*AlertPolicy_Condition_MetricThreshold_ForecastOptions)(nil), // 17: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.ForecastOptions + nil, // 18: google.monitoring.v3.AlertPolicy.Condition.LogMatch.LabelExtractorsEntry + nil, // 19: google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition.LabelsEntry + (*AlertPolicy_Condition_SqlCondition_Minutes)(nil), // 20: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.Minutes + (*AlertPolicy_Condition_SqlCondition_Hourly)(nil), // 21: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.Hourly + (*AlertPolicy_Condition_SqlCondition_Daily)(nil), // 22: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.Daily + (*AlertPolicy_Condition_SqlCondition_RowCountTest)(nil), // 23: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.RowCountTest + (*AlertPolicy_Condition_SqlCondition_BooleanTest)(nil), // 24: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.BooleanTest + (*AlertPolicy_AlertStrategy_NotificationRateLimit)(nil), // 25: google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationRateLimit + (*AlertPolicy_AlertStrategy_NotificationChannelStrategy)(nil), // 26: google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationChannelStrategy + (*wrapperspb.BoolValue)(nil), // 27: google.protobuf.BoolValue + (*status.Status)(nil), // 28: google.rpc.Status + (*MutationRecord)(nil), // 29: google.monitoring.v3.MutationRecord + (*durationpb.Duration)(nil), // 30: google.protobuf.Duration + (*Aggregation)(nil), // 31: google.monitoring.v3.Aggregation + (ComparisonType)(0), // 32: google.monitoring.v3.ComparisonType + (*timeofday.TimeOfDay)(nil), // 33: google.type.TimeOfDay } var file_google_monitoring_v3_alert_proto_depIdxs = []int32{ - 4, // 0: google.monitoring.v3.AlertPolicy.documentation:type_name -> google.monitoring.v3.AlertPolicy.Documentation - 7, // 1: google.monitoring.v3.AlertPolicy.user_labels:type_name -> google.monitoring.v3.AlertPolicy.UserLabelsEntry - 5, // 2: google.monitoring.v3.AlertPolicy.conditions:type_name -> google.monitoring.v3.AlertPolicy.Condition + 5, // 0: google.monitoring.v3.AlertPolicy.documentation:type_name -> google.monitoring.v3.AlertPolicy.Documentation + 8, // 1: google.monitoring.v3.AlertPolicy.user_labels:type_name -> google.monitoring.v3.AlertPolicy.UserLabelsEntry + 6, // 2: google.monitoring.v3.AlertPolicy.conditions:type_name -> google.monitoring.v3.AlertPolicy.Condition 0, // 3: google.monitoring.v3.AlertPolicy.combiner:type_name -> google.monitoring.v3.AlertPolicy.ConditionCombinerType - 20, // 4: google.monitoring.v3.AlertPolicy.enabled:type_name -> google.protobuf.BoolValue - 21, // 5: google.monitoring.v3.AlertPolicy.validity:type_name -> google.rpc.Status - 22, // 6: google.monitoring.v3.AlertPolicy.creation_record:type_name -> google.monitoring.v3.MutationRecord - 22, // 7: google.monitoring.v3.AlertPolicy.mutation_record:type_name -> google.monitoring.v3.MutationRecord - 6, // 8: google.monitoring.v3.AlertPolicy.alert_strategy:type_name -> google.monitoring.v3.AlertPolicy.AlertStrategy + 27, // 4: google.monitoring.v3.AlertPolicy.enabled:type_name -> google.protobuf.BoolValue + 28, // 5: google.monitoring.v3.AlertPolicy.validity:type_name -> google.rpc.Status + 29, // 6: google.monitoring.v3.AlertPolicy.creation_record:type_name -> google.monitoring.v3.MutationRecord + 29, // 7: google.monitoring.v3.AlertPolicy.mutation_record:type_name -> google.monitoring.v3.MutationRecord + 7, // 8: google.monitoring.v3.AlertPolicy.alert_strategy:type_name -> google.monitoring.v3.AlertPolicy.AlertStrategy 1, // 9: google.monitoring.v3.AlertPolicy.severity:type_name -> google.monitoring.v3.AlertPolicy.Severity - 8, // 10: google.monitoring.v3.AlertPolicy.Documentation.links:type_name -> google.monitoring.v3.AlertPolicy.Documentation.Link - 10, // 11: google.monitoring.v3.AlertPolicy.Condition.condition_threshold:type_name -> google.monitoring.v3.AlertPolicy.Condition.MetricThreshold - 11, // 12: google.monitoring.v3.AlertPolicy.Condition.condition_absent:type_name -> google.monitoring.v3.AlertPolicy.Condition.MetricAbsence - 12, // 13: google.monitoring.v3.AlertPolicy.Condition.condition_matched_log:type_name -> google.monitoring.v3.AlertPolicy.Condition.LogMatch - 13, // 14: google.monitoring.v3.AlertPolicy.Condition.condition_monitoring_query_language:type_name -> google.monitoring.v3.AlertPolicy.Condition.MonitoringQueryLanguageCondition - 14, // 15: google.monitoring.v3.AlertPolicy.Condition.condition_prometheus_query_language:type_name -> google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition - 18, // 16: google.monitoring.v3.AlertPolicy.AlertStrategy.notification_rate_limit:type_name -> google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationRateLimit - 23, // 17: google.monitoring.v3.AlertPolicy.AlertStrategy.auto_close:type_name -> google.protobuf.Duration - 19, // 18: google.monitoring.v3.AlertPolicy.AlertStrategy.notification_channel_strategy:type_name -> google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationChannelStrategy - 24, // 19: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.aggregations:type_name -> google.monitoring.v3.Aggregation - 24, // 20: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.denominator_aggregations:type_name -> google.monitoring.v3.Aggregation - 15, // 21: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.forecast_options:type_name -> google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.ForecastOptions - 25, // 22: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.comparison:type_name -> google.monitoring.v3.ComparisonType - 23, // 23: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.duration:type_name -> google.protobuf.Duration - 9, // 24: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.trigger:type_name -> google.monitoring.v3.AlertPolicy.Condition.Trigger - 2, // 25: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.evaluation_missing_data:type_name -> google.monitoring.v3.AlertPolicy.Condition.EvaluationMissingData - 24, // 26: google.monitoring.v3.AlertPolicy.Condition.MetricAbsence.aggregations:type_name -> google.monitoring.v3.Aggregation - 23, // 27: google.monitoring.v3.AlertPolicy.Condition.MetricAbsence.duration:type_name -> google.protobuf.Duration - 9, // 28: google.monitoring.v3.AlertPolicy.Condition.MetricAbsence.trigger:type_name -> google.monitoring.v3.AlertPolicy.Condition.Trigger - 16, // 29: google.monitoring.v3.AlertPolicy.Condition.LogMatch.label_extractors:type_name -> google.monitoring.v3.AlertPolicy.Condition.LogMatch.LabelExtractorsEntry - 23, // 30: google.monitoring.v3.AlertPolicy.Condition.MonitoringQueryLanguageCondition.duration:type_name -> google.protobuf.Duration - 9, // 31: google.monitoring.v3.AlertPolicy.Condition.MonitoringQueryLanguageCondition.trigger:type_name -> google.monitoring.v3.AlertPolicy.Condition.Trigger - 2, // 32: google.monitoring.v3.AlertPolicy.Condition.MonitoringQueryLanguageCondition.evaluation_missing_data:type_name -> google.monitoring.v3.AlertPolicy.Condition.EvaluationMissingData - 23, // 33: google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition.duration:type_name -> google.protobuf.Duration - 23, // 34: google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition.evaluation_interval:type_name -> google.protobuf.Duration - 17, // 35: google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition.labels:type_name -> google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition.LabelsEntry - 23, // 36: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.ForecastOptions.forecast_horizon:type_name -> google.protobuf.Duration - 23, // 37: google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationRateLimit.period:type_name -> google.protobuf.Duration - 23, // 38: google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationChannelStrategy.renotify_interval:type_name -> google.protobuf.Duration - 39, // [39:39] is the sub-list for method output_type - 39, // [39:39] is the sub-list for method input_type - 39, // [39:39] is the sub-list for extension type_name - 39, // [39:39] is the sub-list for extension extendee - 0, // [0:39] is the sub-list for field type_name + 9, // 10: google.monitoring.v3.AlertPolicy.Documentation.links:type_name -> google.monitoring.v3.AlertPolicy.Documentation.Link + 11, // 11: google.monitoring.v3.AlertPolicy.Condition.condition_threshold:type_name -> google.monitoring.v3.AlertPolicy.Condition.MetricThreshold + 12, // 12: google.monitoring.v3.AlertPolicy.Condition.condition_absent:type_name -> google.monitoring.v3.AlertPolicy.Condition.MetricAbsence + 13, // 13: google.monitoring.v3.AlertPolicy.Condition.condition_matched_log:type_name -> google.monitoring.v3.AlertPolicy.Condition.LogMatch + 14, // 14: google.monitoring.v3.AlertPolicy.Condition.condition_monitoring_query_language:type_name -> google.monitoring.v3.AlertPolicy.Condition.MonitoringQueryLanguageCondition + 15, // 15: google.monitoring.v3.AlertPolicy.Condition.condition_prometheus_query_language:type_name -> google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition + 16, // 16: google.monitoring.v3.AlertPolicy.Condition.condition_sql:type_name -> google.monitoring.v3.AlertPolicy.Condition.SqlCondition + 25, // 17: google.monitoring.v3.AlertPolicy.AlertStrategy.notification_rate_limit:type_name -> google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationRateLimit + 3, // 18: google.monitoring.v3.AlertPolicy.AlertStrategy.notification_prompts:type_name -> google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationPrompt + 30, // 19: google.monitoring.v3.AlertPolicy.AlertStrategy.auto_close:type_name -> google.protobuf.Duration + 26, // 20: google.monitoring.v3.AlertPolicy.AlertStrategy.notification_channel_strategy:type_name -> google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationChannelStrategy + 31, // 21: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.aggregations:type_name -> google.monitoring.v3.Aggregation + 31, // 22: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.denominator_aggregations:type_name -> google.monitoring.v3.Aggregation + 17, // 23: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.forecast_options:type_name -> google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.ForecastOptions + 32, // 24: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.comparison:type_name -> google.monitoring.v3.ComparisonType + 30, // 25: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.duration:type_name -> google.protobuf.Duration + 10, // 26: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.trigger:type_name -> google.monitoring.v3.AlertPolicy.Condition.Trigger + 2, // 27: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.evaluation_missing_data:type_name -> google.monitoring.v3.AlertPolicy.Condition.EvaluationMissingData + 31, // 28: google.monitoring.v3.AlertPolicy.Condition.MetricAbsence.aggregations:type_name -> google.monitoring.v3.Aggregation + 30, // 29: google.monitoring.v3.AlertPolicy.Condition.MetricAbsence.duration:type_name -> google.protobuf.Duration + 10, // 30: google.monitoring.v3.AlertPolicy.Condition.MetricAbsence.trigger:type_name -> google.monitoring.v3.AlertPolicy.Condition.Trigger + 18, // 31: google.monitoring.v3.AlertPolicy.Condition.LogMatch.label_extractors:type_name -> google.monitoring.v3.AlertPolicy.Condition.LogMatch.LabelExtractorsEntry + 30, // 32: google.monitoring.v3.AlertPolicy.Condition.MonitoringQueryLanguageCondition.duration:type_name -> google.protobuf.Duration + 10, // 33: google.monitoring.v3.AlertPolicy.Condition.MonitoringQueryLanguageCondition.trigger:type_name -> google.monitoring.v3.AlertPolicy.Condition.Trigger + 2, // 34: google.monitoring.v3.AlertPolicy.Condition.MonitoringQueryLanguageCondition.evaluation_missing_data:type_name -> google.monitoring.v3.AlertPolicy.Condition.EvaluationMissingData + 30, // 35: google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition.duration:type_name -> google.protobuf.Duration + 30, // 36: google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition.evaluation_interval:type_name -> google.protobuf.Duration + 19, // 37: google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition.labels:type_name -> google.monitoring.v3.AlertPolicy.Condition.PrometheusQueryLanguageCondition.LabelsEntry + 20, // 38: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.minutes:type_name -> google.monitoring.v3.AlertPolicy.Condition.SqlCondition.Minutes + 21, // 39: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.hourly:type_name -> google.monitoring.v3.AlertPolicy.Condition.SqlCondition.Hourly + 22, // 40: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.daily:type_name -> google.monitoring.v3.AlertPolicy.Condition.SqlCondition.Daily + 23, // 41: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.row_count_test:type_name -> google.monitoring.v3.AlertPolicy.Condition.SqlCondition.RowCountTest + 24, // 42: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.boolean_test:type_name -> google.monitoring.v3.AlertPolicy.Condition.SqlCondition.BooleanTest + 30, // 43: google.monitoring.v3.AlertPolicy.Condition.MetricThreshold.ForecastOptions.forecast_horizon:type_name -> google.protobuf.Duration + 33, // 44: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.Daily.execution_time:type_name -> google.type.TimeOfDay + 32, // 45: google.monitoring.v3.AlertPolicy.Condition.SqlCondition.RowCountTest.comparison:type_name -> google.monitoring.v3.ComparisonType + 30, // 46: google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationRateLimit.period:type_name -> google.protobuf.Duration + 30, // 47: google.monitoring.v3.AlertPolicy.AlertStrategy.NotificationChannelStrategy.renotify_interval:type_name -> google.protobuf.Duration + 48, // [48:48] is the sub-list for method output_type + 48, // [48:48] is the sub-list for method input_type + 48, // [48:48] is the sub-list for extension type_name + 48, // [48:48] is the sub-list for extension extendee + 0, // [0:48] is the sub-list for field type_name } func init() { file_google_monitoring_v3_alert_proto_init() } @@ -2229,194 +2852,33 @@ func file_google_monitoring_v3_alert_proto_init() { } file_google_monitoring_v3_common_proto_init() file_google_monitoring_v3_mutation_record_proto_init() - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_alert_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_Documentation); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_Condition); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[3].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_AlertStrategy); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[5].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_Documentation_Link); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[6].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_Condition_Trigger); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[7].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_Condition_MetricThreshold); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[8].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_Condition_MetricAbsence); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[9].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_Condition_LogMatch); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[10].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_Condition_MonitoringQueryLanguageCondition); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[11].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_Condition_PrometheusQueryLanguageCondition); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[12].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_Condition_MetricThreshold_ForecastOptions); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[15].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_AlertStrategy_NotificationRateLimit); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_proto_msgTypes[16].Exporter = func(v any, i int) any { - switch v := v.(*AlertPolicy_AlertStrategy_NotificationChannelStrategy); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } file_google_monitoring_v3_alert_proto_msgTypes[2].OneofWrappers = []any{ (*AlertPolicy_Condition_ConditionThreshold)(nil), (*AlertPolicy_Condition_ConditionAbsent)(nil), (*AlertPolicy_Condition_ConditionMatchedLog)(nil), (*AlertPolicy_Condition_ConditionMonitoringQueryLanguage)(nil), (*AlertPolicy_Condition_ConditionPrometheusQueryLanguage)(nil), + (*AlertPolicy_Condition_ConditionSql)(nil), } file_google_monitoring_v3_alert_proto_msgTypes[6].OneofWrappers = []any{ (*AlertPolicy_Condition_Trigger_Count)(nil), (*AlertPolicy_Condition_Trigger_Percent)(nil), } + file_google_monitoring_v3_alert_proto_msgTypes[12].OneofWrappers = []any{ + (*AlertPolicy_Condition_SqlCondition_Minutes_)(nil), + (*AlertPolicy_Condition_SqlCondition_Hourly_)(nil), + (*AlertPolicy_Condition_SqlCondition_Daily_)(nil), + (*AlertPolicy_Condition_SqlCondition_RowCountTest_)(nil), + (*AlertPolicy_Condition_SqlCondition_BooleanTest_)(nil), + } + file_google_monitoring_v3_alert_proto_msgTypes[17].OneofWrappers = []any{} type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ GoPackagePath: reflect.TypeOf(x{}).PkgPath(), RawDescriptor: file_google_monitoring_v3_alert_proto_rawDesc, - NumEnums: 3, - NumMessages: 17, + NumEnums: 4, + NumMessages: 23, NumExtensions: 0, NumServices: 0, }, diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/alert_service.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/alert_service.pb.go index f0e149d16b64a..02103f8cd4912 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/alert_service.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/alert_service.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/alert_service.proto @@ -70,11 +70,9 @@ type CreateAlertPolicyRequest struct { func (x *CreateAlertPolicyRequest) Reset() { *x = CreateAlertPolicyRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateAlertPolicyRequest) String() string { @@ -85,7 +83,7 @@ func (*CreateAlertPolicyRequest) ProtoMessage() {} func (x *CreateAlertPolicyRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -128,11 +126,9 @@ type GetAlertPolicyRequest struct { func (x *GetAlertPolicyRequest) Reset() { *x = GetAlertPolicyRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetAlertPolicyRequest) String() string { @@ -143,7 +139,7 @@ func (*GetAlertPolicyRequest) ProtoMessage() {} func (x *GetAlertPolicyRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -183,34 +179,33 @@ type ListAlertPoliciesRequest struct { // [GetAlertPolicy][google.monitoring.v3.AlertPolicyService.GetAlertPolicy] // operation, instead. Name string `protobuf:"bytes,4,opt,name=name,proto3" json:"name,omitempty"` - // If provided, this field specifies the criteria that must be met by - // alert policies to be included in the response. + // Optional. If provided, this field specifies the criteria that must be met + // by alert policies to be included in the response. // // For more details, see [sorting and // filtering](https://cloud.google.com/monitoring/api/v3/sorting-and-filtering). Filter string `protobuf:"bytes,5,opt,name=filter,proto3" json:"filter,omitempty"` - // A comma-separated list of fields by which to sort the result. Supports - // the same set of field references as the `filter` field. Entries can be - // prefixed with a minus sign to sort by the field in descending order. + // Optional. A comma-separated list of fields by which to sort the result. + // Supports the same set of field references as the `filter` field. Entries + // can be prefixed with a minus sign to sort by the field in descending order. // // For more details, see [sorting and // filtering](https://cloud.google.com/monitoring/api/v3/sorting-and-filtering). OrderBy string `protobuf:"bytes,6,opt,name=order_by,json=orderBy,proto3" json:"order_by,omitempty"` - // The maximum number of results to return in a single response. + // Optional. The maximum number of results to return in a single response. PageSize int32 `protobuf:"varint,2,opt,name=page_size,json=pageSize,proto3" json:"page_size,omitempty"` - // If this field is not empty then it must contain the `nextPageToken` value - // returned by a previous call to this method. Using this field causes the - // method to return more results from the previous method call. + // Optional. If this field is not empty then it must contain the + // `nextPageToken` value returned by a previous call to this method. Using + // this field causes the method to return more results from the previous + // method call. PageToken string `protobuf:"bytes,3,opt,name=page_token,json=pageToken,proto3" json:"page_token,omitempty"` } func (x *ListAlertPoliciesRequest) Reset() { *x = ListAlertPoliciesRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListAlertPoliciesRequest) String() string { @@ -221,7 +216,7 @@ func (*ListAlertPoliciesRequest) ProtoMessage() {} func (x *ListAlertPoliciesRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -290,11 +285,9 @@ type ListAlertPoliciesResponse struct { func (x *ListAlertPoliciesResponse) Reset() { *x = ListAlertPoliciesResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[3] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListAlertPoliciesResponse) String() string { @@ -305,7 +298,7 @@ func (*ListAlertPoliciesResponse) ProtoMessage() {} func (x *ListAlertPoliciesResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -378,11 +371,9 @@ type UpdateAlertPolicyRequest struct { func (x *UpdateAlertPolicyRequest) Reset() { *x = UpdateAlertPolicyRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[4] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[4] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UpdateAlertPolicyRequest) String() string { @@ -393,7 +384,7 @@ func (*UpdateAlertPolicyRequest) ProtoMessage() {} func (x *UpdateAlertPolicyRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[4] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -438,11 +429,9 @@ type DeleteAlertPolicyRequest struct { func (x *DeleteAlertPolicyRequest) Reset() { *x = DeleteAlertPolicyRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[5] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[5] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *DeleteAlertPolicyRequest) String() string { @@ -453,7 +442,7 @@ func (*DeleteAlertPolicyRequest) ProtoMessage() {} func (x *DeleteAlertPolicyRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_alert_service_proto_msgTypes[5] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -511,127 +500,128 @@ var file_google_monitoring_v3_alert_service_proto_rawDesc = []byte{ 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x2d, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x27, 0x0a, 0x25, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, - 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0xcc, 0x01, 0x0a, 0x18, + 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0xe0, 0x01, 0x0a, 0x18, 0x4c, 0x69, 0x73, 0x74, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x41, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x42, 0x2d, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x27, 0x12, 0x25, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, - 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x16, 0x0a, 0x06, 0x66, - 0x69, 0x6c, 0x74, 0x65, 0x72, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x66, 0x69, 0x6c, - 0x74, 0x65, 0x72, 0x12, 0x19, 0x0a, 0x08, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x5f, 0x62, 0x79, 0x18, - 0x06, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x42, 0x79, 0x12, 0x1b, - 0x0a, 0x09, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x05, 0x52, 0x08, 0x70, 0x61, 0x67, 0x65, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x1d, 0x0a, 0x0a, 0x70, - 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x09, 0x70, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x22, 0xac, 0x01, 0x0a, 0x19, 0x4c, - 0x69, 0x73, 0x74, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, - 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x48, 0x0a, 0x0e, 0x61, 0x6c, 0x65, 0x72, - 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, - 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, - 0x69, 0x63, 0x79, 0x52, 0x0d, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, - 0x65, 0x73, 0x12, 0x26, 0x0a, 0x0f, 0x6e, 0x65, 0x78, 0x74, 0x5f, 0x70, 0x61, 0x67, 0x65, 0x5f, - 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x6e, 0x65, 0x78, - 0x74, 0x50, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x12, 0x1d, 0x0a, 0x0a, 0x74, 0x6f, - 0x74, 0x61, 0x6c, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x05, 0x52, 0x09, - 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x53, 0x69, 0x7a, 0x65, 0x22, 0xa2, 0x01, 0x0a, 0x18, 0x55, 0x70, - 0x64, 0x61, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, - 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x3b, 0x0a, 0x0b, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, - 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, - 0x65, 0x6c, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x52, 0x0a, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4d, - 0x61, 0x73, 0x6b, 0x12, 0x49, 0x0a, 0x0c, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, - 0x69, 0x63, 0x79, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, - 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x42, 0x03, 0xe0, 0x41, - 0x02, 0x52, 0x0b, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x22, 0x5d, - 0x0a, 0x18, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, - 0x69, 0x63, 0x79, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x41, 0x0a, 0x04, 0x6e, 0x61, - 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x2d, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x27, - 0x0a, 0x25, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x41, 0x6c, 0x65, 0x72, - 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x32, 0x9e, 0x08, - 0x0a, 0x12, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x53, 0x65, 0x72, - 0x76, 0x69, 0x63, 0x65, 0x12, 0xa8, 0x01, 0x0a, 0x11, 0x4c, 0x69, 0x73, 0x74, 0x41, 0x6c, 0x65, - 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x12, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, - 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, - 0x69, 0x65, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x32, 0xda, 0x41, 0x04, - 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x25, 0x12, 0x23, 0x2f, 0x76, 0x33, 0x2f, + 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x1b, 0x0a, 0x06, 0x66, + 0x69, 0x6c, 0x74, 0x65, 0x72, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, + 0x52, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, 0x1e, 0x0a, 0x08, 0x6f, 0x72, 0x64, 0x65, + 0x72, 0x5f, 0x62, 0x79, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, + 0x07, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x42, 0x79, 0x12, 0x20, 0x0a, 0x09, 0x70, 0x61, 0x67, 0x65, + 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x42, 0x03, 0xe0, 0x41, 0x01, + 0x52, 0x08, 0x70, 0x61, 0x67, 0x65, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x22, 0x0a, 0x0a, 0x70, 0x61, + 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, + 0xe0, 0x41, 0x01, 0x52, 0x09, 0x70, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x22, 0xac, + 0x01, 0x0a, 0x19, 0x4c, 0x69, 0x73, 0x74, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, + 0x63, 0x69, 0x65, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x48, 0x0a, 0x0e, + 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x18, 0x03, + 0x20, 0x03, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, + 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x0d, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, + 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x12, 0x26, 0x0a, 0x0f, 0x6e, 0x65, 0x78, 0x74, 0x5f, 0x70, + 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x0d, 0x6e, 0x65, 0x78, 0x74, 0x50, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x12, 0x1d, + 0x0a, 0x0a, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x04, 0x20, 0x01, + 0x28, 0x05, 0x52, 0x09, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x53, 0x69, 0x7a, 0x65, 0x22, 0xa7, 0x01, + 0x0a, 0x18, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, + 0x69, 0x63, 0x79, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x40, 0x0a, 0x0b, 0x75, 0x70, + 0x64, 0x61, 0x74, 0x65, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x42, 0x03, 0xe0, 0x41, 0x01, + 0x52, 0x0a, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4d, 0x61, 0x73, 0x6b, 0x12, 0x49, 0x0a, 0x0c, + 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x18, 0x03, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, + 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0b, 0x61, 0x6c, 0x65, 0x72, + 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x22, 0x5d, 0x0a, 0x18, 0x44, 0x65, 0x6c, 0x65, 0x74, + 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x65, 0x71, 0x75, + 0x65, 0x73, 0x74, 0x12, 0x41, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, + 0x09, 0x42, 0x2d, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x27, 0x0a, 0x25, 0x6d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, + 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, + 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x32, 0x9e, 0x08, 0x0a, 0x12, 0x41, 0x6c, 0x65, 0x72, 0x74, + 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x12, 0xa8, 0x01, + 0x0a, 0x11, 0x4c, 0x69, 0x73, 0x74, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, + 0x69, 0x65, 0x73, 0x12, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x41, + 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, + 0x65, 0x73, 0x74, 0x1a, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x41, + 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x52, 0x65, 0x73, 0x70, + 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x32, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, + 0x93, 0x02, 0x25, 0x12, 0x23, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, + 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, + 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x12, 0x96, 0x01, 0x0a, 0x0e, 0x47, 0x65, 0x74, + 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x2b, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, + 0x76, 0x33, 0x2e, 0x47, 0x65, 0x74, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, + 0x79, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, + 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x22, 0x34, 0xda, 0x41, 0x04, + 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x27, 0x12, 0x25, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, - 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x12, - 0x96, 0x01, 0x0a, 0x0e, 0x47, 0x65, 0x74, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, - 0x63, 0x79, 0x12, 0x2b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x47, 0x65, 0x74, 0x41, 0x6c, 0x65, + 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, 0x2a, + 0x7d, 0x12, 0xb5, 0x01, 0x0a, 0x11, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, + 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x43, + 0x72, 0x65, 0x61, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, + 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, + 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x22, 0x4d, 0xda, 0x41, 0x11, 0x6e, + 0x61, 0x6d, 0x65, 0x2c, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, + 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x33, 0x3a, 0x0c, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, + 0x6c, 0x69, 0x63, 0x79, 0x22, 0x23, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, + 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, + 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x12, 0x91, 0x01, 0x0a, 0x11, 0x44, 0x65, + 0x6c, 0x65, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, + 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, - 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, - 0x63, 0x79, 0x22, 0x34, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, - 0x27, 0x12, 0x25, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, - 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, - 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, 0x2a, 0x7d, 0x12, 0xb5, 0x01, 0x0a, 0x11, 0x43, 0x72, 0x65, - 0x61, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x2e, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, - 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x21, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, - 0x79, 0x22, 0x4d, 0xda, 0x41, 0x11, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x61, 0x6c, 0x65, 0x72, 0x74, - 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x33, 0x3a, 0x0c, 0x61, - 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x22, 0x23, 0x2f, 0x76, 0x33, - 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, - 0x2a, 0x7d, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, - 0x12, 0x91, 0x01, 0x0a, 0x11, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, - 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x44, 0x65, - 0x6c, 0x65, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, - 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x22, 0x34, - 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x27, 0x2a, 0x25, 0x2f, - 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, - 0x73, 0x2f, 0x2a, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, - 0x73, 0x2f, 0x2a, 0x7d, 0x12, 0xcb, 0x01, 0x0a, 0x11, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x41, - 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, - 0x69, 0x63, 0x79, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x21, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x22, 0x63, 0xda, - 0x41, 0x18, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x2c, 0x61, 0x6c, - 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x42, - 0x3a, 0x0c, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x32, 0x32, - 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, - 0x79, 0x2e, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, - 0x2a, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, - 0x2a, 0x7d, 0x1a, 0xa9, 0x01, 0xca, 0x41, 0x19, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, - 0x6d, 0xd2, 0x41, 0x89, 0x01, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, - 0x61, 0x75, 0x74, 0x68, 0x2f, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2d, 0x70, 0x6c, 0x61, 0x74, 0x66, - 0x6f, 0x72, 0x6d, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, - 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2c, 0x68, - 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, - 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x72, 0x65, 0x61, 0x64, 0x42, 0xcc, - 0x01, 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x42, 0x11, 0x41, 0x6c, 0x65, - 0x72, 0x74, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, - 0x5a, 0x41, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, - 0x6f, 0x6d, 0x2f, 0x67, 0x6f, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, - 0x2f, 0x61, 0x70, 0x69, 0x76, 0x33, 0x2f, 0x76, 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0x3b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, - 0x67, 0x70, 0x62, 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, - 0x75, 0x64, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, - 0xca, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, - 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, - 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x3a, 0x3a, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, - 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x22, 0x34, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, + 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x27, 0x2a, 0x25, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, + 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x61, 0x6c, 0x65, + 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, 0x2a, 0x7d, 0x12, 0xcb, 0x01, + 0x0a, 0x11, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, + 0x69, 0x63, 0x79, 0x12, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x64, 0x61, 0x74, + 0x65, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x65, 0x71, 0x75, + 0x65, 0x73, 0x74, 0x1a, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x65, 0x72, 0x74, + 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x22, 0x63, 0xda, 0x41, 0x18, 0x75, 0x70, 0x64, 0x61, 0x74, + 0x65, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x2c, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, + 0x69, 0x63, 0x79, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x42, 0x3a, 0x0c, 0x61, 0x6c, 0x65, 0x72, 0x74, + 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x32, 0x32, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x61, 0x6c, + 0x65, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x6e, 0x61, 0x6d, 0x65, 0x3d, + 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x61, 0x6c, 0x65, 0x72, 0x74, + 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x2f, 0x2a, 0x7d, 0x1a, 0xa9, 0x01, 0xca, 0x41, + 0x19, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0xd2, 0x41, 0x89, 0x01, 0x68, 0x74, + 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x63, 0x6c, + 0x6f, 0x75, 0x64, 0x2d, 0x70, 0x6c, 0x61, 0x74, 0x66, 0x6f, 0x72, 0x6d, 0x2c, 0x68, 0x74, 0x74, + 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, + 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, + 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, + 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, + 0x6e, 0x67, 0x2e, 0x72, 0x65, 0x61, 0x64, 0x42, 0xcc, 0x01, 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x76, 0x33, 0x42, 0x11, 0x41, 0x6c, 0x65, 0x72, 0x74, 0x53, 0x65, 0x72, 0x76, 0x69, + 0x63, 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, 0x6c, 0x6f, 0x75, 0x64, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x67, 0x6f, 0x2f, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, 0x69, 0x76, 0x33, 0x2f, + 0x76, 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0x3b, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0xaa, 0x02, 0x1a, 0x47, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x69, 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x3a, + 0x3a, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, + 0x6e, 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( @@ -686,80 +676,6 @@ func file_google_monitoring_v3_alert_service_proto_init() { return } file_google_monitoring_v3_alert_proto_init() - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_alert_service_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*CreateAlertPolicyRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_service_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*GetAlertPolicyRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_service_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*ListAlertPoliciesRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_service_proto_msgTypes[3].Exporter = func(v any, i int) any { - switch v := v.(*ListAlertPoliciesResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_service_proto_msgTypes[4].Exporter = func(v any, i int) any { - switch v := v.(*UpdateAlertPolicyRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_alert_service_proto_msgTypes[5].Exporter = func(v any, i int) any { - switch v := v.(*DeleteAlertPolicyRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/common.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/common.pb.go index c9aa5a02472a1..e301262a2fa7f 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/common.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/common.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/common.proto @@ -558,11 +558,9 @@ type TypedValue struct { func (x *TypedValue) Reset() { *x = TypedValue{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_common_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_common_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *TypedValue) String() string { @@ -573,7 +571,7 @@ func (*TypedValue) ProtoMessage() {} func (x *TypedValue) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_common_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -724,11 +722,9 @@ type TimeInterval struct { func (x *TimeInterval) Reset() { *x = TimeInterval{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_common_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_common_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *TimeInterval) String() string { @@ -739,7 +735,7 @@ func (*TimeInterval) ProtoMessage() {} func (x *TimeInterval) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_common_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -864,11 +860,9 @@ type Aggregation struct { func (x *Aggregation) Reset() { *x = Aggregation{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_common_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_common_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Aggregation) String() string { @@ -879,7 +873,7 @@ func (*Aggregation) ProtoMessage() {} func (x *Aggregation) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_common_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1098,44 +1092,6 @@ func file_google_monitoring_v3_common_proto_init() { if File_google_monitoring_v3_common_proto != nil { return } - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_common_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*TypedValue); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_common_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*TimeInterval); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_common_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*Aggregation); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } file_google_monitoring_v3_common_proto_msgTypes[0].OneofWrappers = []any{ (*TypedValue_BoolValue)(nil), (*TypedValue_Int64Value)(nil), diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/dropped_labels.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/dropped_labels.pb.go index 7b1dc962da8ad..0dbf58e435163 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/dropped_labels.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/dropped_labels.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/dropped_labels.proto @@ -62,11 +62,9 @@ type DroppedLabels struct { func (x *DroppedLabels) Reset() { *x = DroppedLabels{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_dropped_labels_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_dropped_labels_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *DroppedLabels) String() string { @@ -77,7 +75,7 @@ func (*DroppedLabels) ProtoMessage() {} func (x *DroppedLabels) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_dropped_labels_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -162,20 +160,6 @@ func file_google_monitoring_v3_dropped_labels_proto_init() { if File_google_monitoring_v3_dropped_labels_proto != nil { return } - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_dropped_labels_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*DroppedLabels); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/group.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/group.pb.go index dff27f9d8ce2d..11d1a62d35b94 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/group.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/group.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/group.proto @@ -93,11 +93,9 @@ type Group struct { func (x *Group) Reset() { *x = Group{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_group_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_group_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Group) String() string { @@ -108,7 +106,7 @@ func (*Group) ProtoMessage() {} func (x *Group) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_group_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -230,20 +228,6 @@ func file_google_monitoring_v3_group_proto_init() { if File_google_monitoring_v3_group_proto != nil { return } - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_group_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*Group); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/group_service.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/group_service.pb.go index 46747d9064388..3cfa112bb450c 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/group_service.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/group_service.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/group_service.proto @@ -74,11 +74,9 @@ type ListGroupsRequest struct { func (x *ListGroupsRequest) Reset() { *x = ListGroupsRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_group_service_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_group_service_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListGroupsRequest) String() string { @@ -89,7 +87,7 @@ func (*ListGroupsRequest) ProtoMessage() {} func (x *ListGroupsRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_group_service_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -212,11 +210,9 @@ type ListGroupsResponse struct { func (x *ListGroupsResponse) Reset() { *x = ListGroupsResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_group_service_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_group_service_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListGroupsResponse) String() string { @@ -227,7 +223,7 @@ func (*ListGroupsResponse) ProtoMessage() {} func (x *ListGroupsResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_group_service_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -270,11 +266,9 @@ type GetGroupRequest struct { func (x *GetGroupRequest) Reset() { *x = GetGroupRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_group_service_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_group_service_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetGroupRequest) String() string { @@ -285,7 +279,7 @@ func (*GetGroupRequest) ProtoMessage() {} func (x *GetGroupRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_group_service_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -328,11 +322,9 @@ type CreateGroupRequest struct { func (x *CreateGroupRequest) Reset() { *x = CreateGroupRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_group_service_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_group_service_proto_msgTypes[3] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateGroupRequest) String() string { @@ -343,7 +335,7 @@ func (*CreateGroupRequest) ProtoMessage() {} func (x *CreateGroupRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_group_service_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -395,11 +387,9 @@ type UpdateGroupRequest struct { func (x *UpdateGroupRequest) Reset() { *x = UpdateGroupRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_group_service_proto_msgTypes[4] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_group_service_proto_msgTypes[4] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UpdateGroupRequest) String() string { @@ -410,7 +400,7 @@ func (*UpdateGroupRequest) ProtoMessage() {} func (x *UpdateGroupRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_group_service_proto_msgTypes[4] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -458,11 +448,9 @@ type DeleteGroupRequest struct { func (x *DeleteGroupRequest) Reset() { *x = DeleteGroupRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_group_service_proto_msgTypes[5] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_group_service_proto_msgTypes[5] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *DeleteGroupRequest) String() string { @@ -473,7 +461,7 @@ func (*DeleteGroupRequest) ProtoMessage() {} func (x *DeleteGroupRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_group_service_proto_msgTypes[5] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -536,11 +524,9 @@ type ListGroupMembersRequest struct { func (x *ListGroupMembersRequest) Reset() { *x = ListGroupMembersRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_group_service_proto_msgTypes[6] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_group_service_proto_msgTypes[6] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListGroupMembersRequest) String() string { @@ -551,7 +537,7 @@ func (*ListGroupMembersRequest) ProtoMessage() {} func (x *ListGroupMembersRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_group_service_proto_msgTypes[6] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -619,11 +605,9 @@ type ListGroupMembersResponse struct { func (x *ListGroupMembersResponse) Reset() { *x = ListGroupMembersResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_group_service_proto_msgTypes[7] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_group_service_proto_msgTypes[7] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListGroupMembersResponse) String() string { @@ -634,7 +618,7 @@ func (*ListGroupMembersResponse) ProtoMessage() {} func (x *ListGroupMembersResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_group_service_proto_msgTypes[7] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -921,104 +905,6 @@ func file_google_monitoring_v3_group_service_proto_init() { } file_google_monitoring_v3_common_proto_init() file_google_monitoring_v3_group_proto_init() - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_group_service_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*ListGroupsRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_group_service_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*ListGroupsResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_group_service_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*GetGroupRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_group_service_proto_msgTypes[3].Exporter = func(v any, i int) any { - switch v := v.(*CreateGroupRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_group_service_proto_msgTypes[4].Exporter = func(v any, i int) any { - switch v := v.(*UpdateGroupRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_group_service_proto_msgTypes[5].Exporter = func(v any, i int) any { - switch v := v.(*DeleteGroupRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_group_service_proto_msgTypes[6].Exporter = func(v any, i int) any { - switch v := v.(*ListGroupMembersRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_group_service_proto_msgTypes[7].Exporter = func(v any, i int) any { - switch v := v.(*ListGroupMembersResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } file_google_monitoring_v3_group_service_proto_msgTypes[0].OneofWrappers = []any{ (*ListGroupsRequest_ChildrenOfGroup)(nil), (*ListGroupsRequest_AncestorsOfGroup)(nil), diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/metric.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/metric.pb.go index b22c22d07e551..1961a1e3a5c6f 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/metric.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/metric.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/metric.proto @@ -60,11 +60,9 @@ type Point struct { func (x *Point) Reset() { *x = Point{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Point) String() string { @@ -75,7 +73,7 @@ func (*Point) ProtoMessage() {} func (x *Point) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -153,17 +151,21 @@ type TimeSeries struct { Points []*Point `protobuf:"bytes,5,rep,name=points,proto3" json:"points,omitempty"` // The units in which the metric value is reported. It is only applicable // if the `value_type` is `INT64`, `DOUBLE`, or `DISTRIBUTION`. The `unit` - // defines the representation of the stored metric values. + // defines the representation of the stored metric values. This field can only + // be changed through CreateTimeSeries when it is empty. Unit string `protobuf:"bytes,8,opt,name=unit,proto3" json:"unit,omitempty"` + // Input only. A detailed description of the time series that will be + // associated with the + // [google.api.MetricDescriptor][google.api.MetricDescriptor] for the metric. + // Once set, this field cannot be changed through CreateTimeSeries. + Description string `protobuf:"bytes,9,opt,name=description,proto3" json:"description,omitempty"` } func (x *TimeSeries) Reset() { *x = TimeSeries{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *TimeSeries) String() string { @@ -174,7 +176,7 @@ func (*TimeSeries) ProtoMessage() {} func (x *TimeSeries) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -238,6 +240,13 @@ func (x *TimeSeries) GetUnit() string { return "" } +func (x *TimeSeries) GetDescription() string { + if x != nil { + return x.Description + } + return "" +} + // A descriptor for the labels and points in a time series. type TimeSeriesDescriptor struct { state protoimpl.MessageState @@ -252,11 +261,9 @@ type TimeSeriesDescriptor struct { func (x *TimeSeriesDescriptor) Reset() { *x = TimeSeriesDescriptor{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *TimeSeriesDescriptor) String() string { @@ -267,7 +274,7 @@ func (*TimeSeriesDescriptor) ProtoMessage() {} func (x *TimeSeriesDescriptor) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -314,11 +321,9 @@ type TimeSeriesData struct { func (x *TimeSeriesData) Reset() { *x = TimeSeriesData{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_proto_msgTypes[3] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *TimeSeriesData) String() string { @@ -329,7 +334,7 @@ func (*TimeSeriesData) ProtoMessage() {} func (x *TimeSeriesData) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -376,11 +381,9 @@ type LabelValue struct { func (x *LabelValue) Reset() { *x = LabelValue{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_proto_msgTypes[4] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_proto_msgTypes[4] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *LabelValue) String() string { @@ -391,7 +394,7 @@ func (*LabelValue) ProtoMessage() {} func (x *LabelValue) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_proto_msgTypes[4] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -474,11 +477,9 @@ type QueryError struct { func (x *QueryError) Reset() { *x = QueryError{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_proto_msgTypes[5] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_proto_msgTypes[5] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *QueryError) String() string { @@ -489,7 +490,7 @@ func (*QueryError) ProtoMessage() {} func (x *QueryError) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_proto_msgTypes[5] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -571,11 +572,9 @@ type TextLocator struct { func (x *TextLocator) Reset() { *x = TextLocator{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_proto_msgTypes[6] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_proto_msgTypes[6] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *TextLocator) String() string { @@ -586,7 +585,7 @@ func (*TextLocator) ProtoMessage() {} func (x *TextLocator) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_proto_msgTypes[6] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -657,11 +656,9 @@ type TimeSeriesDescriptor_ValueDescriptor struct { func (x *TimeSeriesDescriptor_ValueDescriptor) Reset() { *x = TimeSeriesDescriptor_ValueDescriptor{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_proto_msgTypes[7] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_proto_msgTypes[7] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *TimeSeriesDescriptor_ValueDescriptor) String() string { @@ -672,7 +669,7 @@ func (*TimeSeriesDescriptor_ValueDescriptor) ProtoMessage() {} func (x *TimeSeriesDescriptor_ValueDescriptor) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_proto_msgTypes[7] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -731,11 +728,9 @@ type TimeSeriesData_PointData struct { func (x *TimeSeriesData_PointData) Reset() { *x = TimeSeriesData_PointData{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_proto_msgTypes[8] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_proto_msgTypes[8] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *TimeSeriesData_PointData) String() string { @@ -746,7 +741,7 @@ func (*TimeSeriesData_PointData) ProtoMessage() {} func (x *TimeSeriesData_PointData) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_proto_msgTypes[8] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -790,11 +785,9 @@ type TextLocator_Position struct { func (x *TextLocator_Position) Reset() { *x = TextLocator_Position{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_proto_msgTypes[9] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_proto_msgTypes[9] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *TextLocator_Position) String() string { @@ -805,7 +798,7 @@ func (*TextLocator_Position) ProtoMessage() {} func (x *TextLocator_Position) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_proto_msgTypes[9] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -856,7 +849,7 @@ var file_google_monitoring_v3_metric_proto_rawDesc = []byte{ 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x79, 0x70, 0x65, 0x64, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x05, 0x76, 0x61, - 0x6c, 0x75, 0x65, 0x22, 0x90, 0x03, 0x0a, 0x0a, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, + 0x6c, 0x75, 0x65, 0x22, 0xb2, 0x03, 0x0a, 0x0a, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0x2a, 0x0a, 0x06, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x52, 0x06, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x12, 0x39, @@ -881,102 +874,104 @@ var file_google_monitoring_v3_metric_proto_rawDesc = []byte{ 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x6f, 0x69, 0x6e, 0x74, 0x52, 0x06, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x73, 0x12, 0x12, 0x0a, 0x04, 0x75, 0x6e, 0x69, 0x74, 0x18, 0x08, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x04, 0x75, 0x6e, 0x69, 0x74, 0x22, 0x94, 0x03, 0x0a, 0x14, 0x54, 0x69, 0x6d, 0x65, 0x53, - 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, - 0x48, 0x0a, 0x11, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, - 0x74, 0x6f, 0x72, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x44, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x10, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x44, 0x65, - 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0x67, 0x0a, 0x11, 0x70, 0x6f, 0x69, - 0x6e, 0x74, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x18, 0x05, - 0x20, 0x03, 0x28, 0x0b, 0x32, 0x3a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, - 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, - 0x2e, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, - 0x52, 0x10, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, - 0x72, 0x73, 0x1a, 0xc8, 0x01, 0x0a, 0x0f, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x44, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x45, 0x0a, 0x0a, 0x76, 0x61, 0x6c, 0x75, - 0x65, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x26, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, - 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x2e, 0x56, 0x61, 0x6c, 0x75, 0x65, - 0x54, 0x79, 0x70, 0x65, 0x52, 0x09, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x54, 0x79, 0x70, 0x65, 0x12, - 0x48, 0x0a, 0x0b, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x6b, 0x69, 0x6e, 0x64, 0x18, 0x03, - 0x20, 0x01, 0x28, 0x0e, 0x32, 0x27, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, - 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, - 0x6f, 0x72, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x4b, 0x69, 0x6e, 0x64, 0x52, 0x0a, 0x6d, - 0x65, 0x74, 0x72, 0x69, 0x63, 0x4b, 0x69, 0x6e, 0x64, 0x12, 0x12, 0x0a, 0x04, 0x75, 0x6e, 0x69, - 0x74, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x75, 0x6e, 0x69, 0x74, 0x22, 0xb5, 0x02, - 0x0a, 0x0e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x61, 0x74, 0x61, - 0x12, 0x43, 0x0a, 0x0c, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x73, - 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x61, - 0x62, 0x65, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x0b, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x56, - 0x61, 0x6c, 0x75, 0x65, 0x73, 0x12, 0x4d, 0x0a, 0x0a, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x5f, 0x64, - 0x61, 0x74, 0x61, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, - 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x61, 0x74, 0x61, 0x2e, - 0x50, 0x6f, 0x69, 0x6e, 0x74, 0x44, 0x61, 0x74, 0x61, 0x52, 0x09, 0x70, 0x6f, 0x69, 0x6e, 0x74, - 0x44, 0x61, 0x74, 0x61, 0x1a, 0x8e, 0x01, 0x0a, 0x09, 0x50, 0x6f, 0x69, 0x6e, 0x74, 0x44, 0x61, - 0x74, 0x61, 0x12, 0x38, 0x0a, 0x06, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x73, 0x18, 0x01, 0x20, 0x03, - 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x79, 0x70, 0x65, 0x64, 0x56, - 0x61, 0x6c, 0x75, 0x65, 0x52, 0x06, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x73, 0x12, 0x47, 0x0a, 0x0d, - 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x18, 0x02, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x49, - 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x52, 0x0c, 0x74, 0x69, 0x6d, 0x65, 0x49, 0x6e, 0x74, - 0x65, 0x72, 0x76, 0x61, 0x6c, 0x22, 0x7e, 0x0a, 0x0a, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x56, 0x61, - 0x6c, 0x75, 0x65, 0x12, 0x1f, 0x0a, 0x0a, 0x62, 0x6f, 0x6f, 0x6c, 0x5f, 0x76, 0x61, 0x6c, 0x75, - 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x48, 0x00, 0x52, 0x09, 0x62, 0x6f, 0x6f, 0x6c, 0x56, - 0x61, 0x6c, 0x75, 0x65, 0x12, 0x21, 0x0a, 0x0b, 0x69, 0x6e, 0x74, 0x36, 0x34, 0x5f, 0x76, 0x61, - 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x0a, 0x69, 0x6e, 0x74, - 0x36, 0x34, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x23, 0x0a, 0x0c, 0x73, 0x74, 0x72, 0x69, 0x6e, - 0x67, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x48, 0x00, 0x52, - 0x0b, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x07, 0x0a, 0x05, - 0x76, 0x61, 0x6c, 0x75, 0x65, 0x22, 0x63, 0x0a, 0x0a, 0x51, 0x75, 0x65, 0x72, 0x79, 0x45, 0x72, - 0x72, 0x6f, 0x72, 0x12, 0x3b, 0x0a, 0x07, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x65, 0x78, 0x74, - 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x52, 0x07, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, - 0x12, 0x18, 0x0a, 0x07, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x07, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x22, 0xf0, 0x02, 0x0a, 0x0b, 0x54, - 0x65, 0x78, 0x74, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x12, 0x16, 0x0a, 0x06, 0x73, 0x6f, - 0x75, 0x72, 0x63, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x73, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x12, 0x51, 0x0a, 0x0e, 0x73, 0x74, 0x61, 0x72, 0x74, 0x5f, 0x70, 0x6f, 0x73, 0x69, - 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x54, 0x65, 0x78, 0x74, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x2e, 0x50, 0x6f, - 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0d, 0x73, 0x74, 0x61, 0x72, 0x74, 0x50, 0x6f, 0x73, - 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4d, 0x0a, 0x0c, 0x65, 0x6e, 0x64, 0x5f, 0x70, 0x6f, 0x73, - 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x67, 0x6f, + 0x52, 0x04, 0x75, 0x6e, 0x69, 0x74, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, + 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x09, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, + 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x94, 0x03, 0x0a, 0x14, 0x54, 0x69, 0x6d, + 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, + 0x72, 0x12, 0x48, 0x0a, 0x11, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, + 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x44, + 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x10, 0x6c, 0x61, 0x62, 0x65, 0x6c, + 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0x67, 0x0a, 0x11, 0x70, + 0x6f, 0x69, 0x6e, 0x74, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, + 0x18, 0x05, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x3a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, + 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, + 0x6f, 0x72, 0x2e, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, + 0x6f, 0x72, 0x52, 0x10, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x73, 0x1a, 0xc8, 0x01, 0x0a, 0x0f, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x44, 0x65, + 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, + 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x45, 0x0a, 0x0a, 0x76, 0x61, + 0x6c, 0x75, 0x65, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x26, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, + 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x2e, 0x56, 0x61, 0x6c, + 0x75, 0x65, 0x54, 0x79, 0x70, 0x65, 0x52, 0x09, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x54, 0x79, 0x70, + 0x65, 0x12, 0x48, 0x0a, 0x0b, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x6b, 0x69, 0x6e, 0x64, + 0x18, 0x03, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x27, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, + 0x70, 0x74, 0x6f, 0x72, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x4b, 0x69, 0x6e, 0x64, 0x52, + 0x0a, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x4b, 0x69, 0x6e, 0x64, 0x12, 0x12, 0x0a, 0x04, 0x75, + 0x6e, 0x69, 0x74, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x75, 0x6e, 0x69, 0x74, 0x22, + 0xb5, 0x02, 0x0a, 0x0e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x61, + 0x74, 0x61, 0x12, 0x43, 0x0a, 0x0c, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x5f, 0x76, 0x61, 0x6c, 0x75, + 0x65, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, + 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x0b, 0x6c, 0x61, 0x62, 0x65, + 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x73, 0x12, 0x4d, 0x0a, 0x0a, 0x70, 0x6f, 0x69, 0x6e, 0x74, + 0x5f, 0x64, 0x61, 0x74, 0x61, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, - 0x76, 0x33, 0x2e, 0x54, 0x65, 0x78, 0x74, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x2e, 0x50, - 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0b, 0x65, 0x6e, 0x64, 0x50, 0x6f, 0x73, 0x69, - 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x48, 0x0a, 0x0e, 0x6e, 0x65, 0x73, 0x74, 0x65, 0x64, 0x5f, 0x6c, - 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, + 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x61, 0x74, + 0x61, 0x2e, 0x50, 0x6f, 0x69, 0x6e, 0x74, 0x44, 0x61, 0x74, 0x61, 0x52, 0x09, 0x70, 0x6f, 0x69, + 0x6e, 0x74, 0x44, 0x61, 0x74, 0x61, 0x1a, 0x8e, 0x01, 0x0a, 0x09, 0x50, 0x6f, 0x69, 0x6e, 0x74, + 0x44, 0x61, 0x74, 0x61, 0x12, 0x38, 0x0a, 0x06, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x73, 0x18, 0x01, + 0x20, 0x03, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x79, 0x70, 0x65, + 0x64, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x06, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x73, 0x12, 0x47, + 0x0a, 0x0d, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x18, + 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, + 0x65, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x52, 0x0c, 0x74, 0x69, 0x6d, 0x65, 0x49, + 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x22, 0x7e, 0x0a, 0x0a, 0x4c, 0x61, 0x62, 0x65, 0x6c, + 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x1f, 0x0a, 0x0a, 0x62, 0x6f, 0x6f, 0x6c, 0x5f, 0x76, 0x61, + 0x6c, 0x75, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x48, 0x00, 0x52, 0x09, 0x62, 0x6f, 0x6f, + 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x21, 0x0a, 0x0b, 0x69, 0x6e, 0x74, 0x36, 0x34, 0x5f, + 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x0a, 0x69, + 0x6e, 0x74, 0x36, 0x34, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x23, 0x0a, 0x0c, 0x73, 0x74, 0x72, + 0x69, 0x6e, 0x67, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x48, + 0x00, 0x52, 0x0b, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x07, + 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x22, 0x63, 0x0a, 0x0a, 0x51, 0x75, 0x65, 0x72, 0x79, + 0x45, 0x72, 0x72, 0x6f, 0x72, 0x12, 0x3b, 0x0a, 0x07, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x65, + 0x78, 0x74, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x52, 0x07, 0x6c, 0x6f, 0x63, 0x61, 0x74, + 0x6f, 0x72, 0x12, 0x18, 0x0a, 0x07, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x18, 0x02, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x07, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x22, 0xf0, 0x02, 0x0a, + 0x0b, 0x54, 0x65, 0x78, 0x74, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x12, 0x16, 0x0a, 0x06, + 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x73, 0x6f, + 0x75, 0x72, 0x63, 0x65, 0x12, 0x51, 0x0a, 0x0e, 0x73, 0x74, 0x61, 0x72, 0x74, 0x5f, 0x70, 0x6f, + 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, - 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x65, 0x78, 0x74, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x52, - 0x0d, 0x6e, 0x65, 0x73, 0x74, 0x65, 0x64, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x12, 0x25, - 0x0a, 0x0e, 0x6e, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x5f, 0x72, 0x65, 0x61, 0x73, 0x6f, 0x6e, - 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x6e, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x52, - 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x1a, 0x36, 0x0a, 0x08, 0x50, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, - 0x6e, 0x12, 0x12, 0x0a, 0x04, 0x6c, 0x69, 0x6e, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, - 0x04, 0x6c, 0x69, 0x6e, 0x65, 0x12, 0x16, 0x0a, 0x06, 0x63, 0x6f, 0x6c, 0x75, 0x6d, 0x6e, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x06, 0x63, 0x6f, 0x6c, 0x75, 0x6d, 0x6e, 0x42, 0xc6, 0x01, - 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x42, 0x0b, 0x4d, 0x65, 0x74, 0x72, - 0x69, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, 0x6c, 0x6f, 0x75, 0x64, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x67, 0x6f, 0x2f, 0x6d, - 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, 0x69, 0x76, 0x33, 0x2f, - 0x76, 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0x3b, - 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0xaa, 0x02, 0x1a, 0x47, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x69, 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x3a, - 0x3a, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x65, 0x78, 0x74, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x2e, + 0x50, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0d, 0x73, 0x74, 0x61, 0x72, 0x74, 0x50, + 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4d, 0x0a, 0x0c, 0x65, 0x6e, 0x64, 0x5f, 0x70, + 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x65, 0x78, 0x74, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, + 0x2e, 0x50, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0b, 0x65, 0x6e, 0x64, 0x50, 0x6f, + 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x48, 0x0a, 0x0e, 0x6e, 0x65, 0x73, 0x74, 0x65, 0x64, + 0x5f, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, + 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x65, 0x78, 0x74, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, + 0x72, 0x52, 0x0d, 0x6e, 0x65, 0x73, 0x74, 0x65, 0x64, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x6f, 0x72, + 0x12, 0x25, 0x0a, 0x0e, 0x6e, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x5f, 0x72, 0x65, 0x61, 0x73, + 0x6f, 0x6e, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x6e, 0x65, 0x73, 0x74, 0x69, 0x6e, + 0x67, 0x52, 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x1a, 0x36, 0x0a, 0x08, 0x50, 0x6f, 0x73, 0x69, 0x74, + 0x69, 0x6f, 0x6e, 0x12, 0x12, 0x0a, 0x04, 0x6c, 0x69, 0x6e, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x05, 0x52, 0x04, 0x6c, 0x69, 0x6e, 0x65, 0x12, 0x16, 0x0a, 0x06, 0x63, 0x6f, 0x6c, 0x75, 0x6d, + 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x06, 0x63, 0x6f, 0x6c, 0x75, 0x6d, 0x6e, 0x42, + 0xc6, 0x01, 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x42, 0x0b, 0x4d, 0x65, + 0x74, 0x72, 0x69, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, 0x6c, 0x6f, + 0x75, 0x64, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x67, 0x6f, + 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, 0x69, 0x76, + 0x33, 0x2f, 0x76, 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, + 0x62, 0x3b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0xaa, 0x02, + 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x4d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, 0x47, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x3a, 0x3a, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, + 0x72, 0x69, 0x6e, 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( @@ -1046,128 +1041,6 @@ func file_google_monitoring_v3_metric_proto_init() { return } file_google_monitoring_v3_common_proto_init() - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_metric_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*Point); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*TimeSeries); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*TimeSeriesDescriptor); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_proto_msgTypes[3].Exporter = func(v any, i int) any { - switch v := v.(*TimeSeriesData); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_proto_msgTypes[4].Exporter = func(v any, i int) any { - switch v := v.(*LabelValue); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_proto_msgTypes[5].Exporter = func(v any, i int) any { - switch v := v.(*QueryError); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_proto_msgTypes[6].Exporter = func(v any, i int) any { - switch v := v.(*TextLocator); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_proto_msgTypes[7].Exporter = func(v any, i int) any { - switch v := v.(*TimeSeriesDescriptor_ValueDescriptor); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_proto_msgTypes[8].Exporter = func(v any, i int) any { - switch v := v.(*TimeSeriesData_PointData); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_proto_msgTypes[9].Exporter = func(v any, i int) any { - switch v := v.(*TextLocator_Position); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } file_google_monitoring_v3_metric_proto_msgTypes[4].OneofWrappers = []any{ (*LabelValue_BoolValue)(nil), (*LabelValue_Int64Value)(nil), diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/metric_service.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/metric_service.pb.go index 52e1c1e0b9baf..6a83fea93de16 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/metric_service.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/metric_service.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/metric_service.proto @@ -124,11 +124,9 @@ type ListMonitoredResourceDescriptorsRequest struct { func (x *ListMonitoredResourceDescriptorsRequest) Reset() { *x = ListMonitoredResourceDescriptorsRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListMonitoredResourceDescriptorsRequest) String() string { @@ -139,7 +137,7 @@ func (*ListMonitoredResourceDescriptorsRequest) ProtoMessage() {} func (x *ListMonitoredResourceDescriptorsRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -199,11 +197,9 @@ type ListMonitoredResourceDescriptorsResponse struct { func (x *ListMonitoredResourceDescriptorsResponse) Reset() { *x = ListMonitoredResourceDescriptorsResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListMonitoredResourceDescriptorsResponse) String() string { @@ -214,7 +210,7 @@ func (*ListMonitoredResourceDescriptorsResponse) ProtoMessage() {} func (x *ListMonitoredResourceDescriptorsResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -260,11 +256,9 @@ type GetMonitoredResourceDescriptorRequest struct { func (x *GetMonitoredResourceDescriptorRequest) Reset() { *x = GetMonitoredResourceDescriptorRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetMonitoredResourceDescriptorRequest) String() string { @@ -275,7 +269,7 @@ func (*GetMonitoredResourceDescriptorRequest) ProtoMessage() {} func (x *GetMonitoredResourceDescriptorRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -309,7 +303,7 @@ type ListMetricDescriptorsRequest struct { // // projects/[PROJECT_ID_OR_NUMBER] Name string `protobuf:"bytes,5,opt,name=name,proto3" json:"name,omitempty"` - // If this field is empty, all custom and + // Optional. If this field is empty, all custom and // system-defined metric descriptors are returned. // Otherwise, the [filter](https://cloud.google.com/monitoring/api/v3/filters) // specifies which metric descriptors are to be @@ -318,23 +312,22 @@ type ListMetricDescriptorsRequest struct { // // metric.type = starts_with("custom.googleapis.com/") Filter string `protobuf:"bytes,2,opt,name=filter,proto3" json:"filter,omitempty"` - // A positive number that is the maximum number of results to return. The - // default and maximum value is 10,000. If a page_size <= 0 or > 10,000 is - // submitted, will instead return a maximum of 10,000 results. + // Optional. A positive number that is the maximum number of results to + // return. The default and maximum value is 10,000. If a page_size <= 0 or > + // 10,000 is submitted, will instead return a maximum of 10,000 results. PageSize int32 `protobuf:"varint,3,opt,name=page_size,json=pageSize,proto3" json:"page_size,omitempty"` - // If this field is not empty then it must contain the `nextPageToken` value - // returned by a previous call to this method. Using this field causes the - // method to return additional results from the previous method call. + // Optional. If this field is not empty then it must contain the + // `nextPageToken` value returned by a previous call to this method. Using + // this field causes the method to return additional results from the previous + // method call. PageToken string `protobuf:"bytes,4,opt,name=page_token,json=pageToken,proto3" json:"page_token,omitempty"` } func (x *ListMetricDescriptorsRequest) Reset() { *x = ListMetricDescriptorsRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[3] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListMetricDescriptorsRequest) String() string { @@ -345,7 +338,7 @@ func (*ListMetricDescriptorsRequest) ProtoMessage() {} func (x *ListMetricDescriptorsRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -405,11 +398,9 @@ type ListMetricDescriptorsResponse struct { func (x *ListMetricDescriptorsResponse) Reset() { *x = ListMetricDescriptorsResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[4] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[4] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListMetricDescriptorsResponse) String() string { @@ -420,7 +411,7 @@ func (*ListMetricDescriptorsResponse) ProtoMessage() {} func (x *ListMetricDescriptorsResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[4] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -467,11 +458,9 @@ type GetMetricDescriptorRequest struct { func (x *GetMetricDescriptorRequest) Reset() { *x = GetMetricDescriptorRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[5] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[5] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetMetricDescriptorRequest) String() string { @@ -482,7 +471,7 @@ func (*GetMetricDescriptorRequest) ProtoMessage() {} func (x *GetMetricDescriptorRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[5] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -524,11 +513,9 @@ type CreateMetricDescriptorRequest struct { func (x *CreateMetricDescriptorRequest) Reset() { *x = CreateMetricDescriptorRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[6] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[6] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateMetricDescriptorRequest) String() string { @@ -539,7 +526,7 @@ func (*CreateMetricDescriptorRequest) ProtoMessage() {} func (x *CreateMetricDescriptorRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[6] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -586,11 +573,9 @@ type DeleteMetricDescriptorRequest struct { func (x *DeleteMetricDescriptorRequest) Reset() { *x = DeleteMetricDescriptorRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[7] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[7] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *DeleteMetricDescriptorRequest) String() string { @@ -601,7 +586,7 @@ func (*DeleteMetricDescriptorRequest) ProtoMessage() {} func (x *DeleteMetricDescriptorRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[7] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -678,11 +663,9 @@ type ListTimeSeriesRequest struct { func (x *ListTimeSeriesRequest) Reset() { *x = ListTimeSeriesRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[8] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[8] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListTimeSeriesRequest) String() string { @@ -693,7 +676,7 @@ func (*ListTimeSeriesRequest) ProtoMessage() {} func (x *ListTimeSeriesRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[8] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -797,11 +780,9 @@ type ListTimeSeriesResponse struct { func (x *ListTimeSeriesResponse) Reset() { *x = ListTimeSeriesResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[9] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[9] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListTimeSeriesResponse) String() string { @@ -812,7 +793,7 @@ func (*ListTimeSeriesResponse) ProtoMessage() {} func (x *ListTimeSeriesResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[9] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -879,11 +860,9 @@ type CreateTimeSeriesRequest struct { func (x *CreateTimeSeriesRequest) Reset() { *x = CreateTimeSeriesRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[10] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[10] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateTimeSeriesRequest) String() string { @@ -894,7 +873,7 @@ func (*CreateTimeSeriesRequest) ProtoMessage() {} func (x *CreateTimeSeriesRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[10] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -941,11 +920,9 @@ type CreateTimeSeriesError struct { func (x *CreateTimeSeriesError) Reset() { *x = CreateTimeSeriesError{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[11] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[11] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateTimeSeriesError) String() string { @@ -956,7 +933,7 @@ func (*CreateTimeSeriesError) ProtoMessage() {} func (x *CreateTimeSeriesError) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[11] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1003,11 +980,9 @@ type CreateTimeSeriesSummary struct { func (x *CreateTimeSeriesSummary) Reset() { *x = CreateTimeSeriesSummary{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[12] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[12] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateTimeSeriesSummary) String() string { @@ -1018,7 +993,7 @@ func (*CreateTimeSeriesSummary) ProtoMessage() {} func (x *CreateTimeSeriesSummary) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[12] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1054,7 +1029,11 @@ func (x *CreateTimeSeriesSummary) GetErrors() []*CreateTimeSeriesSummary_Error { return nil } -// The `QueryTimeSeries` request. +// The `QueryTimeSeries` request. For information about the status of +// Monitoring Query Language (MQL), see the [MQL deprecation +// notice](https://cloud.google.com/stackdriver/docs/deprecations/mql). +// +// Deprecated: Marked as deprecated in google/monitoring/v3/metric_service.proto. type QueryTimeSeriesRequest struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -1080,11 +1059,9 @@ type QueryTimeSeriesRequest struct { func (x *QueryTimeSeriesRequest) Reset() { *x = QueryTimeSeriesRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[13] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[13] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *QueryTimeSeriesRequest) String() string { @@ -1095,7 +1072,7 @@ func (*QueryTimeSeriesRequest) ProtoMessage() {} func (x *QueryTimeSeriesRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[13] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1138,7 +1115,11 @@ func (x *QueryTimeSeriesRequest) GetPageToken() string { return "" } -// The `QueryTimeSeries` response. +// The `QueryTimeSeries` response. For information about the status of +// Monitoring Query Language (MQL), see the [MQL deprecation +// notice](https://cloud.google.com/stackdriver/docs/deprecations/mql). +// +// Deprecated: Marked as deprecated in google/monitoring/v3/metric_service.proto. type QueryTimeSeriesResponse struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -1160,11 +1141,9 @@ type QueryTimeSeriesResponse struct { func (x *QueryTimeSeriesResponse) Reset() { *x = QueryTimeSeriesResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[14] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[14] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *QueryTimeSeriesResponse) String() string { @@ -1175,7 +1154,7 @@ func (*QueryTimeSeriesResponse) ProtoMessage() {} func (x *QueryTimeSeriesResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[14] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1233,11 +1212,9 @@ type QueryErrorList struct { func (x *QueryErrorList) Reset() { *x = QueryErrorList{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[15] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[15] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *QueryErrorList) String() string { @@ -1248,7 +1225,7 @@ func (*QueryErrorList) ProtoMessage() {} func (x *QueryErrorList) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[15] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1291,11 +1268,9 @@ type CreateTimeSeriesSummary_Error struct { func (x *CreateTimeSeriesSummary_Error) Reset() { *x = CreateTimeSeriesSummary_Error{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[16] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[16] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateTimeSeriesSummary_Error) String() string { @@ -1306,7 +1281,7 @@ func (*CreateTimeSeriesSummary_Error) ProtoMessage() {} func (x *CreateTimeSeriesSummary_Error) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_metric_service_proto_msgTypes[16] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1392,363 +1367,365 @@ var file_google_monitoring_v3_metric_service_proto_rawDesc = []byte{ 0x37, 0x0a, 0x35, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, - 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0xba, + 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0xc9, 0x01, 0x0a, 0x1c, 0x4c, 0x69, 0x73, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x46, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x42, 0x32, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2c, 0x12, 0x2a, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, - 0x72, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x16, 0x0a, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, - 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, - 0x1b, 0x0a, 0x09, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x03, 0x20, 0x01, - 0x28, 0x05, 0x52, 0x08, 0x70, 0x61, 0x67, 0x65, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x1d, 0x0a, 0x0a, - 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x09, 0x70, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x22, 0x94, 0x01, 0x0a, 0x1d, - 0x4c, 0x69, 0x73, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, - 0x70, 0x74, 0x6f, 0x72, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x4b, 0x0a, - 0x12, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, - 0x6f, 0x72, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x11, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, - 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0x26, 0x0a, 0x0f, 0x6e, 0x65, - 0x78, 0x74, 0x5f, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x02, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x0d, 0x6e, 0x65, 0x78, 0x74, 0x50, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, - 0x65, 0x6e, 0x22, 0x64, 0x0a, 0x1a, 0x47, 0x65, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, - 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, - 0x12, 0x46, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x32, - 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2c, 0x0a, 0x2a, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, - 0x6d, 0x2f, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, - 0x6f, 0x72, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0xb7, 0x01, 0x0a, 0x1d, 0x43, 0x72, 0x65, - 0x61, 0x74, 0x65, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, - 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x46, 0x0a, 0x04, 0x6e, 0x61, - 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x32, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2c, - 0x12, 0x2a, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4d, 0x65, 0x74, 0x72, - 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x04, 0x6e, 0x61, - 0x6d, 0x65, 0x12, 0x4e, 0x0a, 0x11, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, - 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x42, 0x03, 0xe0, 0x41, 0x02, - 0x52, 0x10, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, - 0x6f, 0x72, 0x22, 0x67, 0x0a, 0x1d, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x4d, 0x65, 0x74, 0x72, - 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, - 0x65, 0x73, 0x74, 0x12, 0x46, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, - 0x09, 0x42, 0x32, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2c, 0x0a, 0x2a, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, - 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, - 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0xad, 0x04, 0x0a, 0x15, - 0x4c, 0x69, 0x73, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, - 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x40, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x0a, 0x20, - 0x01, 0x28, 0x09, 0x42, 0x2c, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x26, 0x12, 0x24, 0x6d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, - 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, - 0x73, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x1b, 0x0a, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, - 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x66, 0x69, - 0x6c, 0x74, 0x65, 0x72, 0x12, 0x43, 0x0a, 0x08, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, - 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, - 0x6d, 0x65, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, - 0x08, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x12, 0x43, 0x0a, 0x0b, 0x61, 0x67, 0x67, - 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x52, 0x0b, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x56, - 0x0a, 0x15, 0x73, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x61, 0x72, 0x79, 0x5f, 0x61, 0x67, 0x67, 0x72, - 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, - 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x52, 0x14, 0x73, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x61, 0x72, 0x79, 0x41, 0x67, 0x67, 0x72, 0x65, - 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x19, 0x0a, 0x08, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x5f, - 0x62, 0x79, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x42, - 0x79, 0x12, 0x53, 0x0a, 0x04, 0x76, 0x69, 0x65, 0x77, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0e, 0x32, - 0x3a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x53, - 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x2e, 0x54, 0x69, 0x6d, - 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x56, 0x69, 0x65, 0x77, 0x42, 0x03, 0xe0, 0x41, 0x02, - 0x52, 0x04, 0x76, 0x69, 0x65, 0x77, 0x12, 0x1b, 0x0a, 0x09, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x73, - 0x69, 0x7a, 0x65, 0x18, 0x08, 0x20, 0x01, 0x28, 0x05, 0x52, 0x08, 0x70, 0x61, 0x67, 0x65, 0x53, - 0x69, 0x7a, 0x65, 0x12, 0x1d, 0x0a, 0x0a, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, - 0x6e, 0x18, 0x09, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x70, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, - 0x65, 0x6e, 0x22, 0x27, 0x0a, 0x0e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, - 0x56, 0x69, 0x65, 0x77, 0x12, 0x08, 0x0a, 0x04, 0x46, 0x55, 0x4c, 0x4c, 0x10, 0x00, 0x12, 0x0b, - 0x0a, 0x07, 0x48, 0x45, 0x41, 0x44, 0x45, 0x52, 0x53, 0x10, 0x01, 0x22, 0xd6, 0x01, 0x0a, 0x16, - 0x4c, 0x69, 0x73, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, - 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x41, 0x0a, 0x0b, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, - 0x65, 0x72, 0x69, 0x65, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, - 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x0a, 0x74, - 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0x26, 0x0a, 0x0f, 0x6e, 0x65, 0x78, + 0x72, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x1b, 0x0a, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, + 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x06, 0x66, 0x69, + 0x6c, 0x74, 0x65, 0x72, 0x12, 0x20, 0x0a, 0x09, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x69, 0x7a, + 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x05, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x08, 0x70, 0x61, + 0x67, 0x65, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x22, 0x0a, 0x0a, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, + 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, + 0x09, 0x70, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x22, 0x94, 0x01, 0x0a, 0x1d, 0x4c, + 0x69, 0x73, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x4b, 0x0a, 0x12, + 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, + 0x72, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, + 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x11, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, + 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0x26, 0x0a, 0x0f, 0x6e, 0x65, 0x78, 0x74, 0x5f, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x6e, 0x65, 0x78, 0x74, 0x50, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, - 0x6e, 0x12, 0x3d, 0x0a, 0x10, 0x65, 0x78, 0x65, 0x63, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x65, - 0x72, 0x72, 0x6f, 0x72, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, - 0x0f, 0x65, 0x78, 0x65, 0x63, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x73, - 0x12, 0x12, 0x0a, 0x04, 0x75, 0x6e, 0x69, 0x74, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, - 0x75, 0x6e, 0x69, 0x74, 0x22, 0xaa, 0x01, 0x0a, 0x17, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, - 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, - 0x12, 0x47, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x33, - 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2d, 0x0a, 0x2b, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x72, 0x65, 0x73, - 0x6f, 0x75, 0x72, 0x63, 0x65, 0x6d, 0x61, 0x6e, 0x61, 0x67, 0x65, 0x72, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x50, 0x72, 0x6f, 0x6a, - 0x65, 0x63, 0x74, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x46, 0x0a, 0x0b, 0x74, 0x69, 0x6d, - 0x65, 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x20, + 0x6e, 0x22, 0x64, 0x0a, 0x1a, 0x47, 0x65, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, + 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, + 0x46, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x32, 0xe0, + 0x41, 0x02, 0xfa, 0x41, 0x2c, 0x0a, 0x2a, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, + 0x2f, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, + 0x72, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0xb7, 0x01, 0x0a, 0x1d, 0x43, 0x72, 0x65, 0x61, + 0x74, 0x65, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, + 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x46, 0x0a, 0x04, 0x6e, 0x61, 0x6d, + 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x32, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2c, 0x12, + 0x2a, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4d, 0x65, 0x74, 0x72, 0x69, + 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x04, 0x6e, 0x61, 0x6d, + 0x65, 0x12, 0x4e, 0x0a, 0x11, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, 0x65, 0x73, 0x63, + 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, + 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, + 0x10, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, + 0x72, 0x22, 0x67, 0x0a, 0x1d, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x4d, 0x65, 0x74, 0x72, 0x69, + 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, + 0x73, 0x74, 0x12, 0x46, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, + 0x42, 0x32, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2c, 0x0a, 0x2a, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, + 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, + 0x63, 0x6f, 0x6d, 0x2f, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, + 0x70, 0x74, 0x6f, 0x72, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0xad, 0x04, 0x0a, 0x15, 0x4c, + 0x69, 0x73, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, + 0x75, 0x65, 0x73, 0x74, 0x12, 0x40, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x0a, 0x20, 0x01, + 0x28, 0x09, 0x42, 0x2c, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x26, 0x12, 0x24, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, + 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, + 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x1b, 0x0a, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, + 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x06, 0x66, 0x69, 0x6c, + 0x74, 0x65, 0x72, 0x12, 0x43, 0x0a, 0x08, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x18, + 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, + 0x65, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x08, + 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x12, 0x43, 0x0a, 0x0b, 0x61, 0x67, 0x67, 0x72, + 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x52, 0x0b, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x56, 0x0a, + 0x15, 0x73, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x61, 0x72, 0x79, 0x5f, 0x61, 0x67, 0x67, 0x72, 0x65, + 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, + 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, + 0x14, 0x73, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x61, 0x72, 0x79, 0x41, 0x67, 0x67, 0x72, 0x65, 0x67, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x19, 0x0a, 0x08, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x5f, 0x62, + 0x79, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x42, 0x79, + 0x12, 0x53, 0x0a, 0x04, 0x76, 0x69, 0x65, 0x77, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x3a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, - 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0a, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, - 0x73, 0x22, 0x8e, 0x01, 0x0a, 0x15, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, - 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x12, 0x45, 0x0a, 0x0b, 0x74, - 0x69, 0x6d, 0x65, 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x20, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, - 0x65, 0x73, 0x42, 0x02, 0x18, 0x01, 0x52, 0x0a, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, - 0x65, 0x73, 0x12, 0x2e, 0x0a, 0x06, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, - 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x42, 0x02, 0x18, 0x01, 0x52, 0x06, 0x73, 0x74, 0x61, 0x74, - 0x75, 0x73, 0x22, 0x98, 0x02, 0x0a, 0x17, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, - 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x53, 0x75, 0x6d, 0x6d, 0x61, 0x72, 0x79, 0x12, 0x2a, - 0x0a, 0x11, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x5f, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x5f, 0x63, 0x6f, - 0x75, 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x0f, 0x74, 0x6f, 0x74, 0x61, 0x6c, - 0x50, 0x6f, 0x69, 0x6e, 0x74, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x12, 0x2e, 0x0a, 0x13, 0x73, 0x75, - 0x63, 0x63, 0x65, 0x73, 0x73, 0x5f, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x5f, 0x63, 0x6f, 0x75, 0x6e, - 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x11, 0x73, 0x75, 0x63, 0x63, 0x65, 0x73, 0x73, - 0x50, 0x6f, 0x69, 0x6e, 0x74, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x12, 0x4b, 0x0a, 0x06, 0x65, 0x72, - 0x72, 0x6f, 0x72, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x33, 0x2e, 0x67, 0x6f, 0x6f, + 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, + 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x2e, 0x54, 0x69, 0x6d, 0x65, + 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x56, 0x69, 0x65, 0x77, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, + 0x04, 0x76, 0x69, 0x65, 0x77, 0x12, 0x1b, 0x0a, 0x09, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x69, + 0x7a, 0x65, 0x18, 0x08, 0x20, 0x01, 0x28, 0x05, 0x52, 0x08, 0x70, 0x61, 0x67, 0x65, 0x53, 0x69, + 0x7a, 0x65, 0x12, 0x1d, 0x0a, 0x0a, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, + 0x18, 0x09, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x70, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, + 0x6e, 0x22, 0x27, 0x0a, 0x0e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x56, + 0x69, 0x65, 0x77, 0x12, 0x08, 0x0a, 0x04, 0x46, 0x55, 0x4c, 0x4c, 0x10, 0x00, 0x12, 0x0b, 0x0a, + 0x07, 0x48, 0x45, 0x41, 0x44, 0x45, 0x52, 0x53, 0x10, 0x01, 0x22, 0xd6, 0x01, 0x0a, 0x16, 0x4c, + 0x69, 0x73, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x73, + 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x41, 0x0a, 0x0b, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, 0x65, + 0x72, 0x69, 0x65, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, - 0x65, 0x73, 0x53, 0x75, 0x6d, 0x6d, 0x61, 0x72, 0x79, 0x2e, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x52, - 0x06, 0x65, 0x72, 0x72, 0x6f, 0x72, 0x73, 0x1a, 0x54, 0x0a, 0x05, 0x45, 0x72, 0x72, 0x6f, 0x72, - 0x12, 0x2a, 0x0a, 0x06, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x12, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x53, 0x74, - 0x61, 0x74, 0x75, 0x73, 0x52, 0x06, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x12, 0x1f, 0x0a, 0x0b, - 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x05, 0x52, 0x0a, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x22, 0x88, 0x01, - 0x0a, 0x16, 0x51, 0x75, 0x65, 0x72, 0x79, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, - 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x17, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, - 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x04, 0x6e, 0x61, 0x6d, - 0x65, 0x12, 0x19, 0x0a, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, 0x18, 0x07, 0x20, 0x01, 0x28, 0x09, - 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, 0x12, 0x1b, 0x0a, 0x09, - 0x70, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x09, 0x20, 0x01, 0x28, 0x05, 0x52, - 0x08, 0x70, 0x61, 0x67, 0x65, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x1d, 0x0a, 0x0a, 0x70, 0x61, 0x67, - 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x70, - 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x22, 0xae, 0x02, 0x0a, 0x17, 0x51, 0x75, 0x65, - 0x72, 0x79, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x73, 0x70, - 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x60, 0x0a, 0x16, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, 0x65, 0x72, - 0x69, 0x65, 0x73, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x18, 0x08, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, - 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, - 0x52, 0x14, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x4e, 0x0a, 0x10, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, - 0x65, 0x72, 0x69, 0x65, 0x73, 0x5f, 0x64, 0x61, 0x74, 0x61, 0x18, 0x09, 0x20, 0x03, 0x28, 0x0b, - 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, - 0x65, 0x73, 0x44, 0x61, 0x74, 0x61, 0x52, 0x0e, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, - 0x65, 0x73, 0x44, 0x61, 0x74, 0x61, 0x12, 0x26, 0x0a, 0x0f, 0x6e, 0x65, 0x78, 0x74, 0x5f, 0x70, - 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x0d, 0x6e, 0x65, 0x78, 0x74, 0x50, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x12, 0x39, - 0x0a, 0x0e, 0x70, 0x61, 0x72, 0x74, 0x69, 0x61, 0x6c, 0x5f, 0x65, 0x72, 0x72, 0x6f, 0x72, 0x73, - 0x18, 0x0b, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x72, 0x70, 0x63, 0x2e, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, 0x0d, 0x70, 0x61, 0x72, 0x74, - 0x69, 0x61, 0x6c, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x73, 0x22, 0x6f, 0x0a, 0x0e, 0x51, 0x75, 0x65, - 0x72, 0x79, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x4c, 0x69, 0x73, 0x74, 0x12, 0x38, 0x0a, 0x06, 0x65, - 0x72, 0x72, 0x6f, 0x72, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, - 0x76, 0x33, 0x2e, 0x51, 0x75, 0x65, 0x72, 0x79, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x52, 0x06, 0x65, - 0x72, 0x72, 0x6f, 0x72, 0x73, 0x12, 0x23, 0x0a, 0x0d, 0x65, 0x72, 0x72, 0x6f, 0x72, 0x5f, 0x73, - 0x75, 0x6d, 0x6d, 0x61, 0x72, 0x79, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x65, 0x72, - 0x72, 0x6f, 0x72, 0x53, 0x75, 0x6d, 0x6d, 0x61, 0x72, 0x79, 0x32, 0xbc, 0x0f, 0x0a, 0x0d, 0x4d, - 0x65, 0x74, 0x72, 0x69, 0x63, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x12, 0xe4, 0x01, 0x0a, - 0x20, 0x4c, 0x69, 0x73, 0x74, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, - 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, - 0x73, 0x12, 0x3d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x4d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, - 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, - 0x1a, 0x3e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x4d, 0x6f, 0x6e, 0x69, + 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x0a, 0x74, 0x69, + 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0x26, 0x0a, 0x0f, 0x6e, 0x65, 0x78, 0x74, + 0x5f, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x0d, 0x6e, 0x65, 0x78, 0x74, 0x50, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, + 0x12, 0x3d, 0x0a, 0x10, 0x65, 0x78, 0x65, 0x63, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x65, 0x72, + 0x72, 0x6f, 0x72, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, 0x0f, + 0x65, 0x78, 0x65, 0x63, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x73, 0x12, + 0x12, 0x0a, 0x04, 0x75, 0x6e, 0x69, 0x74, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x75, + 0x6e, 0x69, 0x74, 0x22, 0xaa, 0x01, 0x0a, 0x17, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, + 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, + 0x47, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x33, 0xe0, + 0x41, 0x02, 0xfa, 0x41, 0x2d, 0x0a, 0x2b, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x72, 0x65, 0x73, 0x6f, + 0x75, 0x72, 0x63, 0x65, 0x6d, 0x61, 0x6e, 0x61, 0x67, 0x65, 0x72, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x50, 0x72, 0x6f, 0x6a, 0x65, + 0x63, 0x74, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x46, 0x0a, 0x0b, 0x74, 0x69, 0x6d, 0x65, + 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x20, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x42, + 0x03, 0xe0, 0x41, 0x02, 0x52, 0x0a, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, + 0x22, 0x8e, 0x01, 0x0a, 0x15, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x53, + 0x65, 0x72, 0x69, 0x65, 0x73, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x12, 0x45, 0x0a, 0x0b, 0x74, 0x69, + 0x6d, 0x65, 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x20, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, + 0x73, 0x42, 0x02, 0x18, 0x01, 0x52, 0x0a, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, + 0x73, 0x12, 0x2e, 0x0a, 0x06, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x53, + 0x74, 0x61, 0x74, 0x75, 0x73, 0x42, 0x02, 0x18, 0x01, 0x52, 0x06, 0x73, 0x74, 0x61, 0x74, 0x75, + 0x73, 0x22, 0x98, 0x02, 0x0a, 0x17, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, + 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x53, 0x75, 0x6d, 0x6d, 0x61, 0x72, 0x79, 0x12, 0x2a, 0x0a, + 0x11, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x5f, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x5f, 0x63, 0x6f, 0x75, + 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x0f, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x50, + 0x6f, 0x69, 0x6e, 0x74, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x12, 0x2e, 0x0a, 0x13, 0x73, 0x75, 0x63, + 0x63, 0x65, 0x73, 0x73, 0x5f, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, + 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x11, 0x73, 0x75, 0x63, 0x63, 0x65, 0x73, 0x73, 0x50, + 0x6f, 0x69, 0x6e, 0x74, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x12, 0x4b, 0x0a, 0x06, 0x65, 0x72, 0x72, + 0x6f, 0x72, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, + 0x2e, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, + 0x73, 0x53, 0x75, 0x6d, 0x6d, 0x61, 0x72, 0x79, 0x2e, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x52, 0x06, + 0x65, 0x72, 0x72, 0x6f, 0x72, 0x73, 0x1a, 0x54, 0x0a, 0x05, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x12, + 0x2a, 0x0a, 0x06, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x12, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x53, 0x74, 0x61, + 0x74, 0x75, 0x73, 0x52, 0x06, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x12, 0x1f, 0x0a, 0x0b, 0x70, + 0x6f, 0x69, 0x6e, 0x74, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, + 0x52, 0x0a, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x22, 0x8c, 0x01, 0x0a, + 0x16, 0x51, 0x75, 0x65, 0x72, 0x79, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, + 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x17, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, + 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, + 0x12, 0x19, 0x0a, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, 0x18, 0x07, 0x20, 0x01, 0x28, 0x09, 0x42, + 0x03, 0xe0, 0x41, 0x02, 0x52, 0x05, 0x71, 0x75, 0x65, 0x72, 0x79, 0x12, 0x1b, 0x0a, 0x09, 0x70, + 0x61, 0x67, 0x65, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x09, 0x20, 0x01, 0x28, 0x05, 0x52, 0x08, + 0x70, 0x61, 0x67, 0x65, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x1d, 0x0a, 0x0a, 0x70, 0x61, 0x67, 0x65, + 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x70, 0x61, + 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x3a, 0x02, 0x18, 0x01, 0x22, 0xb2, 0x02, 0x0a, 0x17, + 0x51, 0x75, 0x65, 0x72, 0x79, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, + 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x60, 0x0a, 0x16, 0x74, 0x69, 0x6d, 0x65, 0x5f, + 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, + 0x72, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, + 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x52, 0x14, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, + 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x4e, 0x0a, 0x10, 0x74, 0x69, 0x6d, + 0x65, 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x5f, 0x64, 0x61, 0x74, 0x61, 0x18, 0x09, 0x20, + 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x53, + 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x61, 0x74, 0x61, 0x52, 0x0e, 0x74, 0x69, 0x6d, 0x65, 0x53, + 0x65, 0x72, 0x69, 0x65, 0x73, 0x44, 0x61, 0x74, 0x61, 0x12, 0x26, 0x0a, 0x0f, 0x6e, 0x65, 0x78, + 0x74, 0x5f, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x0a, 0x20, 0x01, + 0x28, 0x09, 0x52, 0x0d, 0x6e, 0x65, 0x78, 0x74, 0x50, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, + 0x6e, 0x12, 0x39, 0x0a, 0x0e, 0x70, 0x61, 0x72, 0x74, 0x69, 0x61, 0x6c, 0x5f, 0x65, 0x72, 0x72, + 0x6f, 0x72, 0x73, 0x18, 0x0b, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, 0x0d, 0x70, + 0x61, 0x72, 0x74, 0x69, 0x61, 0x6c, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x73, 0x3a, 0x02, 0x18, 0x01, + 0x22, 0x6f, 0x0a, 0x0e, 0x51, 0x75, 0x65, 0x72, 0x79, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x4c, 0x69, + 0x73, 0x74, 0x12, 0x38, 0x0a, 0x06, 0x65, 0x72, 0x72, 0x6f, 0x72, 0x73, 0x18, 0x01, 0x20, 0x03, + 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x51, 0x75, 0x65, 0x72, 0x79, 0x45, + 0x72, 0x72, 0x6f, 0x72, 0x52, 0x06, 0x65, 0x72, 0x72, 0x6f, 0x72, 0x73, 0x12, 0x23, 0x0a, 0x0d, + 0x65, 0x72, 0x72, 0x6f, 0x72, 0x5f, 0x73, 0x75, 0x6d, 0x6d, 0x61, 0x72, 0x79, 0x18, 0x02, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x0c, 0x65, 0x72, 0x72, 0x6f, 0x72, 0x53, 0x75, 0x6d, 0x6d, 0x61, 0x72, + 0x79, 0x32, 0xbc, 0x0f, 0x0a, 0x0d, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x53, 0x65, 0x72, 0x76, + 0x69, 0x63, 0x65, 0x12, 0xe4, 0x01, 0x0a, 0x20, 0x4c, 0x69, 0x73, 0x74, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, - 0x22, 0x41, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x34, 0x12, - 0x32, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, - 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, - 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, - 0x6f, 0x72, 0x73, 0x12, 0xcc, 0x01, 0x0a, 0x1e, 0x47, 0x65, 0x74, 0x4d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x3b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x47, 0x65, - 0x74, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, - 0x65, 0x73, 0x74, 0x1a, 0x27, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, - 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x22, 0x44, 0xda, 0x41, - 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x37, 0x12, 0x35, 0x2f, 0x76, 0x33, + 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0x3d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, + 0x4c, 0x69, 0x73, 0x74, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, + 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, + 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x3e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, + 0x69, 0x73, 0x74, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, + 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x52, + 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x41, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, + 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x34, 0x12, 0x32, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, + 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, + 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0xcc, 0x01, 0x0a, 0x1e, 0x47, + 0x65, 0x74, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, + 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x3b, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x47, 0x65, 0x74, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, + 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x27, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, + 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x22, 0x44, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, + 0x02, 0x37, 0x12, 0x35, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, + 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, + 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x2a, 0x2a, 0x7d, 0x12, 0xb8, 0x01, 0x0a, 0x15, 0x4c, 0x69, + 0x73, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, + 0x6f, 0x72, 0x73, 0x12, 0x32, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x4d, + 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, + 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, + 0x69, 0x73, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x36, 0xda, 0x41, + 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x29, 0x12, 0x27, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, - 0x2a, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, - 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x2a, - 0x2a, 0x7d, 0x12, 0xb8, 0x01, 0x0a, 0x15, 0x4c, 0x69, 0x73, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, - 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0x32, 0x2e, 0x67, + 0x2a, 0x7d, 0x2f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x73, 0x12, 0xa0, 0x01, 0x0a, 0x13, 0x47, 0x65, 0x74, 0x4d, 0x65, 0x74, 0x72, + 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x30, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, - 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, - 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, - 0x1a, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x4d, 0x65, 0x74, 0x72, - 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x52, 0x65, 0x73, - 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x36, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, - 0xe4, 0x93, 0x02, 0x29, 0x12, 0x27, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, - 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x6d, 0x65, 0x74, 0x72, - 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0xa0, 0x01, - 0x0a, 0x13, 0x47, 0x65, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, - 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x30, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, - 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x47, 0x65, 0x74, + 0x2e, 0x76, 0x33, 0x2e, 0x47, 0x65, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, + 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x1c, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, + 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x22, 0x39, 0xda, 0x41, + 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x2c, 0x12, 0x2a, 0x2f, 0x76, 0x33, + 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, + 0x2a, 0x2f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, + 0x6f, 0x72, 0x73, 0x2f, 0x2a, 0x2a, 0x7d, 0x12, 0xc8, 0x01, 0x0a, 0x16, 0x43, 0x72, 0x65, 0x61, + 0x74, 0x65, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, + 0x6f, 0x72, 0x12, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, - 0x69, 0x70, 0x74, 0x6f, 0x72, 0x22, 0x39, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, - 0xe4, 0x93, 0x02, 0x2c, 0x12, 0x2a, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, - 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6d, 0x65, 0x74, 0x72, 0x69, - 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x2a, 0x2a, 0x7d, - 0x12, 0xc8, 0x01, 0x0a, 0x16, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x4d, 0x65, 0x74, 0x72, 0x69, - 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x33, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, - 0x76, 0x33, 0x2e, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, - 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, - 0x1a, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, - 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x22, 0x5b, - 0xda, 0x41, 0x16, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, - 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x3c, 0x3a, - 0x11, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, - 0x6f, 0x72, 0x22, 0x27, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, - 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, - 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0xa0, 0x01, 0x0a, 0x16, - 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x44, 0x65, - 0x6c, 0x65, 0x74, 0x65, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, - 0x70, 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x16, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6d, - 0x70, 0x74, 0x79, 0x22, 0x39, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, - 0x02, 0x2c, 0x2a, 0x2a, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, - 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, - 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x2a, 0x2a, 0x7d, 0x12, 0xfe, - 0x01, 0x0a, 0x0e, 0x4c, 0x69, 0x73, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, - 0x73, 0x12, 0x2b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x54, 0x69, 0x6d, - 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x2c, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, - 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x90, 0x01, 0xda, - 0x41, 0x19, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x2c, 0x69, 0x6e, - 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x2c, 0x76, 0x69, 0x65, 0x77, 0x82, 0xd3, 0xe4, 0x93, 0x02, - 0x6e, 0x5a, 0x27, 0x12, 0x25, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x6f, - 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, - 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x5a, 0x21, 0x12, 0x1f, 0x2f, 0x76, - 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, - 0x2a, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0x20, 0x2f, - 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, - 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, - 0x99, 0x01, 0x0a, 0x10, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, - 0x72, 0x69, 0x65, 0x73, 0x12, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x72, 0x65, 0x61, - 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, - 0x65, 0x73, 0x74, 0x1a, 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x22, 0x3e, 0xda, 0x41, 0x10, - 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, - 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x25, 0x3a, 0x01, 0x2a, 0x22, 0x20, 0x2f, 0x76, 0x33, 0x2f, 0x7b, + 0x69, 0x70, 0x74, 0x6f, 0x72, 0x22, 0x5b, 0xda, 0x41, 0x16, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x6d, + 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, + 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x3c, 0x3a, 0x11, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, + 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x22, 0x27, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, - 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0xae, 0x01, 0x0a, 0x17, - 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x54, 0x69, 0x6d, - 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x43, - 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, - 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x22, 0x4c, - 0xda, 0x41, 0x10, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, 0x65, 0x72, - 0x69, 0x65, 0x73, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x33, 0x3a, 0x01, 0x2a, 0x22, 0x2e, 0x2f, 0x76, - 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, - 0x2f, 0x2a, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x3a, 0x63, - 0x72, 0x65, 0x61, 0x74, 0x65, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x1a, 0xda, 0x01, 0xca, - 0x41, 0x19, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0xd2, 0x41, 0xba, 0x01, 0x68, - 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x63, - 0x6c, 0x6f, 0x75, 0x64, 0x2d, 0x70, 0x6c, 0x61, 0x74, 0x66, 0x6f, 0x72, 0x6d, 0x2c, 0x68, 0x74, - 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, - 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, - 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x69, 0x6e, 0x67, 0x2e, 0x72, 0x65, 0x61, 0x64, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, - 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, - 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x69, 0x6e, 0x67, 0x2e, 0x77, 0x72, 0x69, 0x74, 0x65, 0x42, 0x89, 0x08, 0xea, 0x41, 0xf0, 0x01, - 0x0a, 0x2a, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4d, 0x65, 0x74, 0x72, - 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x3b, 0x70, 0x72, - 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, - 0x72, 0x73, 0x2f, 0x7b, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, - 0x69, 0x70, 0x74, 0x6f, 0x72, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x45, 0x6f, 0x72, 0x67, 0x61, 0x6e, - 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, - 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x2f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, + 0x72, 0x73, 0x12, 0xa0, 0x01, 0x0a, 0x16, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x4d, 0x65, 0x74, + 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x33, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x4d, 0x65, 0x74, 0x72, 0x69, + 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, + 0x73, 0x74, 0x1a, 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, + 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x22, 0x39, 0xda, 0x41, 0x04, 0x6e, + 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x2c, 0x2a, 0x2a, 0x2f, 0x76, 0x33, 0x2f, 0x7b, + 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, + 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, + 0x73, 0x2f, 0x2a, 0x2a, 0x7d, 0x12, 0xfe, 0x01, 0x0a, 0x0e, 0x4c, 0x69, 0x73, 0x74, 0x54, 0x69, + 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0x2b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, + 0x4c, 0x69, 0x73, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, + 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, + 0x74, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, + 0x6e, 0x73, 0x65, 0x22, 0x90, 0x01, 0xda, 0x41, 0x19, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x66, 0x69, + 0x6c, 0x74, 0x65, 0x72, 0x2c, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x2c, 0x76, 0x69, + 0x65, 0x77, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x6e, 0x5a, 0x27, 0x12, 0x25, 0x2f, 0x76, 0x33, 0x2f, + 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, + 0x73, 0x5a, 0x21, 0x12, 0x1f, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x66, + 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, + 0x72, 0x69, 0x65, 0x73, 0x12, 0x20, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, + 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, + 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0x99, 0x01, 0x0a, 0x10, 0x43, 0x72, 0x65, 0x61, 0x74, + 0x65, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0x2d, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, + 0x76, 0x33, 0x2e, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, + 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x16, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6d, 0x70, + 0x74, 0x79, 0x22, 0x3e, 0xda, 0x41, 0x10, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x74, 0x69, 0x6d, 0x65, + 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x25, 0x3a, 0x01, 0x2a, + 0x22, 0x20, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, + 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, + 0x65, 0x73, 0x12, 0xae, 0x01, 0x0a, 0x17, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x53, 0x65, 0x72, + 0x76, 0x69, 0x63, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0x2d, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, + 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x54, 0x69, 0x6d, 0x65, + 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x16, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, + 0x45, 0x6d, 0x70, 0x74, 0x79, 0x22, 0x4c, 0xda, 0x41, 0x10, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x74, + 0x69, 0x6d, 0x65, 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x33, + 0x3a, 0x01, 0x2a, 0x22, 0x2e, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, + 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, + 0x65, 0x72, 0x69, 0x65, 0x73, 0x3a, 0x63, 0x72, 0x65, 0x61, 0x74, 0x65, 0x53, 0x65, 0x72, 0x76, + 0x69, 0x63, 0x65, 0x1a, 0xda, 0x01, 0xca, 0x41, 0x19, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, + 0x6f, 0x6d, 0xd2, 0x41, 0xba, 0x01, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, + 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, + 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2d, 0x70, 0x6c, 0x61, 0x74, + 0x66, 0x6f, 0x72, 0x6d, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, + 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2c, + 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x72, 0x65, 0x61, 0x64, 0x2c, + 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x77, 0x72, 0x69, 0x74, 0x65, + 0x42, 0x89, 0x08, 0xea, 0x41, 0xf0, 0x01, 0x0a, 0x2a, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, + 0x6f, 0x6d, 0x2f, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x12, 0x3b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, + 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x3d, 0x2a, 0x2a, 0x7d, - 0x12, 0x39, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, - 0x72, 0x7d, 0x2f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, - 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x01, 0x2a, 0x20, 0x01, - 0xea, 0x41, 0xb7, 0x02, 0x0a, 0x35, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, - 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, - 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x4f, 0x70, 0x72, 0x6f, - 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, - 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, - 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, - 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x7d, 0x12, 0x59, 0x6f, 0x72, - 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, - 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x65, 0x64, 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x64, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x7d, 0x12, 0x4d, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, - 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x7d, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, - 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, - 0x64, 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, - 0x69, 0x70, 0x74, 0x6f, 0x72, 0x7d, 0x12, 0x01, 0x2a, 0x20, 0x01, 0xea, 0x41, 0x51, 0x0a, 0x23, - 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x57, 0x6f, 0x72, 0x6b, 0x73, 0x70, - 0x61, 0x63, 0x65, 0x12, 0x12, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, - 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x12, 0x16, 0x77, 0x6f, 0x72, 0x6b, 0x73, 0x70, 0x61, - 0x63, 0x65, 0x73, 0x2f, 0x7b, 0x77, 0x6f, 0x72, 0x6b, 0x73, 0x70, 0x61, 0x63, 0x65, 0x7d, 0xea, - 0x41, 0xb5, 0x01, 0x0a, 0x24, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x54, - 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0x2b, 0x70, 0x72, 0x6f, 0x6a, 0x65, - 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x74, 0x69, - 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x2f, 0x7b, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, - 0x65, 0x72, 0x69, 0x65, 0x73, 0x7d, 0x12, 0x35, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x2f, - 0x7b, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x7d, 0x12, 0x29, 0x66, - 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x7d, 0x2f, - 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x2f, 0x7b, 0x74, 0x69, 0x6d, 0x65, - 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x7d, 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, - 0x76, 0x33, 0x42, 0x12, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, - 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x67, 0x6f, 0x2f, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, 0x69, 0x76, 0x33, 0x2f, 0x76, - 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0x3b, 0x6d, - 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0xaa, 0x02, 0x1a, 0x47, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x3a, 0x3a, - 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, - 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x12, 0x45, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, + 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x2f, 0x6d, + 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, + 0x2f, 0x7b, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x3d, 0x2a, 0x2a, 0x7d, 0x12, 0x39, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, + 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x7d, 0x2f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, + 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x6d, 0x65, 0x74, + 0x72, 0x69, 0x63, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x3d, 0x2a, + 0x2a, 0x7d, 0x12, 0x01, 0x2a, 0x20, 0x01, 0xea, 0x41, 0xb7, 0x02, 0x0a, 0x35, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, + 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, + 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, + 0x6f, 0x72, 0x12, 0x4f, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, + 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, + 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, + 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x5f, 0x72, + 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, + 0x6f, 0x72, 0x7d, 0x12, 0x59, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x7d, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, + 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, + 0x63, 0x65, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x7d, 0x12, 0x4d, + 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x7d, + 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, + 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, + 0x65, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x7d, 0x12, 0x01, 0x2a, + 0x20, 0x01, 0xea, 0x41, 0x51, 0x0a, 0x23, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, + 0x2f, 0x57, 0x6f, 0x72, 0x6b, 0x73, 0x70, 0x61, 0x63, 0x65, 0x12, 0x12, 0x70, 0x72, 0x6f, 0x6a, + 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x12, 0x16, + 0x77, 0x6f, 0x72, 0x6b, 0x73, 0x70, 0x61, 0x63, 0x65, 0x73, 0x2f, 0x7b, 0x77, 0x6f, 0x72, 0x6b, + 0x73, 0x70, 0x61, 0x63, 0x65, 0x7d, 0xea, 0x41, 0xb5, 0x01, 0x0a, 0x24, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, + 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, + 0x12, 0x2b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, + 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x2f, + 0x7b, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x7d, 0x12, 0x35, 0x6f, + 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, + 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, + 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x2f, 0x7b, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, 0x65, 0x72, + 0x69, 0x65, 0x73, 0x7d, 0x12, 0x29, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x7b, 0x66, + 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, + 0x73, 0x2f, 0x7b, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x7d, 0x0a, + 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x42, 0x12, 0x4d, 0x65, 0x74, 0x72, 0x69, + 0x63, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, + 0x41, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, + 0x6d, 0x2f, 0x67, 0x6f, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, + 0x61, 0x70, 0x69, 0x76, 0x33, 0x2f, 0x76, 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x69, 0x6e, 0x67, 0x70, 0x62, 0x3b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, + 0x70, 0x62, 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, + 0x64, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, + 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x3a, 0x3a, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x33, } var ( @@ -1846,212 +1823,6 @@ func file_google_monitoring_v3_metric_service_proto_init() { } file_google_monitoring_v3_common_proto_init() file_google_monitoring_v3_metric_proto_init() - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_metric_service_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*ListMonitoredResourceDescriptorsRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*ListMonitoredResourceDescriptorsResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*GetMonitoredResourceDescriptorRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[3].Exporter = func(v any, i int) any { - switch v := v.(*ListMetricDescriptorsRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[4].Exporter = func(v any, i int) any { - switch v := v.(*ListMetricDescriptorsResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[5].Exporter = func(v any, i int) any { - switch v := v.(*GetMetricDescriptorRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[6].Exporter = func(v any, i int) any { - switch v := v.(*CreateMetricDescriptorRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[7].Exporter = func(v any, i int) any { - switch v := v.(*DeleteMetricDescriptorRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[8].Exporter = func(v any, i int) any { - switch v := v.(*ListTimeSeriesRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[9].Exporter = func(v any, i int) any { - switch v := v.(*ListTimeSeriesResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[10].Exporter = func(v any, i int) any { - switch v := v.(*CreateTimeSeriesRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[11].Exporter = func(v any, i int) any { - switch v := v.(*CreateTimeSeriesError); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[12].Exporter = func(v any, i int) any { - switch v := v.(*CreateTimeSeriesSummary); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[13].Exporter = func(v any, i int) any { - switch v := v.(*QueryTimeSeriesRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[14].Exporter = func(v any, i int) any { - switch v := v.(*QueryTimeSeriesResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[15].Exporter = func(v any, i int) any { - switch v := v.(*QueryErrorList); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_metric_service_proto_msgTypes[16].Exporter = func(v any, i int) any { - switch v := v.(*CreateTimeSeriesSummary_Error); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/mutation_record.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/mutation_record.pb.go index 643b244e4d396..5fd4f33807592 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/mutation_record.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/mutation_record.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/mutation_record.proto @@ -50,11 +50,9 @@ type MutationRecord struct { func (x *MutationRecord) Reset() { *x = MutationRecord{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_mutation_record_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_mutation_record_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *MutationRecord) String() string { @@ -65,7 +63,7 @@ func (*MutationRecord) ProtoMessage() {} func (x *MutationRecord) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_mutation_record_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -157,20 +155,6 @@ func file_google_monitoring_v3_mutation_record_proto_init() { if File_google_monitoring_v3_mutation_record_proto != nil { return } - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_mutation_record_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*MutationRecord); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/notification.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/notification.pb.go index 603b5bcdde12f..48d69d1431dc7 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/notification.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/notification.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/notification.proto @@ -146,11 +146,9 @@ type NotificationChannelDescriptor struct { func (x *NotificationChannelDescriptor) Reset() { *x = NotificationChannelDescriptor{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *NotificationChannelDescriptor) String() string { @@ -161,7 +159,7 @@ func (*NotificationChannelDescriptor) ProtoMessage() {} func (x *NotificationChannelDescriptor) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -241,7 +239,7 @@ type NotificationChannel struct { // [NotificationChannelDescriptor.type][google.monitoring.v3.NotificationChannelDescriptor.type] // field. Type string `protobuf:"bytes,1,opt,name=type,proto3" json:"type,omitempty"` - // The full REST resource name for this channel. The format is: + // Identifier. The full REST resource name for this channel. The format is: // // projects/[PROJECT_ID_OR_NUMBER]/notificationChannels/[CHANNEL_ID] // @@ -306,11 +304,9 @@ type NotificationChannel struct { func (x *NotificationChannel) Reset() { *x = NotificationChannel{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *NotificationChannel) String() string { @@ -321,7 +317,7 @@ func (*NotificationChannel) ProtoMessage() {} func (x *NotificationChannel) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -413,140 +409,142 @@ var file_google_monitoring_v3_notification_proto_rawDesc = []byte{ 0x69, 0x6e, 0x67, 0x2f, 0x76, 0x33, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x14, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x1a, - 0x16, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x6c, 0x61, 0x62, 0x65, - 0x6c, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x1d, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, - 0x61, 0x70, 0x69, 0x2f, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x5f, 0x73, 0x74, 0x61, 0x67, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x19, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x61, - 0x70, 0x69, 0x2f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x1a, 0x21, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x76, 0x33, 0x2f, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x2a, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x6d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x76, 0x33, 0x2f, 0x6d, 0x75, 0x74, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x1a, 0x1e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2f, 0x77, 0x72, 0x61, 0x70, 0x70, 0x65, 0x72, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x22, 0xf0, 0x04, 0x0a, 0x1d, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, - 0x6f, 0x72, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x12, 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x69, - 0x73, 0x70, 0x6c, 0x61, 0x79, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x0b, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x20, 0x0a, - 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, - 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, - 0x33, 0x0a, 0x06, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, - 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4c, 0x61, 0x62, - 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x06, 0x6c, 0x61, - 0x62, 0x65, 0x6c, 0x73, 0x12, 0x4e, 0x0a, 0x0f, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x65, - 0x64, 0x5f, 0x74, 0x69, 0x65, 0x72, 0x73, 0x18, 0x05, 0x20, 0x03, 0x28, 0x0e, 0x32, 0x21, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, - 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x54, 0x69, 0x65, 0x72, - 0x42, 0x02, 0x18, 0x01, 0x52, 0x0e, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x65, 0x64, 0x54, - 0x69, 0x65, 0x72, 0x73, 0x12, 0x3a, 0x0a, 0x0c, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x5f, 0x73, - 0x74, 0x61, 0x67, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x17, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x53, 0x74, - 0x61, 0x67, 0x65, 0x52, 0x0b, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x53, 0x74, 0x61, 0x67, 0x65, - 0x3a, 0xa0, 0x02, 0xea, 0x41, 0x9c, 0x02, 0x0a, 0x37, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, - 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, - 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, - 0x12, 0x46, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, - 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, - 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x5f, 0x64, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x7d, 0x12, 0x50, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, - 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, - 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x5f, 0x64, - 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x7d, 0x12, 0x44, 0x66, 0x6f, 0x6c, 0x64, - 0x65, 0x72, 0x73, 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, - 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, - 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x63, 0x68, 0x61, - 0x6e, 0x6e, 0x65, 0x6c, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x7d, - 0x12, 0x01, 0x2a, 0x22, 0xc6, 0x08, 0x0a, 0x13, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x12, 0x12, 0x0a, 0x04, 0x74, - 0x79, 0x70, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, - 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, - 0x61, 0x6d, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x5f, 0x6e, - 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x69, 0x73, 0x70, 0x6c, - 0x61, 0x79, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4d, 0x0a, 0x06, 0x6c, 0x61, 0x62, 0x65, - 0x6c, 0x73, 0x18, 0x05, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x35, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, - 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, - 0x6e, 0x65, 0x6c, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, - 0x06, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x12, 0x5a, 0x0a, 0x0b, 0x75, 0x73, 0x65, 0x72, 0x5f, - 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x08, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x39, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, - 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x2e, 0x55, 0x73, 0x65, 0x72, 0x4c, 0x61, 0x62, 0x65, - 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x0a, 0x75, 0x73, 0x65, 0x72, 0x4c, 0x61, 0x62, - 0x65, 0x6c, 0x73, 0x12, 0x6d, 0x0a, 0x13, 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0e, - 0x32, 0x3c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x2e, 0x56, 0x65, 0x72, 0x69, - 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, 0x12, - 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53, 0x74, 0x61, 0x74, - 0x75, 0x73, 0x12, 0x34, 0x0a, 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x0b, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, - 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x12, 0x4d, 0x0a, 0x0f, 0x63, 0x72, 0x65, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x18, 0x0c, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x75, 0x74, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x52, 0x0e, 0x63, 0x72, 0x65, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x12, 0x4f, 0x0a, 0x10, 0x6d, 0x75, 0x74, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x73, 0x18, 0x0d, 0x20, 0x03, 0x28, - 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x75, 0x74, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x52, 0x0f, 0x6d, 0x75, 0x74, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x73, 0x1a, 0x39, 0x0a, 0x0b, 0x4c, 0x61, 0x62, 0x65, - 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, - 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, - 0x02, 0x38, 0x01, 0x1a, 0x3d, 0x0a, 0x0f, 0x55, 0x73, 0x65, 0x72, 0x4c, 0x61, 0x62, 0x65, 0x6c, - 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, - 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, - 0x38, 0x01, 0x22, 0x57, 0x0a, 0x12, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x12, 0x23, 0x0a, 0x1f, 0x56, 0x45, 0x52, 0x49, - 0x46, 0x49, 0x43, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x53, 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, - 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x0e, 0x0a, - 0x0a, 0x55, 0x4e, 0x56, 0x45, 0x52, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x01, 0x12, 0x0c, 0x0a, - 0x08, 0x56, 0x45, 0x52, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x02, 0x3a, 0xfe, 0x01, 0xea, 0x41, - 0xfa, 0x01, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, - 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, - 0x6c, 0x12, 0x3e, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, + 0x1f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x66, 0x69, 0x65, 0x6c, + 0x64, 0x5f, 0x62, 0x65, 0x68, 0x61, 0x76, 0x69, 0x6f, 0x72, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x1a, 0x16, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x6c, 0x61, 0x62, + 0x65, 0x6c, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x1d, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x5f, 0x73, 0x74, 0x61, 0x67, + 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x19, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, + 0x61, 0x70, 0x69, 0x2f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x2e, 0x70, 0x72, 0x6f, + 0x74, 0x6f, 0x1a, 0x21, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x76, 0x33, 0x2f, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x2e, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x2a, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x76, 0x33, 0x2f, 0x6d, 0x75, 0x74, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x2e, 0x70, 0x72, 0x6f, 0x74, + 0x6f, 0x1a, 0x1e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, + 0x75, 0x66, 0x2f, 0x77, 0x72, 0x61, 0x70, 0x70, 0x65, 0x72, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, + 0x6f, 0x22, 0xf0, 0x04, 0x0a, 0x1d, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x12, 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, 0x18, + 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, + 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x0b, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x20, + 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, + 0x12, 0x33, 0x0a, 0x06, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, + 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4c, 0x61, + 0x62, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x06, 0x6c, + 0x61, 0x62, 0x65, 0x6c, 0x73, 0x12, 0x4e, 0x0a, 0x0f, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, + 0x65, 0x64, 0x5f, 0x74, 0x69, 0x65, 0x72, 0x73, 0x18, 0x05, 0x20, 0x03, 0x28, 0x0e, 0x32, 0x21, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, + 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x54, 0x69, 0x65, + 0x72, 0x42, 0x02, 0x18, 0x01, 0x52, 0x0e, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x65, 0x64, + 0x54, 0x69, 0x65, 0x72, 0x73, 0x12, 0x3a, 0x0a, 0x0c, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x5f, + 0x73, 0x74, 0x61, 0x67, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x17, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x53, + 0x74, 0x61, 0x67, 0x65, 0x52, 0x0b, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x53, 0x74, 0x61, 0x67, + 0x65, 0x3a, 0xa0, 0x02, 0xea, 0x41, 0x9c, 0x02, 0x0a, 0x37, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, + 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, + 0x63, 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, + 0x72, 0x12, 0x46, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x7b, 0x6e, 0x6f, 0x74, 0x69, - 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, - 0x7d, 0x12, 0x48, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, - 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x2f, - 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, - 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x7b, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x7d, 0x12, 0x3c, 0x66, 0x6f, 0x6c, + 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x5f, 0x64, 0x65, + 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x7d, 0x12, 0x50, 0x6f, 0x72, 0x67, 0x61, 0x6e, + 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, + 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, + 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x5f, + 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x7d, 0x12, 0x44, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, - 0x6c, 0x73, 0x2f, 0x7b, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x7d, 0x12, 0x01, 0x2a, 0x42, 0xcc, 0x01, 0x0a, - 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x42, 0x11, 0x4e, 0x6f, 0x74, 0x69, 0x66, - 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, - 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, - 0x2f, 0x67, 0x6f, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, - 0x70, 0x69, 0x76, 0x33, 0x2f, 0x76, 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x70, 0x62, 0x3b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, - 0x62, 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, - 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, - 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x3a, 0x3a, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x33, + 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x7b, 0x63, 0x68, + 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, + 0x7d, 0x12, 0x01, 0x2a, 0x22, 0xcb, 0x08, 0x0a, 0x13, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x12, 0x12, 0x0a, 0x04, + 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, + 0x12, 0x17, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, + 0xe0, 0x41, 0x08, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, + 0x70, 0x6c, 0x61, 0x79, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x0b, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x20, 0x0a, 0x0b, + 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4d, + 0x0a, 0x06, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x05, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x35, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, + 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, + 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x06, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x12, 0x5a, 0x0a, + 0x0b, 0x75, 0x73, 0x65, 0x72, 0x5f, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x08, 0x20, 0x03, + 0x28, 0x0b, 0x32, 0x39, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, + 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x2e, 0x55, 0x73, + 0x65, 0x72, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x0a, 0x75, + 0x73, 0x65, 0x72, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x12, 0x6d, 0x0a, 0x13, 0x76, 0x65, 0x72, + 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, + 0x18, 0x09, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x3c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, + 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, + 0x6c, 0x2e, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53, 0x74, + 0x61, 0x74, 0x75, 0x73, 0x52, 0x12, 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x12, 0x34, 0x0a, 0x07, 0x65, 0x6e, 0x61, 0x62, + 0x6c, 0x65, 0x64, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, + 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x07, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x12, 0x4d, + 0x0a, 0x0f, 0x63, 0x72, 0x65, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x63, 0x6f, 0x72, + 0x64, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4d, + 0x75, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x52, 0x0e, 0x63, + 0x72, 0x65, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x12, 0x4f, 0x0a, + 0x10, 0x6d, 0x75, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, + 0x73, 0x18, 0x0d, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4d, + 0x75, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x52, 0x0f, 0x6d, + 0x75, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x73, 0x1a, 0x39, + 0x0a, 0x0b, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, + 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, + 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, + 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x1a, 0x3d, 0x0a, 0x0f, 0x55, 0x73, 0x65, + 0x72, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, + 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, + 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, + 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x57, 0x0a, 0x12, 0x56, 0x65, 0x72, 0x69, + 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x12, 0x23, + 0x0a, 0x1f, 0x56, 0x45, 0x52, 0x49, 0x46, 0x49, 0x43, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x53, + 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, + 0x44, 0x10, 0x00, 0x12, 0x0e, 0x0a, 0x0a, 0x55, 0x4e, 0x56, 0x45, 0x52, 0x49, 0x46, 0x49, 0x45, + 0x44, 0x10, 0x01, 0x12, 0x0c, 0x0a, 0x08, 0x56, 0x45, 0x52, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, + 0x02, 0x3a, 0xfe, 0x01, 0xea, 0x41, 0xfa, 0x01, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, + 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, + 0x63, 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x12, 0x3e, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, + 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, 0x69, + 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, + 0x2f, 0x7b, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, + 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x7d, 0x12, 0x48, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x7b, 0x6e, 0x6f, 0x74, 0x69, + 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, + 0x7d, 0x12, 0x3c, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, + 0x65, 0x72, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x7b, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, + 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x7d, 0x12, + 0x01, 0x2a, 0x42, 0xcc, 0x01, 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x42, + 0x11, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x6f, + 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x67, 0x6f, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, + 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, 0x69, 0x76, 0x33, 0x2f, 0x76, 0x32, 0x2f, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0x3b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x5c, 0x43, 0x6c, + 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5c, 0x56, + 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x3a, 0x3a, 0x43, 0x6c, 0x6f, 0x75, + 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x3a, 0x3a, 0x56, + 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( @@ -599,32 +597,6 @@ func file_google_monitoring_v3_notification_proto_init() { } file_google_monitoring_v3_common_proto_init() file_google_monitoring_v3_mutation_record_proto_init() - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_notification_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*NotificationChannelDescriptor); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*NotificationChannel); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/notification_service.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/notification_service.pb.go index ac7bafd1f10d3..9ae6580b1b43b 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/notification_service.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/notification_service.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/notification_service.proto @@ -73,11 +73,9 @@ type ListNotificationChannelDescriptorsRequest struct { func (x *ListNotificationChannelDescriptorsRequest) Reset() { *x = ListNotificationChannelDescriptorsRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListNotificationChannelDescriptorsRequest) String() string { @@ -88,7 +86,7 @@ func (*ListNotificationChannelDescriptorsRequest) ProtoMessage() {} func (x *ListNotificationChannelDescriptorsRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -142,11 +140,9 @@ type ListNotificationChannelDescriptorsResponse struct { func (x *ListNotificationChannelDescriptorsResponse) Reset() { *x = ListNotificationChannelDescriptorsResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListNotificationChannelDescriptorsResponse) String() string { @@ -157,7 +153,7 @@ func (*ListNotificationChannelDescriptorsResponse) ProtoMessage() {} func (x *ListNotificationChannelDescriptorsResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -200,11 +196,9 @@ type GetNotificationChannelDescriptorRequest struct { func (x *GetNotificationChannelDescriptorRequest) Reset() { *x = GetNotificationChannelDescriptorRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetNotificationChannelDescriptorRequest) String() string { @@ -215,7 +209,7 @@ func (*GetNotificationChannelDescriptorRequest) ProtoMessage() {} func (x *GetNotificationChannelDescriptorRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -260,11 +254,9 @@ type CreateNotificationChannelRequest struct { func (x *CreateNotificationChannelRequest) Reset() { *x = CreateNotificationChannelRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[3] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateNotificationChannelRequest) String() string { @@ -275,7 +267,7 @@ func (*CreateNotificationChannelRequest) ProtoMessage() {} func (x *CreateNotificationChannelRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -323,24 +315,24 @@ type ListNotificationChannelsRequest struct { // [`GetNotificationChannel`][google.monitoring.v3.NotificationChannelService.GetNotificationChannel] // operation. Name string `protobuf:"bytes,5,opt,name=name,proto3" json:"name,omitempty"` - // If provided, this field specifies the criteria that must be met by - // notification channels to be included in the response. + // Optional. If provided, this field specifies the criteria that must be met + // by notification channels to be included in the response. // // For more details, see [sorting and // filtering](https://cloud.google.com/monitoring/api/v3/sorting-and-filtering). Filter string `protobuf:"bytes,6,opt,name=filter,proto3" json:"filter,omitempty"` - // A comma-separated list of fields by which to sort the result. Supports - // the same set of fields as in `filter`. Entries can be prefixed with - // a minus sign to sort in descending rather than ascending order. + // Optional. A comma-separated list of fields by which to sort the result. + // Supports the same set of fields as in `filter`. Entries can be prefixed + // with a minus sign to sort in descending rather than ascending order. // // For more details, see [sorting and // filtering](https://cloud.google.com/monitoring/api/v3/sorting-and-filtering). OrderBy string `protobuf:"bytes,7,opt,name=order_by,json=orderBy,proto3" json:"order_by,omitempty"` - // The maximum number of results to return in a single response. If + // Optional. The maximum number of results to return in a single response. If // not set to a positive number, a reasonable value will be chosen by the // service. PageSize int32 `protobuf:"varint,3,opt,name=page_size,json=pageSize,proto3" json:"page_size,omitempty"` - // If non-empty, `page_token` must contain a value returned as the + // Optional. If non-empty, `page_token` must contain a value returned as the // `next_page_token` in a previous response to request the next set // of results. PageToken string `protobuf:"bytes,4,opt,name=page_token,json=pageToken,proto3" json:"page_token,omitempty"` @@ -348,11 +340,9 @@ type ListNotificationChannelsRequest struct { func (x *ListNotificationChannelsRequest) Reset() { *x = ListNotificationChannelsRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[4] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[4] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListNotificationChannelsRequest) String() string { @@ -363,7 +353,7 @@ func (*ListNotificationChannelsRequest) ProtoMessage() {} func (x *ListNotificationChannelsRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[4] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -433,11 +423,9 @@ type ListNotificationChannelsResponse struct { func (x *ListNotificationChannelsResponse) Reset() { *x = ListNotificationChannelsResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[5] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[5] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListNotificationChannelsResponse) String() string { @@ -448,7 +436,7 @@ func (*ListNotificationChannelsResponse) ProtoMessage() {} func (x *ListNotificationChannelsResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[5] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -498,11 +486,9 @@ type GetNotificationChannelRequest struct { func (x *GetNotificationChannelRequest) Reset() { *x = GetNotificationChannelRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[6] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[6] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetNotificationChannelRequest) String() string { @@ -513,7 +499,7 @@ func (*GetNotificationChannelRequest) ProtoMessage() {} func (x *GetNotificationChannelRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[6] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -541,7 +527,7 @@ type UpdateNotificationChannelRequest struct { sizeCache protoimpl.SizeCache unknownFields protoimpl.UnknownFields - // The fields to update. + // Optional. The fields to update. UpdateMask *fieldmaskpb.FieldMask `protobuf:"bytes,2,opt,name=update_mask,json=updateMask,proto3" json:"update_mask,omitempty"` // Required. A description of the changes to be applied to the specified // notification channel. The description must provide a definition for @@ -552,11 +538,9 @@ type UpdateNotificationChannelRequest struct { func (x *UpdateNotificationChannelRequest) Reset() { *x = UpdateNotificationChannelRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[7] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[7] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UpdateNotificationChannelRequest) String() string { @@ -567,7 +551,7 @@ func (*UpdateNotificationChannelRequest) ProtoMessage() {} func (x *UpdateNotificationChannelRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[7] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -608,18 +592,16 @@ type DeleteNotificationChannelRequest struct { Name string `protobuf:"bytes,3,opt,name=name,proto3" json:"name,omitempty"` // If true, the notification channel will be deleted regardless of its // use in alert policies (the policies will be updated to remove the - // channel). If false, channels that are still referenced by an existing - // alerting policy will fail to be deleted in a delete operation. + // channel). If false, this operation will fail if the notification channel + // is referenced by existing alerting policies. Force bool `protobuf:"varint,5,opt,name=force,proto3" json:"force,omitempty"` } func (x *DeleteNotificationChannelRequest) Reset() { *x = DeleteNotificationChannelRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[8] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[8] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *DeleteNotificationChannelRequest) String() string { @@ -630,7 +612,7 @@ func (*DeleteNotificationChannelRequest) ProtoMessage() {} func (x *DeleteNotificationChannelRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[8] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -671,11 +653,9 @@ type SendNotificationChannelVerificationCodeRequest struct { func (x *SendNotificationChannelVerificationCodeRequest) Reset() { *x = SendNotificationChannelVerificationCodeRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[9] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[9] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *SendNotificationChannelVerificationCodeRequest) String() string { @@ -686,7 +666,7 @@ func (*SendNotificationChannelVerificationCodeRequest) ProtoMessage() {} func (x *SendNotificationChannelVerificationCodeRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[9] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -732,11 +712,9 @@ type GetNotificationChannelVerificationCodeRequest struct { func (x *GetNotificationChannelVerificationCodeRequest) Reset() { *x = GetNotificationChannelVerificationCodeRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[10] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[10] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetNotificationChannelVerificationCodeRequest) String() string { @@ -747,7 +725,7 @@ func (*GetNotificationChannelVerificationCodeRequest) ProtoMessage() {} func (x *GetNotificationChannelVerificationCodeRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[10] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -795,11 +773,9 @@ type GetNotificationChannelVerificationCodeResponse struct { func (x *GetNotificationChannelVerificationCodeResponse) Reset() { *x = GetNotificationChannelVerificationCodeResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[11] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[11] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetNotificationChannelVerificationCodeResponse) String() string { @@ -810,7 +786,7 @@ func (*GetNotificationChannelVerificationCodeResponse) ProtoMessage() {} func (x *GetNotificationChannelVerificationCodeResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[11] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -859,11 +835,9 @@ type VerifyNotificationChannelRequest struct { func (x *VerifyNotificationChannelRequest) Reset() { *x = VerifyNotificationChannelRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[12] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[12] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *VerifyNotificationChannelRequest) String() string { @@ -874,7 +848,7 @@ func (*VerifyNotificationChannelRequest) ProtoMessage() {} func (x *VerifyNotificationChannelRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_notification_service_proto_msgTypes[12] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -971,262 +945,263 @@ var file_google_monitoring_v3_notification_service_proto_rawDesc = []byte{ 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x13, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, - 0x65, 0x6c, 0x22, 0xdb, 0x01, 0x0a, 0x1f, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, + 0x65, 0x6c, 0x22, 0xef, 0x01, 0x0a, 0x1f, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x49, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x42, 0x35, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2f, 0x12, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x04, 0x6e, 0x61, 0x6d, - 0x65, 0x12, 0x16, 0x0a, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x18, 0x06, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, 0x19, 0x0a, 0x08, 0x6f, 0x72, 0x64, - 0x65, 0x72, 0x5f, 0x62, 0x79, 0x18, 0x07, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x6f, 0x72, 0x64, - 0x65, 0x72, 0x42, 0x79, 0x12, 0x1b, 0x0a, 0x09, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x69, 0x7a, - 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x05, 0x52, 0x08, 0x70, 0x61, 0x67, 0x65, 0x53, 0x69, 0x7a, - 0x65, 0x12, 0x1d, 0x0a, 0x0a, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, - 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x70, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, - 0x22, 0xc9, 0x01, 0x0a, 0x20, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x52, 0x65, 0x73, - 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x5e, 0x0a, 0x15, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x18, 0x03, - 0x20, 0x03, 0x28, 0x0b, 0x32, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, - 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, - 0x14, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, - 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x12, 0x26, 0x0a, 0x0f, 0x6e, 0x65, 0x78, 0x74, 0x5f, 0x70, 0x61, - 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, - 0x6e, 0x65, 0x78, 0x74, 0x50, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x12, 0x1d, 0x0a, - 0x0a, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, - 0x05, 0x52, 0x09, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x53, 0x69, 0x7a, 0x65, 0x22, 0x6a, 0x0a, 0x1d, - 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, - 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x49, 0x0a, - 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x35, 0xe0, 0x41, 0x02, - 0xfa, 0x41, 0x2f, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4e, - 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, - 0x65, 0x6c, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0xc2, 0x01, 0x0a, 0x20, 0x55, 0x70, 0x64, - 0x61, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, - 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x3b, 0x0a, - 0x0b, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x52, 0x0a, - 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4d, 0x61, 0x73, 0x6b, 0x12, 0x61, 0x0a, 0x14, 0x6e, 0x6f, - 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, - 0x65, 0x6c, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x12, 0x1b, 0x0a, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x18, 0x06, 0x20, 0x01, 0x28, + 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x06, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, 0x1e, + 0x0a, 0x08, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x5f, 0x62, 0x79, 0x18, 0x07, 0x20, 0x01, 0x28, 0x09, + 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x07, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x42, 0x79, 0x12, 0x20, + 0x0a, 0x09, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, + 0x05, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x08, 0x70, 0x61, 0x67, 0x65, 0x53, 0x69, 0x7a, 0x65, + 0x12, 0x22, 0x0a, 0x0a, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x04, + 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x09, 0x70, 0x61, 0x67, 0x65, 0x54, + 0x6f, 0x6b, 0x65, 0x6e, 0x22, 0xc9, 0x01, 0x0a, 0x20, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, + 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, + 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x5e, 0x0a, 0x15, 0x6e, 0x6f, 0x74, + 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, + 0x6c, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, - 0x6e, 0x65, 0x6c, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x13, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, - 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x22, 0x83, 0x01, - 0x0a, 0x20, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, - 0x73, 0x74, 0x12, 0x49, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, - 0x42, 0x35, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2f, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, - 0x63, 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x14, 0x0a, - 0x05, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x52, 0x05, 0x66, 0x6f, - 0x72, 0x63, 0x65, 0x22, 0x7b, 0x0a, 0x2e, 0x53, 0x65, 0x6e, 0x64, 0x4e, 0x6f, 0x74, 0x69, 0x66, + 0x6e, 0x65, 0x6c, 0x52, 0x14, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x12, 0x26, 0x0a, 0x0f, 0x6e, 0x65, 0x78, + 0x74, 0x5f, 0x70, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x02, 0x20, 0x01, + 0x28, 0x09, 0x52, 0x0d, 0x6e, 0x65, 0x78, 0x74, 0x50, 0x61, 0x67, 0x65, 0x54, 0x6f, 0x6b, 0x65, + 0x6e, 0x12, 0x1d, 0x0a, 0x0a, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, + 0x04, 0x20, 0x01, 0x28, 0x05, 0x52, 0x09, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x53, 0x69, 0x7a, 0x65, + 0x22, 0x6a, 0x0a, 0x1d, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, + 0x74, 0x12, 0x49, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, + 0x35, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2f, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, + 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, + 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0xc7, 0x01, 0x0a, + 0x20, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, + 0x74, 0x12, 0x40, 0x0a, 0x0b, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x5f, 0x6d, 0x61, 0x73, 0x6b, + 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4d, 0x61, + 0x73, 0x6b, 0x42, 0x03, 0xe0, 0x41, 0x01, 0x52, 0x0a, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4d, + 0x61, 0x73, 0x6b, 0x12, 0x61, 0x0a, 0x14, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x18, 0x03, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x42, 0x03, 0xe0, 0x41, + 0x02, 0x52, 0x13, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, + 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x22, 0x83, 0x01, 0x0a, 0x20, 0x44, 0x65, 0x6c, 0x65, 0x74, + 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, + 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x49, 0x0a, 0x04, 0x6e, + 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x35, 0xe0, 0x41, 0x02, 0xfa, 0x41, + 0x2f, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, 0x74, + 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, + 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x18, + 0x05, 0x20, 0x01, 0x28, 0x08, 0x52, 0x05, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x22, 0x7b, 0x0a, 0x2e, + 0x53, 0x65, 0x6e, 0x64, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x49, + 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x35, 0xe0, 0x41, + 0x02, 0xfa, 0x41, 0x2f, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, + 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, + 0x6e, 0x65, 0x6c, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0xb7, 0x01, 0x0a, 0x2d, 0x47, 0x65, + 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, + 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x43, 0x6f, 0x64, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x49, 0x0a, 0x04, 0x6e, + 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x35, 0xe0, 0x41, 0x02, 0xfa, 0x41, + 0x2f, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, 0x74, + 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, + 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x3b, 0x0a, 0x0b, 0x65, 0x78, 0x70, 0x69, 0x72, 0x65, + 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, + 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x52, 0x0a, 0x65, 0x78, 0x70, 0x69, 0x72, 0x65, 0x54, + 0x69, 0x6d, 0x65, 0x22, 0x81, 0x01, 0x0a, 0x2e, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x52, 0x65, - 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x49, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x09, 0x42, 0x35, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2f, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, - 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, - 0x22, 0xb7, 0x01, 0x0a, 0x2d, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, 0x66, - 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, - 0x73, 0x74, 0x12, 0x49, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, - 0x42, 0x35, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2f, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, - 0x63, 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x3b, 0x0a, - 0x0b, 0x65, 0x78, 0x70, 0x69, 0x72, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x52, 0x0a, - 0x65, 0x78, 0x70, 0x69, 0x72, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x22, 0x81, 0x01, 0x0a, 0x2e, 0x47, - 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, - 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x12, 0x0a, - 0x04, 0x63, 0x6f, 0x64, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x63, 0x6f, 0x64, - 0x65, 0x12, 0x3b, 0x0a, 0x0b, 0x65, 0x78, 0x70, 0x69, 0x72, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, - 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, - 0x6d, 0x70, 0x52, 0x0a, 0x65, 0x78, 0x70, 0x69, 0x72, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x22, 0x86, - 0x01, 0x0a, 0x20, 0x56, 0x65, 0x72, 0x69, 0x66, 0x79, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, - 0x65, 0x73, 0x74, 0x12, 0x49, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, - 0x09, 0x42, 0x35, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x2f, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, - 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x17, - 0x0a, 0x04, 0x63, 0x6f, 0x64, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, - 0x02, 0x52, 0x04, 0x63, 0x6f, 0x64, 0x65, 0x32, 0xea, 0x12, 0x0a, 0x1a, 0x4e, 0x6f, 0x74, 0x69, - 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x53, - 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x12, 0xec, 0x01, 0x0a, 0x22, 0x4c, 0x69, 0x73, 0x74, 0x4e, - 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, - 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0x3f, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, - 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x40, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, + 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x12, 0x0a, 0x04, 0x63, 0x6f, 0x64, 0x65, 0x18, 0x01, + 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x63, 0x6f, 0x64, 0x65, 0x12, 0x3b, 0x0a, 0x0b, 0x65, 0x78, + 0x70, 0x69, 0x72, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x52, 0x0a, 0x65, 0x78, 0x70, + 0x69, 0x72, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x22, 0x86, 0x01, 0x0a, 0x20, 0x56, 0x65, 0x72, 0x69, + 0x66, 0x79, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, + 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x49, 0x0a, 0x04, + 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x35, 0xe0, 0x41, 0x02, 0xfa, + 0x41, 0x2f, 0x0a, 0x2d, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x4e, 0x6f, + 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, + 0x6c, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x17, 0x0a, 0x04, 0x63, 0x6f, 0x64, 0x65, 0x18, + 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x04, 0x63, 0x6f, 0x64, 0x65, + 0x32, 0xea, 0x12, 0x0a, 0x1a, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x12, + 0xec, 0x01, 0x0a, 0x22, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, + 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0x3f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, + 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, + 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, + 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x40, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, + 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, + 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, + 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x43, 0xda, 0x41, 0x04, 0x6e, 0x61, + 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x36, 0x12, 0x34, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, + 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, + 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, + 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0xdd, + 0x01, 0x0a, 0x20, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x12, 0x3d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x47, 0x65, 0x74, 0x4e, 0x6f, + 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, + 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, + 0x73, 0x74, 0x1a, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, - 0x22, 0x43, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x36, 0x12, - 0x34, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, - 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, - 0x70, 0x74, 0x6f, 0x72, 0x73, 0x12, 0xdd, 0x01, 0x0a, 0x20, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, + 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x22, 0x45, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, + 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x38, 0x12, 0x36, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, + 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, - 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x3d, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, - 0x6f, 0x72, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, - 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, - 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x22, 0x45, - 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x38, 0x12, 0x36, 0x2f, - 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, - 0x73, 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, - 0x72, 0x73, 0x2f, 0x2a, 0x7d, 0x12, 0xc4, 0x01, 0x0a, 0x18, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, - 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, - 0x6c, 0x73, 0x12, 0x35, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, + 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x73, 0x2f, 0x2a, 0x7d, 0x12, 0xc4, + 0x01, 0x0a, 0x18, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x12, 0x35, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, + 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, + 0x73, 0x74, 0x1a, 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, - 0x6c, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, - 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, - 0x65, 0x22, 0x39, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x2c, - 0x12, 0x2a, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, - 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x12, 0xb5, 0x01, 0x0a, - 0x16, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x12, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x47, - 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, - 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x29, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, - 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x22, 0x3b, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, - 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x2e, 0x12, 0x2c, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, - 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, + 0x6c, 0x73, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x39, 0xda, 0x41, 0x04, 0x6e, + 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x2c, 0x12, 0x2a, 0x2f, 0x76, 0x33, 0x2f, 0x7b, + 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, + 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, + 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x12, 0xb5, 0x01, 0x0a, 0x16, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, + 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, + 0x12, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, + 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, + 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, + 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, - 0x73, 0x2f, 0x2a, 0x7d, 0x12, 0xe4, 0x01, 0x0a, 0x19, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x4e, + 0x22, 0x3b, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x2e, 0x12, + 0x2c, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, + 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x2a, 0x7d, 0x12, 0xe4, 0x01, + 0x0a, 0x19, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x12, 0x36, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, + 0x76, 0x33, 0x2e, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, + 0x65, 0x73, 0x74, 0x1a, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, + 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x22, 0x64, + 0xda, 0x41, 0x19, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x82, 0xd3, 0xe4, 0x93, + 0x02, 0x42, 0x3a, 0x14, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x22, 0x2a, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, + 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, + 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, + 0x6e, 0x65, 0x6c, 0x73, 0x12, 0x83, 0x02, 0x0a, 0x19, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x12, 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x72, 0x65, 0x61, 0x74, 0x65, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, - 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x22, 0x64, 0xda, 0x41, 0x19, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x6e, - 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, - 0x6e, 0x65, 0x6c, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x42, 0x3a, 0x14, 0x6e, 0x6f, 0x74, 0x69, 0x66, - 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x22, - 0x2a, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, - 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x12, 0x83, 0x02, 0x0a, 0x19, - 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x12, 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, - 0x2e, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, - 0x74, 0x1a, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x22, 0x82, 0x01, 0xda, - 0x41, 0x20, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x2c, 0x6e, 0x6f, + 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x22, 0x82, 0x01, 0xda, 0x41, 0x20, 0x75, 0x70, 0x64, 0x61, 0x74, + 0x65, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x2c, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x82, 0xd3, 0xe4, 0x93, 0x02, + 0x59, 0x3a, 0x14, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, + 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x32, 0x41, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, - 0x65, 0x6c, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x59, 0x3a, 0x14, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, - 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x32, 0x41, - 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x2e, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, - 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, - 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x2a, - 0x7d, 0x12, 0xae, 0x01, 0x0a, 0x19, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, - 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x12, - 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x4e, 0x6f, 0x74, - 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, - 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x22, - 0x41, 0xda, 0x41, 0x0a, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x82, 0xd3, - 0xe4, 0x93, 0x02, 0x2e, 0x2a, 0x2c, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, - 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, - 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, - 0x2a, 0x7d, 0x12, 0xdc, 0x01, 0x0a, 0x27, 0x53, 0x65, 0x6e, 0x64, 0x4e, 0x6f, 0x74, 0x69, 0x66, - 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, - 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x12, 0x44, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x65, 0x6e, 0x64, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, - 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, - 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x52, 0x65, 0x71, - 0x75, 0x65, 0x73, 0x74, 0x1a, 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x22, 0x53, 0xda, 0x41, - 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x46, 0x3a, 0x01, 0x2a, 0x22, 0x41, - 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, - 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x2a, 0x7d, 0x3a, 0x73, 0x65, 0x6e, - 0x64, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, - 0x65, 0x12, 0x87, 0x02, 0x0a, 0x26, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, - 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x12, 0x43, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, - 0x2e, 0x76, 0x33, 0x2e, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, - 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, - 0x74, 0x1a, 0x44, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, - 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, - 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x52, - 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x52, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, - 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x45, 0x3a, 0x01, 0x2a, 0x22, 0x40, 0x2f, 0x76, 0x33, 0x2f, 0x7b, - 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, - 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, - 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x2a, 0x7d, 0x3a, 0x67, 0x65, 0x74, 0x56, 0x65, 0x72, 0x69, 0x66, - 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x12, 0xca, 0x01, 0x0a, 0x19, - 0x56, 0x65, 0x72, 0x69, 0x66, 0x79, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x12, 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, - 0x2e, 0x56, 0x65, 0x72, 0x69, 0x66, 0x79, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, - 0x74, 0x1a, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x22, 0x4a, 0xda, 0x41, - 0x09, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x63, 0x6f, 0x64, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x38, - 0x3a, 0x01, 0x2a, 0x22, 0x33, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, - 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, - 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x2a, - 0x7d, 0x3a, 0x76, 0x65, 0x72, 0x69, 0x66, 0x79, 0x1a, 0xa9, 0x01, 0xca, 0x41, 0x19, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, - 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0xd2, 0x41, 0x89, 0x01, 0x68, 0x74, 0x74, 0x70, 0x73, - 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, - 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x63, 0x6c, 0x6f, 0x75, 0x64, - 0x2d, 0x70, 0x6c, 0x61, 0x74, 0x66, 0x6f, 0x72, 0x6d, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, - 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, - 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, - 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, - 0x72, 0x65, 0x61, 0x64, 0x42, 0xd3, 0x01, 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, + 0x65, 0x6c, 0x2e, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, + 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, + 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x2a, 0x7d, 0x12, 0xae, 0x01, 0x0a, 0x19, 0x44, + 0x65, 0x6c, 0x65, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x12, 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, + 0x44, 0x65, 0x6c, 0x65, 0x74, 0x65, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, + 0x1a, 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, + 0x75, 0x66, 0x2e, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x22, 0x41, 0xda, 0x41, 0x0a, 0x6e, 0x61, 0x6d, + 0x65, 0x2c, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x2e, 0x2a, 0x2c, 0x2f, + 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, + 0x73, 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x2a, 0x7d, 0x12, 0xdc, 0x01, 0x0a, 0x27, + 0x53, 0x65, 0x6e, 0x64, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x12, 0x44, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x53, + 0x65, 0x6e, 0x64, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, + 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x16, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, + 0x45, 0x6d, 0x70, 0x74, 0x79, 0x22, 0x53, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, + 0xe4, 0x93, 0x02, 0x46, 0x3a, 0x01, 0x2a, 0x22, 0x41, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, + 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, + 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, + 0x6c, 0x73, 0x2f, 0x2a, 0x7d, 0x3a, 0x73, 0x65, 0x6e, 0x64, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, + 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x12, 0x87, 0x02, 0x0a, 0x26, 0x47, + 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, + 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x12, 0x43, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x47, 0x65, 0x74, + 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, + 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, + 0x6f, 0x64, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x44, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, + 0x33, 0x2e, 0x47, 0x65, 0x74, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x64, 0x65, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, + 0x22, 0x52, 0xda, 0x41, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x45, 0x3a, + 0x01, 0x2a, 0x22, 0x40, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, + 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x2a, 0x7d, + 0x3a, 0x67, 0x65, 0x74, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x43, 0x6f, 0x64, 0x65, 0x12, 0xca, 0x01, 0x0a, 0x19, 0x56, 0x65, 0x72, 0x69, 0x66, 0x79, 0x4e, + 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, 0x6e, + 0x65, 0x6c, 0x12, 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x56, 0x65, 0x72, 0x69, 0x66, 0x79, + 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x61, 0x6e, + 0x6e, 0x65, 0x6c, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x42, 0x18, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53, - 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, - 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, - 0x67, 0x6f, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, - 0x69, 0x76, 0x33, 0x2f, 0x76, 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, - 0x67, 0x70, 0x62, 0x3b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, - 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, - 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, - 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x3a, 0x3a, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x33, + 0x33, 0x2e, 0x4e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, + 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x22, 0x4a, 0xda, 0x41, 0x09, 0x6e, 0x61, 0x6d, 0x65, 0x2c, 0x63, + 0x6f, 0x64, 0x65, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x38, 0x3a, 0x01, 0x2a, 0x22, 0x33, 0x2f, 0x76, + 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, + 0x2f, 0x2a, 0x2f, 0x6e, 0x6f, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, + 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x2a, 0x7d, 0x3a, 0x76, 0x65, 0x72, 0x69, 0x66, + 0x79, 0x1a, 0xa9, 0x01, 0xca, 0x41, 0x19, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, + 0xd2, 0x41, 0x89, 0x01, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, + 0x75, 0x74, 0x68, 0x2f, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2d, 0x70, 0x6c, 0x61, 0x74, 0x66, 0x6f, + 0x72, 0x6d, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, + 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2c, 0x68, 0x74, + 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x72, 0x65, 0x61, 0x64, 0x42, 0xd3, 0x01, + 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x42, 0x18, 0x4e, 0x6f, 0x74, 0x69, + 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x50, + 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x67, 0x6f, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, 0x69, 0x76, 0x33, 0x2f, 0x76, 0x32, 0x2f, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0x3b, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x5c, + 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, + 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x3a, 0x3a, 0x43, 0x6c, + 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x3a, + 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( @@ -1303,164 +1278,6 @@ func file_google_monitoring_v3_notification_service_proto_init() { return } file_google_monitoring_v3_notification_proto_init() - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_notification_service_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*ListNotificationChannelDescriptorsRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*ListNotificationChannelDescriptorsResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*GetNotificationChannelDescriptorRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[3].Exporter = func(v any, i int) any { - switch v := v.(*CreateNotificationChannelRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[4].Exporter = func(v any, i int) any { - switch v := v.(*ListNotificationChannelsRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[5].Exporter = func(v any, i int) any { - switch v := v.(*ListNotificationChannelsResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[6].Exporter = func(v any, i int) any { - switch v := v.(*GetNotificationChannelRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[7].Exporter = func(v any, i int) any { - switch v := v.(*UpdateNotificationChannelRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[8].Exporter = func(v any, i int) any { - switch v := v.(*DeleteNotificationChannelRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[9].Exporter = func(v any, i int) any { - switch v := v.(*SendNotificationChannelVerificationCodeRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[10].Exporter = func(v any, i int) any { - switch v := v.(*GetNotificationChannelVerificationCodeRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[11].Exporter = func(v any, i int) any { - switch v := v.(*GetNotificationChannelVerificationCodeResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_notification_service_proto_msgTypes[12].Exporter = func(v any, i int) any { - switch v := v.(*VerifyNotificationChannelRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/query_service.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/query_service.pb.go index e9bfbd68f5379..b1f18a6d2534f 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/query_service.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/query_service.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/query_service.proto @@ -52,42 +52,42 @@ var file_google_monitoring_v3_query_service_proto_rawDesc = []byte{ 0x74, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x29, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x76, 0x33, 0x2f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x32, 0xde, 0x02, 0x0a, 0x0c, 0x51, 0x75, 0x65, 0x72, 0x79, 0x53, 0x65, 0x72, 0x76, - 0x69, 0x63, 0x65, 0x12, 0xa1, 0x01, 0x0a, 0x0f, 0x51, 0x75, 0x65, 0x72, 0x79, 0x54, 0x69, 0x6d, + 0x74, 0x6f, 0x32, 0xe1, 0x02, 0x0a, 0x0c, 0x51, 0x75, 0x65, 0x72, 0x79, 0x53, 0x65, 0x72, 0x76, + 0x69, 0x63, 0x65, 0x12, 0xa4, 0x01, 0x0a, 0x0f, 0x51, 0x75, 0x65, 0x72, 0x79, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x12, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x51, 0x75, 0x65, 0x72, 0x79, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x51, 0x75, 0x65, 0x72, 0x79, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x73, 0x70, - 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x31, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x2b, 0x3a, 0x01, 0x2a, 0x22, + 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x34, 0x82, 0xd3, 0xe4, 0x93, 0x02, 0x2b, 0x3a, 0x01, 0x2a, 0x22, 0x26, 0x2f, 0x76, 0x33, 0x2f, 0x7b, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x2a, 0x7d, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, - 0x73, 0x3a, 0x71, 0x75, 0x65, 0x72, 0x79, 0x1a, 0xa9, 0x01, 0xca, 0x41, 0x19, 0x6d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, - 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0xd2, 0x41, 0x89, 0x01, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, - 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, - 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2d, - 0x70, 0x6c, 0x61, 0x74, 0x66, 0x6f, 0x72, 0x6d, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, - 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, - 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x69, 0x6e, 0x67, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, - 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x72, - 0x65, 0x61, 0x64, 0x42, 0xcc, 0x01, 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, - 0x42, 0x11, 0x51, 0x75, 0x65, 0x72, 0x79, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x50, 0x72, - 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x67, 0x6f, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, 0x69, 0x76, 0x33, 0x2f, 0x76, 0x32, 0x2f, 0x6d, - 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0x3b, 0x6d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x5c, 0x43, - 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5c, - 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x3a, 0x3a, 0x43, 0x6c, 0x6f, - 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x3a, 0x3a, - 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x73, 0x3a, 0x71, 0x75, 0x65, 0x72, 0x79, 0x88, 0x02, 0x01, 0x1a, 0xa9, 0x01, 0xca, 0x41, 0x19, + 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0xd2, 0x41, 0x89, 0x01, 0x68, 0x74, 0x74, + 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, + 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x63, 0x6c, 0x6f, + 0x75, 0x64, 0x2d, 0x70, 0x6c, 0x61, 0x74, 0x66, 0x6f, 0x72, 0x6d, 0x2c, 0x68, 0x74, 0x74, 0x70, + 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, + 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, + 0x77, 0x77, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, + 0x6d, 0x2f, 0x61, 0x75, 0x74, 0x68, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x72, 0x65, 0x61, 0x64, 0x42, 0xcc, 0x01, 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, + 0x2e, 0x76, 0x33, 0x42, 0x11, 0x51, 0x75, 0x65, 0x72, 0x79, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, + 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x67, 0x6f, 0x2f, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, 0x69, 0x76, 0x33, 0x2f, 0x76, + 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0x3b, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0xaa, 0x02, 0x1a, 0x47, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, + 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x3a, 0x3a, + 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var file_google_monitoring_v3_query_service_proto_goTypes = []any{ @@ -141,7 +141,11 @@ const _ = grpc.SupportPackageIsVersion6 // // For semantics around ctx use and closing/ending streaming RPCs, please refer to https://godoc.org/google.golang.org/grpc#ClientConn.NewStream. type QueryServiceClient interface { - // Queries time series using Monitoring Query Language. + // Deprecated: Do not use. + // Queries time series by using Monitoring Query Language (MQL). We recommend + // using PromQL instead of MQL. For more information about the status of MQL, + // see the [MQL deprecation + // notice](https://cloud.google.com/stackdriver/docs/deprecations/mql). QueryTimeSeries(ctx context.Context, in *QueryTimeSeriesRequest, opts ...grpc.CallOption) (*QueryTimeSeriesResponse, error) } @@ -153,6 +157,7 @@ func NewQueryServiceClient(cc grpc.ClientConnInterface) QueryServiceClient { return &queryServiceClient{cc} } +// Deprecated: Do not use. func (c *queryServiceClient) QueryTimeSeries(ctx context.Context, in *QueryTimeSeriesRequest, opts ...grpc.CallOption) (*QueryTimeSeriesResponse, error) { out := new(QueryTimeSeriesResponse) err := c.cc.Invoke(ctx, "/google.monitoring.v3.QueryService/QueryTimeSeries", in, out, opts...) @@ -164,7 +169,11 @@ func (c *queryServiceClient) QueryTimeSeries(ctx context.Context, in *QueryTimeS // QueryServiceServer is the server API for QueryService service. type QueryServiceServer interface { - // Queries time series using Monitoring Query Language. + // Deprecated: Do not use. + // Queries time series by using Monitoring Query Language (MQL). We recommend + // using PromQL instead of MQL. For more information about the status of MQL, + // see the [MQL deprecation + // notice](https://cloud.google.com/stackdriver/docs/deprecations/mql). QueryTimeSeries(context.Context, *QueryTimeSeriesRequest) (*QueryTimeSeriesResponse, error) } diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/service.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/service.pb.go index 869a3738c09b9..aa462351d7c48 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/service.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/service.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/service.proto @@ -147,11 +147,9 @@ type Service struct { func (x *Service) Reset() { *x = Service{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service) String() string { @@ -162,7 +160,7 @@ func (*Service) ProtoMessage() {} func (x *Service) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -387,7 +385,7 @@ type ServiceLevelObjective struct { // quality. ServiceLevelIndicator *ServiceLevelIndicator `protobuf:"bytes,3,opt,name=service_level_indicator,json=serviceLevelIndicator,proto3" json:"service_level_indicator,omitempty"` // The fraction of service that must be good in order for this objective to be - // met. `0 < goal <= 0.999`. + // met. `0 < goal <= 0.9999`. Goal float64 `protobuf:"fixed64,4,opt,name=goal,proto3" json:"goal,omitempty"` // The time period over which the objective will be evaluated. // @@ -407,11 +405,9 @@ type ServiceLevelObjective struct { func (x *ServiceLevelObjective) Reset() { *x = ServiceLevelObjective{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ServiceLevelObjective) String() string { @@ -422,7 +418,7 @@ func (*ServiceLevelObjective) ProtoMessage() {} func (x *ServiceLevelObjective) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -546,11 +542,9 @@ type ServiceLevelIndicator struct { func (x *ServiceLevelIndicator) Reset() { *x = ServiceLevelIndicator{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ServiceLevelIndicator) String() string { @@ -561,7 +555,7 @@ func (*ServiceLevelIndicator) ProtoMessage() {} func (x *ServiceLevelIndicator) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -669,11 +663,9 @@ type BasicSli struct { func (x *BasicSli) Reset() { *x = BasicSli{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[3] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *BasicSli) String() string { @@ -684,7 +676,7 @@ func (*BasicSli) ProtoMessage() {} func (x *BasicSli) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -775,11 +767,9 @@ type Range struct { func (x *Range) Reset() { *x = Range{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[4] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[4] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Range) String() string { @@ -790,7 +780,7 @@ func (*Range) ProtoMessage() {} func (x *Range) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[4] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -837,11 +827,9 @@ type RequestBasedSli struct { func (x *RequestBasedSli) Reset() { *x = RequestBasedSli{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[5] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[5] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *RequestBasedSli) String() string { @@ -852,7 +840,7 @@ func (*RequestBasedSli) ProtoMessage() {} func (x *RequestBasedSli) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[5] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -941,11 +929,9 @@ type TimeSeriesRatio struct { func (x *TimeSeriesRatio) Reset() { *x = TimeSeriesRatio{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[6] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[6] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *TimeSeriesRatio) String() string { @@ -956,7 +942,7 @@ func (*TimeSeriesRatio) ProtoMessage() {} func (x *TimeSeriesRatio) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[6] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1013,11 +999,9 @@ type DistributionCut struct { func (x *DistributionCut) Reset() { *x = DistributionCut{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[7] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[7] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *DistributionCut) String() string { @@ -1028,7 +1012,7 @@ func (*DistributionCut) ProtoMessage() {} func (x *DistributionCut) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[7] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1081,11 +1065,9 @@ type WindowsBasedSli struct { func (x *WindowsBasedSli) Reset() { *x = WindowsBasedSli{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[8] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[8] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *WindowsBasedSli) String() string { @@ -1096,7 +1078,7 @@ func (*WindowsBasedSli) ProtoMessage() {} func (x *WindowsBasedSli) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[8] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1200,11 +1182,9 @@ type Service_Custom struct { func (x *Service_Custom) Reset() { *x = Service_Custom{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[9] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[9] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_Custom) String() string { @@ -1215,7 +1195,7 @@ func (*Service_Custom) ProtoMessage() {} func (x *Service_Custom) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[9] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1244,11 +1224,9 @@ type Service_AppEngine struct { func (x *Service_AppEngine) Reset() { *x = Service_AppEngine{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[10] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[10] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_AppEngine) String() string { @@ -1259,7 +1237,7 @@ func (*Service_AppEngine) ProtoMessage() {} func (x *Service_AppEngine) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[10] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1295,11 +1273,9 @@ type Service_CloudEndpoints struct { func (x *Service_CloudEndpoints) Reset() { *x = Service_CloudEndpoints{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[11] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[11] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_CloudEndpoints) String() string { @@ -1310,7 +1286,7 @@ func (*Service_CloudEndpoints) ProtoMessage() {} func (x *Service_CloudEndpoints) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[11] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1358,11 +1334,9 @@ type Service_ClusterIstio struct { func (x *Service_ClusterIstio) Reset() { *x = Service_ClusterIstio{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[12] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[12] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_ClusterIstio) String() string { @@ -1373,7 +1347,7 @@ func (*Service_ClusterIstio) ProtoMessage() {} func (x *Service_ClusterIstio) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[12] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1436,11 +1410,9 @@ type Service_MeshIstio struct { func (x *Service_MeshIstio) Reset() { *x = Service_MeshIstio{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[13] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[13] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_MeshIstio) String() string { @@ -1451,7 +1423,7 @@ func (*Service_MeshIstio) ProtoMessage() {} func (x *Service_MeshIstio) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[13] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1512,11 +1484,9 @@ type Service_IstioCanonicalService struct { func (x *Service_IstioCanonicalService) Reset() { *x = Service_IstioCanonicalService{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[14] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[14] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_IstioCanonicalService) String() string { @@ -1527,7 +1497,7 @@ func (*Service_IstioCanonicalService) ProtoMessage() {} func (x *Service_IstioCanonicalService) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[14] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1581,11 +1551,9 @@ type Service_CloudRun struct { func (x *Service_CloudRun) Reset() { *x = Service_CloudRun{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[15] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[15] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_CloudRun) String() string { @@ -1596,7 +1564,7 @@ func (*Service_CloudRun) ProtoMessage() {} func (x *Service_CloudRun) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[15] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1647,11 +1615,9 @@ type Service_GkeNamespace struct { func (x *Service_GkeNamespace) Reset() { *x = Service_GkeNamespace{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[16] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[16] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_GkeNamespace) String() string { @@ -1662,7 +1628,7 @@ func (*Service_GkeNamespace) ProtoMessage() {} func (x *Service_GkeNamespace) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[16] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1731,11 +1697,9 @@ type Service_GkeWorkload struct { func (x *Service_GkeWorkload) Reset() { *x = Service_GkeWorkload{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[17] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[17] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_GkeWorkload) String() string { @@ -1746,7 +1710,7 @@ func (*Service_GkeWorkload) ProtoMessage() {} func (x *Service_GkeWorkload) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[17] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1830,11 +1794,9 @@ type Service_GkeService struct { func (x *Service_GkeService) Reset() { *x = Service_GkeService{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[18] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[18] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_GkeService) String() string { @@ -1845,7 +1807,7 @@ func (*Service_GkeService) ProtoMessage() {} func (x *Service_GkeService) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[18] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1917,11 +1879,9 @@ type Service_BasicService struct { func (x *Service_BasicService) Reset() { *x = Service_BasicService{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[19] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[19] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_BasicService) String() string { @@ -1932,7 +1892,7 @@ func (*Service_BasicService) ProtoMessage() {} func (x *Service_BasicService) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[19] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1974,11 +1934,9 @@ type Service_Telemetry struct { func (x *Service_Telemetry) Reset() { *x = Service_Telemetry{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[20] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[20] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Service_Telemetry) String() string { @@ -1989,7 +1947,7 @@ func (*Service_Telemetry) ProtoMessage() {} func (x *Service_Telemetry) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[20] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -2020,11 +1978,9 @@ type BasicSli_AvailabilityCriteria struct { func (x *BasicSli_AvailabilityCriteria) Reset() { *x = BasicSli_AvailabilityCriteria{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[24] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[24] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *BasicSli_AvailabilityCriteria) String() string { @@ -2035,7 +1991,7 @@ func (*BasicSli_AvailabilityCriteria) ProtoMessage() {} func (x *BasicSli_AvailabilityCriteria) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[24] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -2063,11 +2019,9 @@ type BasicSli_LatencyCriteria struct { func (x *BasicSli_LatencyCriteria) Reset() { *x = BasicSli_LatencyCriteria{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[25] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[25] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *BasicSli_LatencyCriteria) String() string { @@ -2078,7 +2032,7 @@ func (*BasicSli_LatencyCriteria) ProtoMessage() {} func (x *BasicSli_LatencyCriteria) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[25] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -2121,11 +2075,9 @@ type WindowsBasedSli_PerformanceThreshold struct { func (x *WindowsBasedSli_PerformanceThreshold) Reset() { *x = WindowsBasedSli_PerformanceThreshold{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[26] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[26] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *WindowsBasedSli_PerformanceThreshold) String() string { @@ -2136,7 +2088,7 @@ func (*WindowsBasedSli_PerformanceThreshold) ProtoMessage() {} func (x *WindowsBasedSli_PerformanceThreshold) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[26] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -2218,11 +2170,9 @@ type WindowsBasedSli_MetricRange struct { func (x *WindowsBasedSli_MetricRange) Reset() { *x = WindowsBasedSli_MetricRange{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_proto_msgTypes[27] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_proto_msgTypes[27] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *WindowsBasedSli_MetricRange) String() string { @@ -2233,7 +2183,7 @@ func (*WindowsBasedSli_MetricRange) ProtoMessage() {} func (x *WindowsBasedSli_MetricRange) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_proto_msgTypes[27] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -2744,308 +2694,6 @@ func file_google_monitoring_v3_service_proto_init() { if File_google_monitoring_v3_service_proto != nil { return } - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_service_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*Service); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*ServiceLevelObjective); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*ServiceLevelIndicator); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[3].Exporter = func(v any, i int) any { - switch v := v.(*BasicSli); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[4].Exporter = func(v any, i int) any { - switch v := v.(*Range); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[5].Exporter = func(v any, i int) any { - switch v := v.(*RequestBasedSli); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[6].Exporter = func(v any, i int) any { - switch v := v.(*TimeSeriesRatio); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[7].Exporter = func(v any, i int) any { - switch v := v.(*DistributionCut); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[8].Exporter = func(v any, i int) any { - switch v := v.(*WindowsBasedSli); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[9].Exporter = func(v any, i int) any { - switch v := v.(*Service_Custom); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[10].Exporter = func(v any, i int) any { - switch v := v.(*Service_AppEngine); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[11].Exporter = func(v any, i int) any { - switch v := v.(*Service_CloudEndpoints); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[12].Exporter = func(v any, i int) any { - switch v := v.(*Service_ClusterIstio); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[13].Exporter = func(v any, i int) any { - switch v := v.(*Service_MeshIstio); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[14].Exporter = func(v any, i int) any { - switch v := v.(*Service_IstioCanonicalService); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[15].Exporter = func(v any, i int) any { - switch v := v.(*Service_CloudRun); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[16].Exporter = func(v any, i int) any { - switch v := v.(*Service_GkeNamespace); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[17].Exporter = func(v any, i int) any { - switch v := v.(*Service_GkeWorkload); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[18].Exporter = func(v any, i int) any { - switch v := v.(*Service_GkeService); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[19].Exporter = func(v any, i int) any { - switch v := v.(*Service_BasicService); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[20].Exporter = func(v any, i int) any { - switch v := v.(*Service_Telemetry); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[24].Exporter = func(v any, i int) any { - switch v := v.(*BasicSli_AvailabilityCriteria); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[25].Exporter = func(v any, i int) any { - switch v := v.(*BasicSli_LatencyCriteria); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[26].Exporter = func(v any, i int) any { - switch v := v.(*WindowsBasedSli_PerformanceThreshold); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_proto_msgTypes[27].Exporter = func(v any, i int) any { - switch v := v.(*WindowsBasedSli_MetricRange); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } file_google_monitoring_v3_service_proto_msgTypes[0].OneofWrappers = []any{ (*Service_Custom_)(nil), (*Service_AppEngine_)(nil), diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/service_service.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/service_service.pb.go index 15e1f04d6a50f..01520d88a2ce6 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/service_service.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/service_service.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/service_service.proto @@ -63,11 +63,9 @@ type CreateServiceRequest struct { func (x *CreateServiceRequest) Reset() { *x = CreateServiceRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateServiceRequest) String() string { @@ -78,7 +76,7 @@ func (*CreateServiceRequest) ProtoMessage() {} func (x *CreateServiceRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -128,11 +126,9 @@ type GetServiceRequest struct { func (x *GetServiceRequest) Reset() { *x = GetServiceRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetServiceRequest) String() string { @@ -143,7 +139,7 @@ func (*GetServiceRequest) ProtoMessage() {} func (x *GetServiceRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -208,11 +204,9 @@ type ListServicesRequest struct { func (x *ListServicesRequest) Reset() { *x = ListServicesRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListServicesRequest) String() string { @@ -223,7 +217,7 @@ func (*ListServicesRequest) ProtoMessage() {} func (x *ListServicesRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -282,11 +276,9 @@ type ListServicesResponse struct { func (x *ListServicesResponse) Reset() { *x = ListServicesResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[3] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListServicesResponse) String() string { @@ -297,7 +289,7 @@ func (*ListServicesResponse) ProtoMessage() {} func (x *ListServicesResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -341,11 +333,9 @@ type UpdateServiceRequest struct { func (x *UpdateServiceRequest) Reset() { *x = UpdateServiceRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[4] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[4] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UpdateServiceRequest) String() string { @@ -356,7 +346,7 @@ func (*UpdateServiceRequest) ProtoMessage() {} func (x *UpdateServiceRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[4] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -399,11 +389,9 @@ type DeleteServiceRequest struct { func (x *DeleteServiceRequest) Reset() { *x = DeleteServiceRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[5] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[5] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *DeleteServiceRequest) String() string { @@ -414,7 +402,7 @@ func (*DeleteServiceRequest) ProtoMessage() {} func (x *DeleteServiceRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[5] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -458,11 +446,9 @@ type CreateServiceLevelObjectiveRequest struct { func (x *CreateServiceLevelObjectiveRequest) Reset() { *x = CreateServiceLevelObjectiveRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[6] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[6] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateServiceLevelObjectiveRequest) String() string { @@ -473,7 +459,7 @@ func (*CreateServiceLevelObjectiveRequest) ProtoMessage() {} func (x *CreateServiceLevelObjectiveRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[6] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -529,11 +515,9 @@ type GetServiceLevelObjectiveRequest struct { func (x *GetServiceLevelObjectiveRequest) Reset() { *x = GetServiceLevelObjectiveRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[7] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[7] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetServiceLevelObjectiveRequest) String() string { @@ -544,7 +528,7 @@ func (*GetServiceLevelObjectiveRequest) ProtoMessage() {} func (x *GetServiceLevelObjectiveRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[7] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -603,11 +587,9 @@ type ListServiceLevelObjectivesRequest struct { func (x *ListServiceLevelObjectivesRequest) Reset() { *x = ListServiceLevelObjectivesRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[8] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[8] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListServiceLevelObjectivesRequest) String() string { @@ -618,7 +600,7 @@ func (*ListServiceLevelObjectivesRequest) ProtoMessage() {} func (x *ListServiceLevelObjectivesRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[8] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -684,11 +666,9 @@ type ListServiceLevelObjectivesResponse struct { func (x *ListServiceLevelObjectivesResponse) Reset() { *x = ListServiceLevelObjectivesResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[9] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[9] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListServiceLevelObjectivesResponse) String() string { @@ -699,7 +679,7 @@ func (*ListServiceLevelObjectivesResponse) ProtoMessage() {} func (x *ListServiceLevelObjectivesResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[9] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -743,11 +723,9 @@ type UpdateServiceLevelObjectiveRequest struct { func (x *UpdateServiceLevelObjectiveRequest) Reset() { *x = UpdateServiceLevelObjectiveRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[10] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[10] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UpdateServiceLevelObjectiveRequest) String() string { @@ -758,7 +736,7 @@ func (*UpdateServiceLevelObjectiveRequest) ProtoMessage() {} func (x *UpdateServiceLevelObjectiveRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[10] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -802,11 +780,9 @@ type DeleteServiceLevelObjectiveRequest struct { func (x *DeleteServiceLevelObjectiveRequest) Reset() { *x = DeleteServiceLevelObjectiveRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_service_service_proto_msgTypes[11] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_service_service_proto_msgTypes[11] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *DeleteServiceLevelObjectiveRequest) String() string { @@ -817,7 +793,7 @@ func (*DeleteServiceLevelObjectiveRequest) ProtoMessage() {} func (x *DeleteServiceLevelObjectiveRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_service_service_proto_msgTypes[11] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1205,152 +1181,6 @@ func file_google_monitoring_v3_service_service_proto_init() { return } file_google_monitoring_v3_service_proto_init() - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_service_service_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*CreateServiceRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_service_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*GetServiceRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_service_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*ListServicesRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_service_proto_msgTypes[3].Exporter = func(v any, i int) any { - switch v := v.(*ListServicesResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_service_proto_msgTypes[4].Exporter = func(v any, i int) any { - switch v := v.(*UpdateServiceRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_service_proto_msgTypes[5].Exporter = func(v any, i int) any { - switch v := v.(*DeleteServiceRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_service_proto_msgTypes[6].Exporter = func(v any, i int) any { - switch v := v.(*CreateServiceLevelObjectiveRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_service_proto_msgTypes[7].Exporter = func(v any, i int) any { - switch v := v.(*GetServiceLevelObjectiveRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_service_proto_msgTypes[8].Exporter = func(v any, i int) any { - switch v := v.(*ListServiceLevelObjectivesRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_service_proto_msgTypes[9].Exporter = func(v any, i int) any { - switch v := v.(*ListServiceLevelObjectivesResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_service_proto_msgTypes[10].Exporter = func(v any, i int) any { - switch v := v.(*UpdateServiceLevelObjectiveRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_service_service_proto_msgTypes[11].Exporter = func(v any, i int) any { - switch v := v.(*DeleteServiceLevelObjectiveRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/snooze.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/snooze.pb.go index ab49868045dcc..dc835473887df 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/snooze.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/snooze.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/snooze.proto @@ -45,7 +45,7 @@ type Snooze struct { sizeCache protoimpl.SizeCache unknownFields protoimpl.UnknownFields - // Required. The name of the `Snooze`. The format is: + // Required. Identifier. The name of the `Snooze`. The format is: // // projects/[PROJECT_ID_OR_NUMBER]/snoozes/[SNOOZE_ID] // @@ -67,11 +67,9 @@ type Snooze struct { func (x *Snooze) Reset() { *x = Snooze{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_snooze_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_snooze_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Snooze) String() string { @@ -82,7 +80,7 @@ func (*Snooze) ProtoMessage() {} func (x *Snooze) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_snooze_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -145,11 +143,9 @@ type Snooze_Criteria struct { func (x *Snooze_Criteria) Reset() { *x = Snooze_Criteria{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_snooze_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_snooze_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *Snooze_Criteria) String() string { @@ -160,7 +156,7 @@ func (*Snooze_Criteria) ProtoMessage() {} func (x *Snooze_Criteria) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_snooze_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -196,7 +192,7 @@ var file_google_monitoring_v3_snooze_proto_rawDesc = []byte{ 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x76, 0x33, 0x2f, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0xf6, 0x02, 0x0a, 0x06, 0x53, 0x6e, 0x6f, 0x6f, 0x7a, 0x65, 0x12, 0x17, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, - 0x09, 0x42, 0x03, 0xe0, 0x41, 0x02, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x46, 0x0a, 0x08, + 0x09, 0x42, 0x03, 0xe0, 0x41, 0x08, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x46, 0x0a, 0x08, 0x63, 0x72, 0x69, 0x74, 0x65, 0x72, 0x69, 0x61, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x6e, 0x6f, 0x6f, 0x7a, 0x65, 0x2e, 0x43, 0x72, 0x69, @@ -268,32 +264,6 @@ func file_google_monitoring_v3_snooze_proto_init() { return } file_google_monitoring_v3_common_proto_init() - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_snooze_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*Snooze); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_snooze_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*Snooze_Criteria); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/snooze_service.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/snooze_service.pb.go index 39388a9982884..8c9ffaa9d4f88 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/snooze_service.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/snooze_service.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/snooze_service.proto @@ -61,11 +61,9 @@ type CreateSnoozeRequest struct { func (x *CreateSnoozeRequest) Reset() { *x = CreateSnoozeRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateSnoozeRequest) String() string { @@ -76,7 +74,7 @@ func (*CreateSnoozeRequest) ProtoMessage() {} func (x *CreateSnoozeRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -144,11 +142,9 @@ type ListSnoozesRequest struct { func (x *ListSnoozesRequest) Reset() { *x = ListSnoozesRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListSnoozesRequest) String() string { @@ -159,7 +155,7 @@ func (*ListSnoozesRequest) ProtoMessage() {} func (x *ListSnoozesRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -218,11 +214,9 @@ type ListSnoozesResponse struct { func (x *ListSnoozesResponse) Reset() { *x = ListSnoozesResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListSnoozesResponse) String() string { @@ -233,7 +227,7 @@ func (*ListSnoozesResponse) ProtoMessage() {} func (x *ListSnoozesResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -277,11 +271,9 @@ type GetSnoozeRequest struct { func (x *GetSnoozeRequest) Reset() { *x = GetSnoozeRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[3] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetSnoozeRequest) String() string { @@ -292,7 +284,7 @@ func (*GetSnoozeRequest) ProtoMessage() {} func (x *GetSnoozeRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -361,11 +353,9 @@ type UpdateSnoozeRequest struct { func (x *UpdateSnoozeRequest) Reset() { *x = UpdateSnoozeRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[4] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[4] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UpdateSnoozeRequest) String() string { @@ -376,7 +366,7 @@ func (*UpdateSnoozeRequest) ProtoMessage() {} func (x *UpdateSnoozeRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_snooze_service_proto_msgTypes[4] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -580,68 +570,6 @@ func file_google_monitoring_v3_snooze_service_proto_init() { return } file_google_monitoring_v3_snooze_proto_init() - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_snooze_service_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*CreateSnoozeRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_snooze_service_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*ListSnoozesRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_snooze_service_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*ListSnoozesResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_snooze_service_proto_msgTypes[3].Exporter = func(v any, i int) any { - switch v := v.(*GetSnoozeRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_snooze_service_proto_msgTypes[4].Exporter = func(v any, i int) any { - switch v := v.(*UpdateSnoozeRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/span_context.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/span_context.pb.go index 5a55ecc665091..3555d6e0a1cd5 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/span_context.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/span_context.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/span_context.proto @@ -61,11 +61,9 @@ type SpanContext struct { func (x *SpanContext) Reset() { *x = SpanContext{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_span_context_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_span_context_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *SpanContext) String() string { @@ -76,7 +74,7 @@ func (*SpanContext) ProtoMessage() {} func (x *SpanContext) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_span_context_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -153,20 +151,6 @@ func file_google_monitoring_v3_span_context_proto_init() { if File_google_monitoring_v3_span_context_proto != nil { return } - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_span_context_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*SpanContext); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/uptime.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/uptime.pb.go index e0b9e4a385a67..7e122ade520fa 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/uptime.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/uptime.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/uptime.proto @@ -699,11 +699,9 @@ type InternalChecker struct { func (x *InternalChecker) Reset() { *x = InternalChecker{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *InternalChecker) String() string { @@ -714,7 +712,7 @@ func (*InternalChecker) ProtoMessage() {} func (x *InternalChecker) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -787,11 +785,9 @@ type SyntheticMonitorTarget struct { func (x *SyntheticMonitorTarget) Reset() { *x = SyntheticMonitorTarget{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *SyntheticMonitorTarget) String() string { @@ -802,7 +798,7 @@ func (*SyntheticMonitorTarget) ProtoMessage() {} func (x *SyntheticMonitorTarget) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -928,11 +924,9 @@ type UptimeCheckConfig struct { func (x *UptimeCheckConfig) Reset() { *x = UptimeCheckConfig{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UptimeCheckConfig) String() string { @@ -943,7 +937,7 @@ func (*UptimeCheckConfig) ProtoMessage() {} func (x *UptimeCheckConfig) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1157,11 +1151,9 @@ type UptimeCheckIp struct { func (x *UptimeCheckIp) Reset() { *x = UptimeCheckIp{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[3] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UptimeCheckIp) String() string { @@ -1172,7 +1164,7 @@ func (*UptimeCheckIp) ProtoMessage() {} func (x *UptimeCheckIp) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1227,11 +1219,9 @@ type SyntheticMonitorTarget_CloudFunctionV2Target struct { func (x *SyntheticMonitorTarget_CloudFunctionV2Target) Reset() { *x = SyntheticMonitorTarget_CloudFunctionV2Target{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[4] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[4] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *SyntheticMonitorTarget_CloudFunctionV2Target) String() string { @@ -1242,7 +1232,7 @@ func (*SyntheticMonitorTarget_CloudFunctionV2Target) ProtoMessage() {} func (x *SyntheticMonitorTarget_CloudFunctionV2Target) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[4] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1288,11 +1278,9 @@ type UptimeCheckConfig_ResourceGroup struct { func (x *UptimeCheckConfig_ResourceGroup) Reset() { *x = UptimeCheckConfig_ResourceGroup{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[5] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[5] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UptimeCheckConfig_ResourceGroup) String() string { @@ -1303,7 +1291,7 @@ func (*UptimeCheckConfig_ResourceGroup) ProtoMessage() {} func (x *UptimeCheckConfig_ResourceGroup) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[5] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1346,11 +1334,9 @@ type UptimeCheckConfig_PingConfig struct { func (x *UptimeCheckConfig_PingConfig) Reset() { *x = UptimeCheckConfig_PingConfig{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[6] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[6] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UptimeCheckConfig_PingConfig) String() string { @@ -1361,7 +1347,7 @@ func (*UptimeCheckConfig_PingConfig) ProtoMessage() {} func (x *UptimeCheckConfig_PingConfig) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[6] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1474,11 +1460,9 @@ type UptimeCheckConfig_HttpCheck struct { func (x *UptimeCheckConfig_HttpCheck) Reset() { *x = UptimeCheckConfig_HttpCheck{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[7] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[7] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UptimeCheckConfig_HttpCheck) String() string { @@ -1489,7 +1473,7 @@ func (*UptimeCheckConfig_HttpCheck) ProtoMessage() {} func (x *UptimeCheckConfig_HttpCheck) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[7] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1639,11 +1623,9 @@ type UptimeCheckConfig_TcpCheck struct { func (x *UptimeCheckConfig_TcpCheck) Reset() { *x = UptimeCheckConfig_TcpCheck{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[8] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[8] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UptimeCheckConfig_TcpCheck) String() string { @@ -1654,7 +1636,7 @@ func (*UptimeCheckConfig_TcpCheck) ProtoMessage() {} func (x *UptimeCheckConfig_TcpCheck) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[8] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1711,11 +1693,9 @@ type UptimeCheckConfig_ContentMatcher struct { func (x *UptimeCheckConfig_ContentMatcher) Reset() { *x = UptimeCheckConfig_ContentMatcher{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[9] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[9] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UptimeCheckConfig_ContentMatcher) String() string { @@ -1726,7 +1706,7 @@ func (*UptimeCheckConfig_ContentMatcher) ProtoMessage() {} func (x *UptimeCheckConfig_ContentMatcher) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[9] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1798,11 +1778,9 @@ type UptimeCheckConfig_HttpCheck_BasicAuthentication struct { func (x *UptimeCheckConfig_HttpCheck_BasicAuthentication) Reset() { *x = UptimeCheckConfig_HttpCheck_BasicAuthentication{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[11] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[11] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UptimeCheckConfig_HttpCheck_BasicAuthentication) String() string { @@ -1813,7 +1791,7 @@ func (*UptimeCheckConfig_HttpCheck_BasicAuthentication) ProtoMessage() {} func (x *UptimeCheckConfig_HttpCheck_BasicAuthentication) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[11] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1860,11 +1838,9 @@ type UptimeCheckConfig_HttpCheck_ResponseStatusCode struct { func (x *UptimeCheckConfig_HttpCheck_ResponseStatusCode) Reset() { *x = UptimeCheckConfig_HttpCheck_ResponseStatusCode{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[12] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[12] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UptimeCheckConfig_HttpCheck_ResponseStatusCode) String() string { @@ -1875,7 +1851,7 @@ func (*UptimeCheckConfig_HttpCheck_ResponseStatusCode) ProtoMessage() {} func (x *UptimeCheckConfig_HttpCheck_ResponseStatusCode) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[12] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -1931,10 +1907,11 @@ func (*UptimeCheckConfig_HttpCheck_ResponseStatusCode_StatusValue) isUptimeCheck func (*UptimeCheckConfig_HttpCheck_ResponseStatusCode_StatusClass_) isUptimeCheckConfig_HttpCheck_ResponseStatusCode_StatusCode() { } -// Contains information needed for generating an +// Contains information needed for generating either an // [OpenID Connect -// token](https://developers.google.com/identity/protocols/OpenIDConnect). -// The OIDC token will be generated for the Monitoring service agent service +// token](https://developers.google.com/identity/protocols/OpenIDConnect) or +// [OAuth token](https://developers.google.com/identity/protocols/oauth2). +// The token will be generated for the Monitoring service agent service // account. type UptimeCheckConfig_HttpCheck_ServiceAgentAuthentication struct { state protoimpl.MessageState @@ -1947,11 +1924,9 @@ type UptimeCheckConfig_HttpCheck_ServiceAgentAuthentication struct { func (x *UptimeCheckConfig_HttpCheck_ServiceAgentAuthentication) Reset() { *x = UptimeCheckConfig_HttpCheck_ServiceAgentAuthentication{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[13] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[13] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UptimeCheckConfig_HttpCheck_ServiceAgentAuthentication) String() string { @@ -1962,7 +1937,7 @@ func (*UptimeCheckConfig_HttpCheck_ServiceAgentAuthentication) ProtoMessage() {} func (x *UptimeCheckConfig_HttpCheck_ServiceAgentAuthentication) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[13] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -2002,11 +1977,9 @@ type UptimeCheckConfig_ContentMatcher_JsonPathMatcher struct { func (x *UptimeCheckConfig_ContentMatcher_JsonPathMatcher) Reset() { *x = UptimeCheckConfig_ContentMatcher_JsonPathMatcher{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_proto_msgTypes[15] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_proto_msgTypes[15] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UptimeCheckConfig_ContentMatcher_JsonPathMatcher) String() string { @@ -2017,7 +1990,7 @@ func (*UptimeCheckConfig_ContentMatcher_JsonPathMatcher) ProtoMessage() {} func (x *UptimeCheckConfig_ContentMatcher_JsonPathMatcher) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_proto_msgTypes[15] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -2054,377 +2027,379 @@ var file_google_monitoring_v3_uptime_proto_rawDesc = []byte{ 0x6f, 0x74, 0x6f, 0x12, 0x14, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x1a, 0x1f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x5f, 0x62, 0x65, 0x68, 0x61, - 0x76, 0x69, 0x6f, 0x72, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x23, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, - 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, - 0x19, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x72, 0x65, 0x73, 0x6f, - 0x75, 0x72, 0x63, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x1e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x64, 0x75, 0x72, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0xa1, 0x02, 0x0a, 0x0f, 0x49, - 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x12, 0x12, - 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, - 0x6d, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x5f, 0x6e, 0x61, - 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, - 0x79, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x18, 0x0a, 0x07, 0x6e, 0x65, 0x74, 0x77, 0x6f, 0x72, 0x6b, - 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x6e, 0x65, 0x74, 0x77, 0x6f, 0x72, 0x6b, 0x12, - 0x19, 0x0a, 0x08, 0x67, 0x63, 0x70, 0x5f, 0x7a, 0x6f, 0x6e, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x07, 0x67, 0x63, 0x70, 0x5a, 0x6f, 0x6e, 0x65, 0x12, 0x26, 0x0a, 0x0f, 0x70, 0x65, - 0x65, 0x72, 0x5f, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x69, 0x64, 0x18, 0x06, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x0d, 0x70, 0x65, 0x65, 0x72, 0x50, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, - 0x49, 0x64, 0x12, 0x41, 0x0a, 0x05, 0x73, 0x74, 0x61, 0x74, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, - 0x0e, 0x32, 0x2b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, - 0x6c, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x2e, 0x53, 0x74, 0x61, 0x74, 0x65, 0x52, 0x05, - 0x73, 0x74, 0x61, 0x74, 0x65, 0x22, 0x33, 0x0a, 0x05, 0x53, 0x74, 0x61, 0x74, 0x65, 0x12, 0x0f, - 0x0a, 0x0b, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, - 0x0c, 0x0a, 0x08, 0x43, 0x52, 0x45, 0x41, 0x54, 0x49, 0x4e, 0x47, 0x10, 0x01, 0x12, 0x0b, 0x0a, - 0x07, 0x52, 0x55, 0x4e, 0x4e, 0x49, 0x4e, 0x47, 0x10, 0x02, 0x3a, 0x02, 0x18, 0x01, 0x22, 0xc4, - 0x02, 0x0a, 0x16, 0x53, 0x79, 0x6e, 0x74, 0x68, 0x65, 0x74, 0x69, 0x63, 0x4d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, 0x12, 0x70, 0x0a, 0x11, 0x63, 0x6c, 0x6f, - 0x75, 0x64, 0x5f, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x76, 0x32, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x42, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x79, 0x6e, 0x74, - 0x68, 0x65, 0x74, 0x69, 0x63, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x54, 0x61, 0x72, 0x67, - 0x65, 0x74, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x46, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, - 0x56, 0x32, 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, 0x48, 0x00, 0x52, 0x0f, 0x63, 0x6c, 0x6f, 0x75, - 0x64, 0x46, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x56, 0x32, 0x1a, 0xad, 0x01, 0x0a, 0x15, + 0x76, 0x69, 0x6f, 0x72, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x1b, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x5f, 0x69, 0x6e, 0x66, + 0x6f, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x23, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, + 0x61, 0x70, 0x69, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x5f, 0x72, 0x65, + 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x19, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, + 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x1e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0xa1, 0x02, 0x0a, 0x0f, 0x49, 0x6e, 0x74, 0x65, + 0x72, 0x6e, 0x61, 0x6c, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x12, 0x12, 0x0a, 0x04, 0x6e, + 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, + 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, + 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x4e, 0x61, + 0x6d, 0x65, 0x12, 0x18, 0x0a, 0x07, 0x6e, 0x65, 0x74, 0x77, 0x6f, 0x72, 0x6b, 0x18, 0x03, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x07, 0x6e, 0x65, 0x74, 0x77, 0x6f, 0x72, 0x6b, 0x12, 0x19, 0x0a, 0x08, + 0x67, 0x63, 0x70, 0x5f, 0x7a, 0x6f, 0x6e, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, + 0x67, 0x63, 0x70, 0x5a, 0x6f, 0x6e, 0x65, 0x12, 0x26, 0x0a, 0x0f, 0x70, 0x65, 0x65, 0x72, 0x5f, + 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x69, 0x64, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, + 0x52, 0x0d, 0x70, 0x65, 0x65, 0x72, 0x50, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x49, 0x64, 0x12, + 0x41, 0x0a, 0x05, 0x73, 0x74, 0x61, 0x74, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2b, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, + 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x43, 0x68, + 0x65, 0x63, 0x6b, 0x65, 0x72, 0x2e, 0x53, 0x74, 0x61, 0x74, 0x65, 0x52, 0x05, 0x73, 0x74, 0x61, + 0x74, 0x65, 0x22, 0x33, 0x0a, 0x05, 0x53, 0x74, 0x61, 0x74, 0x65, 0x12, 0x0f, 0x0a, 0x0b, 0x55, + 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x0c, 0x0a, 0x08, + 0x43, 0x52, 0x45, 0x41, 0x54, 0x49, 0x4e, 0x47, 0x10, 0x01, 0x12, 0x0b, 0x0a, 0x07, 0x52, 0x55, + 0x4e, 0x4e, 0x49, 0x4e, 0x47, 0x10, 0x02, 0x3a, 0x02, 0x18, 0x01, 0x22, 0xc4, 0x02, 0x0a, 0x16, + 0x53, 0x79, 0x6e, 0x74, 0x68, 0x65, 0x74, 0x69, 0x63, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, 0x12, 0x70, 0x0a, 0x11, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x5f, + 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x76, 0x32, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x42, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x79, 0x6e, 0x74, 0x68, 0x65, 0x74, + 0x69, 0x63, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x46, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x56, 0x32, 0x54, - 0x61, 0x72, 0x67, 0x65, 0x74, 0x12, 0x42, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x09, 0x42, 0x2e, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x28, 0x0a, 0x26, 0x63, 0x6c, 0x6f, - 0x75, 0x64, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x46, 0x75, 0x6e, 0x63, 0x74, - 0x69, 0x6f, 0x6e, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x50, 0x0a, 0x12, 0x63, 0x6c, 0x6f, - 0x75, 0x64, 0x5f, 0x72, 0x75, 0x6e, 0x5f, 0x72, 0x65, 0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, - 0x70, 0x69, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, - 0x75, 0x72, 0x63, 0x65, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x10, 0x63, 0x6c, 0x6f, 0x75, 0x64, - 0x52, 0x75, 0x6e, 0x52, 0x65, 0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x42, 0x08, 0x0a, 0x06, 0x74, - 0x61, 0x72, 0x67, 0x65, 0x74, 0x22, 0x94, 0x23, 0x0a, 0x11, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, - 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x17, 0x0a, 0x04, 0x6e, - 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x08, 0x52, 0x04, - 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x5f, - 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x69, 0x73, 0x70, - 0x6c, 0x61, 0x79, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x4e, 0x0a, 0x12, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x18, 0x03, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x1d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, - 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x48, 0x00, 0x52, 0x11, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, - 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x12, 0x5e, 0x0a, 0x0e, 0x72, 0x65, 0x73, 0x6f, 0x75, - 0x72, 0x63, 0x65, 0x5f, 0x67, 0x72, 0x6f, 0x75, 0x70, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x35, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, - 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, - 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, - 0x65, 0x47, 0x72, 0x6f, 0x75, 0x70, 0x48, 0x00, 0x52, 0x0d, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x47, 0x72, 0x6f, 0x75, 0x70, 0x12, 0x5b, 0x0a, 0x11, 0x73, 0x79, 0x6e, 0x74, 0x68, - 0x65, 0x74, 0x69, 0x63, 0x5f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x18, 0x15, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x79, 0x6e, 0x74, 0x68, 0x65, - 0x74, 0x69, 0x63, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, - 0x48, 0x00, 0x52, 0x10, 0x73, 0x79, 0x6e, 0x74, 0x68, 0x65, 0x74, 0x69, 0x63, 0x4d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x12, 0x52, 0x0a, 0x0a, 0x68, 0x74, 0x74, 0x70, 0x5f, 0x63, 0x68, 0x65, - 0x63, 0x6b, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x31, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x61, 0x72, 0x67, 0x65, 0x74, 0x48, 0x00, 0x52, 0x0f, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x46, 0x75, + 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x56, 0x32, 0x1a, 0xad, 0x01, 0x0a, 0x15, 0x43, 0x6c, 0x6f, + 0x75, 0x64, 0x46, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x56, 0x32, 0x54, 0x61, 0x72, 0x67, + 0x65, 0x74, 0x12, 0x42, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, + 0x42, 0x2e, 0xe0, 0x41, 0x02, 0xfa, 0x41, 0x28, 0x0a, 0x26, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x66, + 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, + 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x46, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, + 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x50, 0x0a, 0x12, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x5f, + 0x72, 0x75, 0x6e, 0x5f, 0x72, 0x65, 0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x1d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, + 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, + 0x65, 0x42, 0x03, 0xe0, 0x41, 0x03, 0x52, 0x10, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x52, 0x75, 0x6e, + 0x52, 0x65, 0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x42, 0x08, 0x0a, 0x06, 0x74, 0x61, 0x72, 0x67, + 0x65, 0x74, 0x22, 0x94, 0x23, 0x0a, 0x11, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, + 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x17, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0xe0, 0x41, 0x08, 0x52, 0x04, 0x6e, 0x61, 0x6d, + 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x5f, 0x6e, 0x61, 0x6d, + 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, + 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x4e, 0x0a, 0x12, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, + 0x64, 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x1d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x48, + 0x00, 0x52, 0x11, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, + 0x75, 0x72, 0x63, 0x65, 0x12, 0x5e, 0x0a, 0x0e, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, + 0x5f, 0x67, 0x72, 0x6f, 0x75, 0x70, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x35, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, + 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x47, 0x72, + 0x6f, 0x75, 0x70, 0x48, 0x00, 0x52, 0x0d, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x47, + 0x72, 0x6f, 0x75, 0x70, 0x12, 0x5b, 0x0a, 0x11, 0x73, 0x79, 0x6e, 0x74, 0x68, 0x65, 0x74, 0x69, + 0x63, 0x5f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x18, 0x15, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x79, 0x6e, 0x74, 0x68, 0x65, 0x74, 0x69, 0x63, + 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, 0x48, 0x00, 0x52, + 0x10, 0x73, 0x79, 0x6e, 0x74, 0x68, 0x65, 0x74, 0x69, 0x63, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, + 0x72, 0x12, 0x52, 0x0a, 0x0a, 0x68, 0x74, 0x74, 0x70, 0x5f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x18, + 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x31, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, + 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x48, + 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x48, 0x01, 0x52, 0x09, 0x68, 0x74, 0x74, 0x70, + 0x43, 0x68, 0x65, 0x63, 0x6b, 0x12, 0x4f, 0x0a, 0x09, 0x74, 0x63, 0x70, 0x5f, 0x63, 0x68, 0x65, + 0x63, 0x6b, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x30, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x48, 0x01, 0x52, 0x09, 0x68, - 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x12, 0x4f, 0x0a, 0x09, 0x74, 0x63, 0x70, 0x5f, - 0x63, 0x68, 0x65, 0x63, 0x6b, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x30, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, - 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, - 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x54, 0x63, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x48, 0x01, 0x52, - 0x08, 0x74, 0x63, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x12, 0x31, 0x0a, 0x06, 0x70, 0x65, 0x72, - 0x69, 0x6f, 0x64, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x06, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, 0x12, 0x33, 0x0a, 0x07, - 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, - 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x07, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, - 0x74, 0x12, 0x61, 0x0a, 0x10, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x5f, 0x6d, 0x61, 0x74, - 0x63, 0x68, 0x65, 0x72, 0x73, 0x18, 0x09, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x36, 0x2e, 0x67, 0x6f, + 0x67, 0x2e, 0x54, 0x63, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x48, 0x01, 0x52, 0x08, 0x74, 0x63, + 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x12, 0x31, 0x0a, 0x06, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, + 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x52, 0x06, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, 0x12, 0x33, 0x0a, 0x07, 0x74, 0x69, 0x6d, + 0x65, 0x6f, 0x75, 0x74, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x07, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x12, 0x61, + 0x0a, 0x10, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, + 0x72, 0x73, 0x18, 0x09, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, + 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, + 0x67, 0x2e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, + 0x52, 0x0f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, + 0x73, 0x12, 0x56, 0x0a, 0x0c, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x5f, 0x74, 0x79, 0x70, + 0x65, 0x18, 0x11, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, + 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, + 0x2e, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, 0x52, 0x0b, 0x63, 0x68, + 0x65, 0x63, 0x6b, 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, 0x12, 0x52, 0x0a, 0x10, 0x73, 0x65, 0x6c, + 0x65, 0x63, 0x74, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x0a, 0x20, + 0x03, 0x28, 0x0e, 0x32, 0x27, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, + 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x52, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x52, 0x0f, 0x73, 0x65, + 0x6c, 0x65, 0x63, 0x74, 0x65, 0x64, 0x52, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x23, 0x0a, + 0x0b, 0x69, 0x73, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x18, 0x0f, 0x20, 0x01, + 0x28, 0x08, 0x42, 0x02, 0x18, 0x01, 0x52, 0x0a, 0x69, 0x73, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, + 0x61, 0x6c, 0x12, 0x56, 0x0a, 0x11, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x5f, 0x63, + 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x73, 0x18, 0x0e, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x25, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x43, 0x68, 0x65, + 0x63, 0x6b, 0x65, 0x72, 0x42, 0x02, 0x18, 0x01, 0x52, 0x10, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, + 0x61, 0x6c, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x73, 0x12, 0x58, 0x0a, 0x0b, 0x75, 0x73, + 0x65, 0x72, 0x5f, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x14, 0x20, 0x03, 0x28, 0x0b, 0x32, + 0x37, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, + 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x55, 0x73, 0x65, 0x72, 0x4c, 0x61, 0x62, + 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x0a, 0x75, 0x73, 0x65, 0x72, 0x4c, 0x61, + 0x62, 0x65, 0x6c, 0x73, 0x1a, 0x78, 0x0a, 0x0d, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, + 0x47, 0x72, 0x6f, 0x75, 0x70, 0x12, 0x19, 0x0a, 0x08, 0x67, 0x72, 0x6f, 0x75, 0x70, 0x5f, 0x69, + 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x67, 0x72, 0x6f, 0x75, 0x70, 0x49, 0x64, + 0x12, 0x4c, 0x0a, 0x0d, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x74, 0x79, 0x70, + 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x27, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x47, + 0x72, 0x6f, 0x75, 0x70, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x54, 0x79, 0x70, 0x65, + 0x52, 0x0c, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x54, 0x79, 0x70, 0x65, 0x1a, 0x2d, + 0x0a, 0x0a, 0x50, 0x69, 0x6e, 0x67, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x1f, 0x0a, 0x0b, + 0x70, 0x69, 0x6e, 0x67, 0x73, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x05, 0x52, 0x0a, 0x70, 0x69, 0x6e, 0x67, 0x73, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x1a, 0xef, 0x0e, + 0x0a, 0x09, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x12, 0x66, 0x0a, 0x0e, 0x72, + 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x18, 0x08, 0x20, + 0x01, 0x28, 0x0e, 0x32, 0x3f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, + 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x48, 0x74, 0x74, + 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x4d, 0x65, + 0x74, 0x68, 0x6f, 0x64, 0x52, 0x0d, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x4d, 0x65, 0x74, + 0x68, 0x6f, 0x64, 0x12, 0x17, 0x0a, 0x07, 0x75, 0x73, 0x65, 0x5f, 0x73, 0x73, 0x6c, 0x18, 0x01, + 0x20, 0x01, 0x28, 0x08, 0x52, 0x06, 0x75, 0x73, 0x65, 0x53, 0x73, 0x6c, 0x12, 0x12, 0x0a, 0x04, + 0x70, 0x61, 0x74, 0x68, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x70, 0x61, 0x74, 0x68, + 0x12, 0x12, 0x0a, 0x04, 0x70, 0x6f, 0x72, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x05, 0x52, 0x04, + 0x70, 0x6f, 0x72, 0x74, 0x12, 0x62, 0x0a, 0x09, 0x61, 0x75, 0x74, 0x68, 0x5f, 0x69, 0x6e, 0x66, + 0x6f, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x45, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, + 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, + 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x42, 0x61, 0x73, 0x69, 0x63, + 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x08, + 0x61, 0x75, 0x74, 0x68, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x21, 0x0a, 0x0c, 0x6d, 0x61, 0x73, 0x6b, + 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0b, + 0x6d, 0x61, 0x73, 0x6b, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x12, 0x58, 0x0a, 0x07, 0x68, + 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x18, 0x06, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x3e, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, + 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, + 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x07, 0x68, 0x65, + 0x61, 0x64, 0x65, 0x72, 0x73, 0x12, 0x60, 0x0a, 0x0c, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, + 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x3d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, - 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, - 0x68, 0x65, 0x72, 0x52, 0x0f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, - 0x68, 0x65, 0x72, 0x73, 0x12, 0x56, 0x0a, 0x0c, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x5f, - 0x74, 0x79, 0x70, 0x65, 0x18, 0x11, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x33, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x2e, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, 0x52, - 0x0b, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, 0x12, 0x52, 0x0a, 0x10, - 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x73, - 0x18, 0x0a, 0x20, 0x03, 0x28, 0x0e, 0x32, 0x27, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, - 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x52, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x52, - 0x0f, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x65, 0x64, 0x52, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x73, - 0x12, 0x23, 0x0a, 0x0b, 0x69, 0x73, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x18, - 0x0f, 0x20, 0x01, 0x28, 0x08, 0x42, 0x02, 0x18, 0x01, 0x52, 0x0a, 0x69, 0x73, 0x49, 0x6e, 0x74, - 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x12, 0x56, 0x0a, 0x11, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, - 0x6c, 0x5f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x73, 0x18, 0x0e, 0x20, 0x03, 0x28, 0x0b, - 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, - 0x43, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x42, 0x02, 0x18, 0x01, 0x52, 0x10, 0x69, 0x6e, 0x74, - 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x73, 0x12, 0x58, 0x0a, - 0x0b, 0x75, 0x73, 0x65, 0x72, 0x5f, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x14, 0x20, 0x03, - 0x28, 0x0b, 0x32, 0x37, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, - 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x55, 0x73, 0x65, 0x72, - 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x0a, 0x75, 0x73, 0x65, - 0x72, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x1a, 0x78, 0x0a, 0x0d, 0x52, 0x65, 0x73, 0x6f, 0x75, - 0x72, 0x63, 0x65, 0x47, 0x72, 0x6f, 0x75, 0x70, 0x12, 0x19, 0x0a, 0x08, 0x67, 0x72, 0x6f, 0x75, - 0x70, 0x5f, 0x69, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x67, 0x72, 0x6f, 0x75, - 0x70, 0x49, 0x64, 0x12, 0x4c, 0x0a, 0x0d, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, - 0x74, 0x79, 0x70, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x27, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x47, 0x72, 0x6f, 0x75, 0x70, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x54, - 0x79, 0x70, 0x65, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x54, 0x79, 0x70, - 0x65, 0x1a, 0x2d, 0x0a, 0x0a, 0x50, 0x69, 0x6e, 0x67, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, - 0x1f, 0x0a, 0x0b, 0x70, 0x69, 0x6e, 0x67, 0x73, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x05, 0x52, 0x0a, 0x70, 0x69, 0x6e, 0x67, 0x73, 0x43, 0x6f, 0x75, 0x6e, 0x74, - 0x1a, 0xef, 0x0e, 0x0a, 0x09, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x12, 0x66, - 0x0a, 0x0e, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, - 0x18, 0x08, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x3f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, - 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, - 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, - 0x74, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x52, 0x0d, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, - 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x12, 0x17, 0x0a, 0x07, 0x75, 0x73, 0x65, 0x5f, 0x73, 0x73, - 0x6c, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x52, 0x06, 0x75, 0x73, 0x65, 0x53, 0x73, 0x6c, 0x12, - 0x12, 0x0a, 0x04, 0x70, 0x61, 0x74, 0x68, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x70, - 0x61, 0x74, 0x68, 0x12, 0x12, 0x0a, 0x04, 0x70, 0x6f, 0x72, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, - 0x05, 0x52, 0x04, 0x70, 0x6f, 0x72, 0x74, 0x12, 0x62, 0x0a, 0x09, 0x61, 0x75, 0x74, 0x68, 0x5f, - 0x69, 0x6e, 0x66, 0x6f, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x45, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x42, 0x61, - 0x73, 0x69, 0x63, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x52, 0x08, 0x61, 0x75, 0x74, 0x68, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x21, 0x0a, 0x0c, 0x6d, - 0x61, 0x73, 0x6b, 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x18, 0x05, 0x20, 0x01, 0x28, - 0x08, 0x52, 0x0b, 0x6d, 0x61, 0x73, 0x6b, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x12, 0x58, - 0x0a, 0x07, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x18, 0x06, 0x20, 0x03, 0x28, 0x0b, 0x32, - 0x3e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, + 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x43, + 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x54, 0x79, 0x70, 0x65, 0x52, 0x0b, 0x63, 0x6f, 0x6e, 0x74, + 0x65, 0x6e, 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x2e, 0x0a, 0x13, 0x63, 0x75, 0x73, 0x74, 0x6f, + 0x6d, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x0d, + 0x20, 0x01, 0x28, 0x09, 0x52, 0x11, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x43, 0x6f, 0x6e, 0x74, + 0x65, 0x6e, 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x76, 0x61, 0x6c, 0x69, 0x64, + 0x61, 0x74, 0x65, 0x5f, 0x73, 0x73, 0x6c, 0x18, 0x07, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0b, 0x76, + 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x65, 0x53, 0x73, 0x6c, 0x12, 0x12, 0x0a, 0x04, 0x62, 0x6f, + 0x64, 0x79, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x04, 0x62, 0x6f, 0x64, 0x79, 0x12, 0x89, + 0x01, 0x0a, 0x1e, 0x61, 0x63, 0x63, 0x65, 0x70, 0x74, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x73, 0x70, + 0x6f, 0x6e, 0x73, 0x65, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x5f, 0x63, 0x6f, 0x64, 0x65, + 0x73, 0x18, 0x0b, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x44, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, + 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, + 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x52, 0x65, 0x73, 0x70, 0x6f, + 0x6e, 0x73, 0x65, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x43, 0x6f, 0x64, 0x65, 0x52, 0x1b, 0x61, + 0x63, 0x63, 0x65, 0x70, 0x74, 0x65, 0x64, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x53, + 0x74, 0x61, 0x74, 0x75, 0x73, 0x43, 0x6f, 0x64, 0x65, 0x73, 0x12, 0x53, 0x0a, 0x0b, 0x70, 0x69, + 0x6e, 0x67, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x32, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, - 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, - 0x63, 0x6b, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, - 0x07, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x12, 0x60, 0x0a, 0x0c, 0x63, 0x6f, 0x6e, 0x74, - 0x65, 0x6e, 0x74, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x3d, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, - 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, - 0x6b, 0x2e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x54, 0x79, 0x70, 0x65, 0x52, 0x0b, 0x63, - 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x2e, 0x0a, 0x13, 0x63, 0x75, - 0x73, 0x74, 0x6f, 0x6d, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x5f, 0x74, 0x79, 0x70, - 0x65, 0x18, 0x0d, 0x20, 0x01, 0x28, 0x09, 0x52, 0x11, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x43, - 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x76, 0x61, - 0x6c, 0x69, 0x64, 0x61, 0x74, 0x65, 0x5f, 0x73, 0x73, 0x6c, 0x18, 0x07, 0x20, 0x01, 0x28, 0x08, - 0x52, 0x0b, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x65, 0x53, 0x73, 0x6c, 0x12, 0x12, 0x0a, - 0x04, 0x62, 0x6f, 0x64, 0x79, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x04, 0x62, 0x6f, 0x64, - 0x79, 0x12, 0x89, 0x01, 0x0a, 0x1e, 0x61, 0x63, 0x63, 0x65, 0x70, 0x74, 0x65, 0x64, 0x5f, 0x72, - 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x5f, 0x63, - 0x6f, 0x64, 0x65, 0x73, 0x18, 0x0b, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x44, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x52, 0x65, - 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x43, 0x6f, 0x64, 0x65, - 0x52, 0x1b, 0x61, 0x63, 0x63, 0x65, 0x70, 0x74, 0x65, 0x64, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, - 0x73, 0x65, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x43, 0x6f, 0x64, 0x65, 0x73, 0x12, 0x53, 0x0a, - 0x0b, 0x70, 0x69, 0x6e, 0x67, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x0c, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x32, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, - 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, - 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x50, 0x69, 0x6e, 0x67, - 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x0a, 0x70, 0x69, 0x6e, 0x67, 0x43, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x12, 0x90, 0x01, 0x0a, 0x1c, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x5f, 0x61, - 0x67, 0x65, 0x6e, 0x74, 0x5f, 0x61, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x18, 0x0e, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x4c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, - 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x53, 0x65, 0x72, - 0x76, 0x69, 0x63, 0x65, 0x41, 0x67, 0x65, 0x6e, 0x74, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, - 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x48, 0x00, 0x52, 0x1a, 0x73, 0x65, 0x72, 0x76, 0x69, - 0x63, 0x65, 0x41, 0x67, 0x65, 0x6e, 0x74, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0x4d, 0x0a, 0x13, 0x42, 0x61, 0x73, 0x69, 0x63, 0x41, 0x75, - 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1a, 0x0a, 0x08, - 0x75, 0x73, 0x65, 0x72, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, - 0x75, 0x73, 0x65, 0x72, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x1a, 0x0a, 0x08, 0x70, 0x61, 0x73, 0x73, - 0x77, 0x6f, 0x72, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x70, 0x61, 0x73, 0x73, - 0x77, 0x6f, 0x72, 0x64, 0x1a, 0xf6, 0x02, 0x0a, 0x12, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, - 0x65, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x43, 0x6f, 0x64, 0x65, 0x12, 0x23, 0x0a, 0x0c, 0x73, - 0x74, 0x61, 0x74, 0x75, 0x73, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, - 0x05, 0x48, 0x00, 0x52, 0x0b, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x56, 0x61, 0x6c, 0x75, 0x65, - 0x12, 0x75, 0x0a, 0x0c, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x5f, 0x63, 0x6c, 0x61, 0x73, 0x73, - 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x50, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x50, 0x69, 0x6e, 0x67, 0x43, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x52, 0x0a, 0x70, 0x69, 0x6e, 0x67, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, + 0x90, 0x01, 0x0a, 0x1c, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x5f, 0x61, 0x67, 0x65, 0x6e, + 0x74, 0x5f, 0x61, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x18, 0x0e, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x4c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, - 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, - 0x73, 0x65, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x43, 0x6f, 0x64, 0x65, 0x2e, 0x53, 0x74, 0x61, - 0x74, 0x75, 0x73, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x48, 0x00, 0x52, 0x0b, 0x73, 0x74, 0x61, 0x74, - 0x75, 0x73, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x22, 0xb4, 0x01, 0x0a, 0x0b, 0x53, 0x74, 0x61, 0x74, - 0x75, 0x73, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x12, 0x1c, 0x0a, 0x18, 0x53, 0x54, 0x41, 0x54, 0x55, - 0x53, 0x5f, 0x43, 0x4c, 0x41, 0x53, 0x53, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, - 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x14, 0x0a, 0x10, 0x53, 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, - 0x43, 0x4c, 0x41, 0x53, 0x53, 0x5f, 0x31, 0x58, 0x58, 0x10, 0x64, 0x12, 0x15, 0x0a, 0x10, 0x53, - 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, 0x43, 0x4c, 0x41, 0x53, 0x53, 0x5f, 0x32, 0x58, 0x58, 0x10, - 0xc8, 0x01, 0x12, 0x15, 0x0a, 0x10, 0x53, 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, 0x43, 0x4c, 0x41, - 0x53, 0x53, 0x5f, 0x33, 0x58, 0x58, 0x10, 0xac, 0x02, 0x12, 0x15, 0x0a, 0x10, 0x53, 0x54, 0x41, - 0x54, 0x55, 0x53, 0x5f, 0x43, 0x4c, 0x41, 0x53, 0x53, 0x5f, 0x34, 0x58, 0x58, 0x10, 0x90, 0x03, - 0x12, 0x15, 0x0a, 0x10, 0x53, 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, 0x43, 0x4c, 0x41, 0x53, 0x53, - 0x5f, 0x35, 0x58, 0x58, 0x10, 0xf4, 0x03, 0x12, 0x15, 0x0a, 0x10, 0x53, 0x54, 0x41, 0x54, 0x55, - 0x53, 0x5f, 0x43, 0x4c, 0x41, 0x53, 0x53, 0x5f, 0x41, 0x4e, 0x59, 0x10, 0xe8, 0x07, 0x42, 0x0d, - 0x0a, 0x0b, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x5f, 0x63, 0x6f, 0x64, 0x65, 0x1a, 0x82, 0x02, - 0x0a, 0x1a, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x41, 0x67, 0x65, 0x6e, 0x74, 0x41, 0x75, - 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x7f, 0x0a, 0x04, - 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x6b, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, - 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x53, 0x65, - 0x72, 0x76, 0x69, 0x63, 0x65, 0x41, 0x67, 0x65, 0x6e, 0x74, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, - 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, - 0x41, 0x67, 0x65, 0x6e, 0x74, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x54, 0x79, 0x70, 0x65, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x22, 0x63, 0x0a, - 0x1e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x41, 0x67, 0x65, 0x6e, 0x74, 0x41, 0x75, 0x74, - 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x54, 0x79, 0x70, 0x65, 0x12, - 0x31, 0x0a, 0x2d, 0x53, 0x45, 0x52, 0x56, 0x49, 0x43, 0x45, 0x5f, 0x41, 0x47, 0x45, 0x4e, 0x54, - 0x5f, 0x41, 0x55, 0x54, 0x48, 0x45, 0x4e, 0x54, 0x49, 0x43, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, - 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, - 0x10, 0x00, 0x12, 0x0e, 0x0a, 0x0a, 0x4f, 0x49, 0x44, 0x43, 0x5f, 0x54, 0x4f, 0x4b, 0x45, 0x4e, - 0x10, 0x01, 0x1a, 0x3a, 0x0a, 0x0c, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x45, 0x6e, 0x74, - 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x3a, - 0x0a, 0x0d, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x12, - 0x16, 0x0a, 0x12, 0x4d, 0x45, 0x54, 0x48, 0x4f, 0x44, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, - 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x07, 0x0a, 0x03, 0x47, 0x45, 0x54, 0x10, 0x01, - 0x12, 0x08, 0x0a, 0x04, 0x50, 0x4f, 0x53, 0x54, 0x10, 0x02, 0x22, 0x47, 0x0a, 0x0b, 0x43, 0x6f, - 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x14, 0x0a, 0x10, 0x54, 0x59, 0x50, - 0x45, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, - 0x0f, 0x0a, 0x0b, 0x55, 0x52, 0x4c, 0x5f, 0x45, 0x4e, 0x43, 0x4f, 0x44, 0x45, 0x44, 0x10, 0x01, - 0x12, 0x11, 0x0a, 0x0d, 0x55, 0x53, 0x45, 0x52, 0x5f, 0x50, 0x52, 0x4f, 0x56, 0x49, 0x44, 0x45, - 0x44, 0x10, 0x02, 0x42, 0x0d, 0x0a, 0x0b, 0x61, 0x75, 0x74, 0x68, 0x5f, 0x6d, 0x65, 0x74, 0x68, - 0x6f, 0x64, 0x1a, 0x73, 0x0a, 0x08, 0x54, 0x63, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x12, 0x12, - 0x0a, 0x04, 0x70, 0x6f, 0x72, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x04, 0x70, 0x6f, - 0x72, 0x74, 0x12, 0x53, 0x0a, 0x0b, 0x70, 0x69, 0x6e, 0x67, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x32, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, + 0x65, 0x41, 0x67, 0x65, 0x6e, 0x74, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x48, 0x00, 0x52, 0x1a, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x41, + 0x67, 0x65, 0x6e, 0x74, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x1a, 0x4d, 0x0a, 0x13, 0x42, 0x61, 0x73, 0x69, 0x63, 0x41, 0x75, 0x74, 0x68, 0x65, + 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1a, 0x0a, 0x08, 0x75, 0x73, 0x65, + 0x72, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x75, 0x73, 0x65, + 0x72, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x1a, 0x0a, 0x08, 0x70, 0x61, 0x73, 0x73, 0x77, 0x6f, 0x72, + 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x70, 0x61, 0x73, 0x73, 0x77, 0x6f, 0x72, + 0x64, 0x1a, 0xf6, 0x02, 0x0a, 0x12, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x53, 0x74, + 0x61, 0x74, 0x75, 0x73, 0x43, 0x6f, 0x64, 0x65, 0x12, 0x23, 0x0a, 0x0c, 0x73, 0x74, 0x61, 0x74, + 0x75, 0x73, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x48, 0x00, + 0x52, 0x0b, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x75, 0x0a, + 0x0c, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x5f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x18, 0x02, 0x20, + 0x01, 0x28, 0x0e, 0x32, 0x50, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, + 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x48, 0x74, 0x74, + 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x53, + 0x74, 0x61, 0x74, 0x75, 0x73, 0x43, 0x6f, 0x64, 0x65, 0x2e, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, + 0x43, 0x6c, 0x61, 0x73, 0x73, 0x48, 0x00, 0x52, 0x0b, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x43, + 0x6c, 0x61, 0x73, 0x73, 0x22, 0xb4, 0x01, 0x0a, 0x0b, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x43, + 0x6c, 0x61, 0x73, 0x73, 0x12, 0x1c, 0x0a, 0x18, 0x53, 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, 0x43, + 0x4c, 0x41, 0x53, 0x53, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, + 0x10, 0x00, 0x12, 0x14, 0x0a, 0x10, 0x53, 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, 0x43, 0x4c, 0x41, + 0x53, 0x53, 0x5f, 0x31, 0x58, 0x58, 0x10, 0x64, 0x12, 0x15, 0x0a, 0x10, 0x53, 0x54, 0x41, 0x54, + 0x55, 0x53, 0x5f, 0x43, 0x4c, 0x41, 0x53, 0x53, 0x5f, 0x32, 0x58, 0x58, 0x10, 0xc8, 0x01, 0x12, + 0x15, 0x0a, 0x10, 0x53, 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, 0x43, 0x4c, 0x41, 0x53, 0x53, 0x5f, + 0x33, 0x58, 0x58, 0x10, 0xac, 0x02, 0x12, 0x15, 0x0a, 0x10, 0x53, 0x54, 0x41, 0x54, 0x55, 0x53, + 0x5f, 0x43, 0x4c, 0x41, 0x53, 0x53, 0x5f, 0x34, 0x58, 0x58, 0x10, 0x90, 0x03, 0x12, 0x15, 0x0a, + 0x10, 0x53, 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, 0x43, 0x4c, 0x41, 0x53, 0x53, 0x5f, 0x35, 0x58, + 0x58, 0x10, 0xf4, 0x03, 0x12, 0x15, 0x0a, 0x10, 0x53, 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, 0x43, + 0x4c, 0x41, 0x53, 0x53, 0x5f, 0x41, 0x4e, 0x59, 0x10, 0xe8, 0x07, 0x42, 0x0d, 0x0a, 0x0b, 0x73, + 0x74, 0x61, 0x74, 0x75, 0x73, 0x5f, 0x63, 0x6f, 0x64, 0x65, 0x1a, 0x82, 0x02, 0x0a, 0x1a, 0x53, + 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x41, 0x67, 0x65, 0x6e, 0x74, 0x41, 0x75, 0x74, 0x68, 0x65, + 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x7f, 0x0a, 0x04, 0x74, 0x79, 0x70, + 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x6b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x2e, 0x50, 0x69, 0x6e, 0x67, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x0a, 0x70, 0x69, 0x6e, - 0x67, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x1a, 0x84, 0x06, 0x0a, 0x0e, 0x43, 0x6f, 0x6e, 0x74, - 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x12, 0x18, 0x0a, 0x07, 0x63, 0x6f, - 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x63, 0x6f, 0x6e, - 0x74, 0x65, 0x6e, 0x74, 0x12, 0x65, 0x0a, 0x07, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x4b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, + 0x2e, 0x48, 0x74, 0x74, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, + 0x63, 0x65, 0x41, 0x67, 0x65, 0x6e, 0x74, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x41, 0x67, 0x65, + 0x6e, 0x74, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x54, 0x79, 0x70, 0x65, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x22, 0x63, 0x0a, 0x1e, 0x53, 0x65, + 0x72, 0x76, 0x69, 0x63, 0x65, 0x41, 0x67, 0x65, 0x6e, 0x74, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, + 0x74, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x54, 0x79, 0x70, 0x65, 0x12, 0x31, 0x0a, 0x2d, + 0x53, 0x45, 0x52, 0x56, 0x49, 0x43, 0x45, 0x5f, 0x41, 0x47, 0x45, 0x4e, 0x54, 0x5f, 0x41, 0x55, + 0x54, 0x48, 0x45, 0x4e, 0x54, 0x49, 0x43, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x54, 0x59, 0x50, + 0x45, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, + 0x0e, 0x0a, 0x0a, 0x4f, 0x49, 0x44, 0x43, 0x5f, 0x54, 0x4f, 0x4b, 0x45, 0x4e, 0x10, 0x01, 0x1a, + 0x3a, 0x0a, 0x0c, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, + 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, + 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, + 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x3a, 0x0a, 0x0d, 0x52, + 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x12, 0x16, 0x0a, 0x12, + 0x4d, 0x45, 0x54, 0x48, 0x4f, 0x44, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, + 0x45, 0x44, 0x10, 0x00, 0x12, 0x07, 0x0a, 0x03, 0x47, 0x45, 0x54, 0x10, 0x01, 0x12, 0x08, 0x0a, + 0x04, 0x50, 0x4f, 0x53, 0x54, 0x10, 0x02, 0x22, 0x47, 0x0a, 0x0b, 0x43, 0x6f, 0x6e, 0x74, 0x65, + 0x6e, 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x14, 0x0a, 0x10, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, + 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x0f, 0x0a, 0x0b, + 0x55, 0x52, 0x4c, 0x5f, 0x45, 0x4e, 0x43, 0x4f, 0x44, 0x45, 0x44, 0x10, 0x01, 0x12, 0x11, 0x0a, + 0x0d, 0x55, 0x53, 0x45, 0x52, 0x5f, 0x50, 0x52, 0x4f, 0x56, 0x49, 0x44, 0x45, 0x44, 0x10, 0x02, + 0x42, 0x0d, 0x0a, 0x0b, 0x61, 0x75, 0x74, 0x68, 0x5f, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x1a, + 0x73, 0x0a, 0x08, 0x54, 0x63, 0x70, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x12, 0x12, 0x0a, 0x04, 0x70, + 0x6f, 0x72, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x04, 0x70, 0x6f, 0x72, 0x74, 0x12, + 0x53, 0x0a, 0x0b, 0x70, 0x69, 0x6e, 0x67, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x02, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x32, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, + 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, + 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x50, 0x69, + 0x6e, 0x67, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x0a, 0x70, 0x69, 0x6e, 0x67, 0x43, 0x6f, + 0x6e, 0x66, 0x69, 0x67, 0x1a, 0x84, 0x06, 0x0a, 0x0e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, + 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x12, 0x18, 0x0a, 0x07, 0x63, 0x6f, 0x6e, 0x74, 0x65, + 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, + 0x74, 0x12, 0x65, 0x0a, 0x07, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x18, 0x02, 0x20, 0x01, + 0x28, 0x0e, 0x32, 0x4b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, + 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, + 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x43, 0x6f, 0x6e, 0x74, + 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x2e, 0x43, 0x6f, 0x6e, 0x74, 0x65, + 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, + 0x07, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x12, 0x74, 0x0a, 0x11, 0x6a, 0x73, 0x6f, 0x6e, + 0x5f, 0x70, 0x61, 0x74, 0x68, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x18, 0x03, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x46, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, + 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, + 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x43, 0x6f, 0x6e, + 0x74, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x2e, 0x4a, 0x73, 0x6f, 0x6e, + 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x48, 0x00, 0x52, 0x0f, 0x6a, + 0x73, 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x1a, 0x94, + 0x02, 0x0a, 0x0f, 0x4a, 0x73, 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, 0x74, 0x63, 0x68, + 0x65, 0x72, 0x12, 0x1b, 0x0a, 0x09, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x70, 0x61, 0x74, 0x68, 0x18, + 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x6a, 0x73, 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x12, + 0x7f, 0x0a, 0x0c, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x18, + 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x5c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x43, - 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x2e, 0x43, 0x6f, - 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x4f, 0x70, 0x74, 0x69, - 0x6f, 0x6e, 0x52, 0x07, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x12, 0x74, 0x0a, 0x11, 0x6a, - 0x73, 0x6f, 0x6e, 0x5f, 0x70, 0x61, 0x74, 0x68, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, - 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x46, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, - 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, - 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x2e, 0x4a, - 0x73, 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x48, 0x00, - 0x52, 0x0f, 0x6a, 0x73, 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, - 0x72, 0x1a, 0x94, 0x02, 0x0a, 0x0f, 0x4a, 0x73, 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, - 0x74, 0x63, 0x68, 0x65, 0x72, 0x12, 0x1b, 0x0a, 0x09, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x70, 0x61, - 0x74, 0x68, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x6a, 0x73, 0x6f, 0x6e, 0x50, 0x61, - 0x74, 0x68, 0x12, 0x7f, 0x0a, 0x0c, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, - 0x65, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x5c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, - 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x2e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, - 0x2e, 0x4a, 0x73, 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, - 0x2e, 0x4a, 0x73, 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, - 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0b, 0x6a, 0x73, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, - 0x68, 0x65, 0x72, 0x22, 0x63, 0x0a, 0x15, 0x4a, 0x73, 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x4d, - 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x28, 0x0a, 0x24, - 0x4a, 0x53, 0x4f, 0x4e, 0x5f, 0x50, 0x41, 0x54, 0x48, 0x5f, 0x4d, 0x41, 0x54, 0x43, 0x48, 0x45, + 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x2e, 0x4a, 0x73, + 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x2e, 0x4a, 0x73, + 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x4f, 0x70, 0x74, + 0x69, 0x6f, 0x6e, 0x52, 0x0b, 0x6a, 0x73, 0x6f, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, + 0x22, 0x63, 0x0a, 0x15, 0x4a, 0x73, 0x6f, 0x6e, 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, 0x74, 0x63, + 0x68, 0x65, 0x72, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x28, 0x0a, 0x24, 0x4a, 0x53, 0x4f, + 0x4e, 0x5f, 0x50, 0x41, 0x54, 0x48, 0x5f, 0x4d, 0x41, 0x54, 0x43, 0x48, 0x45, 0x52, 0x5f, 0x4f, + 0x50, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, + 0x44, 0x10, 0x00, 0x12, 0x0f, 0x0a, 0x0b, 0x45, 0x58, 0x41, 0x43, 0x54, 0x5f, 0x4d, 0x41, 0x54, + 0x43, 0x48, 0x10, 0x01, 0x12, 0x0f, 0x0a, 0x0b, 0x52, 0x45, 0x47, 0x45, 0x58, 0x5f, 0x4d, 0x41, + 0x54, 0x43, 0x48, 0x10, 0x02, 0x22, 0xc8, 0x01, 0x0a, 0x14, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x6e, + 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x26, + 0x0a, 0x22, 0x43, 0x4f, 0x4e, 0x54, 0x45, 0x4e, 0x54, 0x5f, 0x4d, 0x41, 0x54, 0x43, 0x48, 0x45, 0x52, 0x5f, 0x4f, 0x50, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, - 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x0f, 0x0a, 0x0b, 0x45, 0x58, 0x41, 0x43, 0x54, 0x5f, - 0x4d, 0x41, 0x54, 0x43, 0x48, 0x10, 0x01, 0x12, 0x0f, 0x0a, 0x0b, 0x52, 0x45, 0x47, 0x45, 0x58, - 0x5f, 0x4d, 0x41, 0x54, 0x43, 0x48, 0x10, 0x02, 0x22, 0xc8, 0x01, 0x0a, 0x14, 0x43, 0x6f, 0x6e, - 0x74, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x4f, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x12, 0x26, 0x0a, 0x22, 0x43, 0x4f, 0x4e, 0x54, 0x45, 0x4e, 0x54, 0x5f, 0x4d, 0x41, 0x54, - 0x43, 0x48, 0x45, 0x52, 0x5f, 0x4f, 0x50, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x53, 0x50, - 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x13, 0x0a, 0x0f, 0x43, 0x4f, 0x4e, - 0x54, 0x41, 0x49, 0x4e, 0x53, 0x5f, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x10, 0x01, 0x12, 0x17, - 0x0a, 0x13, 0x4e, 0x4f, 0x54, 0x5f, 0x43, 0x4f, 0x4e, 0x54, 0x41, 0x49, 0x4e, 0x53, 0x5f, 0x53, - 0x54, 0x52, 0x49, 0x4e, 0x47, 0x10, 0x02, 0x12, 0x11, 0x0a, 0x0d, 0x4d, 0x41, 0x54, 0x43, 0x48, - 0x45, 0x53, 0x5f, 0x52, 0x45, 0x47, 0x45, 0x58, 0x10, 0x03, 0x12, 0x15, 0x0a, 0x11, 0x4e, 0x4f, - 0x54, 0x5f, 0x4d, 0x41, 0x54, 0x43, 0x48, 0x45, 0x53, 0x5f, 0x52, 0x45, 0x47, 0x45, 0x58, 0x10, - 0x04, 0x12, 0x15, 0x0a, 0x11, 0x4d, 0x41, 0x54, 0x43, 0x48, 0x45, 0x53, 0x5f, 0x4a, 0x53, 0x4f, - 0x4e, 0x5f, 0x50, 0x41, 0x54, 0x48, 0x10, 0x05, 0x12, 0x19, 0x0a, 0x15, 0x4e, 0x4f, 0x54, 0x5f, - 0x4d, 0x41, 0x54, 0x43, 0x48, 0x45, 0x53, 0x5f, 0x4a, 0x53, 0x4f, 0x4e, 0x5f, 0x50, 0x41, 0x54, - 0x48, 0x10, 0x06, 0x42, 0x19, 0x0a, 0x17, 0x61, 0x64, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x61, - 0x6c, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x5f, 0x69, 0x6e, 0x66, 0x6f, 0x1a, 0x3d, - 0x0a, 0x0f, 0x55, 0x73, 0x65, 0x72, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, - 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, - 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x55, 0x0a, - 0x0b, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, 0x12, 0x1c, 0x0a, 0x18, - 0x43, 0x48, 0x45, 0x43, 0x4b, 0x45, 0x52, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x53, - 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x16, 0x0a, 0x12, 0x53, 0x54, - 0x41, 0x54, 0x49, 0x43, 0x5f, 0x49, 0x50, 0x5f, 0x43, 0x48, 0x45, 0x43, 0x4b, 0x45, 0x52, 0x53, - 0x10, 0x01, 0x12, 0x10, 0x0a, 0x0c, 0x56, 0x50, 0x43, 0x5f, 0x43, 0x48, 0x45, 0x43, 0x4b, 0x45, - 0x52, 0x53, 0x10, 0x03, 0x3a, 0xf3, 0x01, 0xea, 0x41, 0xef, 0x01, 0x0a, 0x2b, 0x6d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, - 0x69, 0x73, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, - 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x3b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, - 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x75, 0x70, 0x74, - 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x73, 0x2f, - 0x7b, 0x75, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x5f, 0x63, 0x6f, - 0x6e, 0x66, 0x69, 0x67, 0x7d, 0x12, 0x45, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x7d, 0x2f, 0x75, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, - 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x73, 0x2f, 0x7b, 0x75, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x63, - 0x68, 0x65, 0x63, 0x6b, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x7d, 0x12, 0x39, 0x66, 0x6f, - 0x6c, 0x64, 0x65, 0x72, 0x73, 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x7d, 0x2f, 0x75, - 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x73, 0x2f, 0x7b, 0x75, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x5f, - 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x7d, 0x12, 0x01, 0x2a, 0x42, 0x0a, 0x0a, 0x08, 0x72, 0x65, - 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x42, 0x14, 0x0a, 0x12, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x5f, - 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x22, 0x8b, 0x01, 0x0a, - 0x0d, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x49, 0x70, 0x12, 0x3f, - 0x0a, 0x06, 0x72, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x27, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, - 0x6b, 0x52, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x52, 0x06, 0x72, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x12, - 0x1a, 0x0a, 0x08, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x08, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1d, 0x0a, 0x0a, 0x69, - 0x70, 0x5f, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x09, 0x69, 0x70, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x2a, 0x95, 0x01, 0x0a, 0x11, 0x55, - 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x52, 0x65, 0x67, 0x69, 0x6f, 0x6e, - 0x12, 0x16, 0x0a, 0x12, 0x52, 0x45, 0x47, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, - 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x07, 0x0a, 0x03, 0x55, 0x53, 0x41, 0x10, - 0x01, 0x12, 0x0a, 0x0a, 0x06, 0x45, 0x55, 0x52, 0x4f, 0x50, 0x45, 0x10, 0x02, 0x12, 0x11, 0x0a, - 0x0d, 0x53, 0x4f, 0x55, 0x54, 0x48, 0x5f, 0x41, 0x4d, 0x45, 0x52, 0x49, 0x43, 0x41, 0x10, 0x03, - 0x12, 0x10, 0x0a, 0x0c, 0x41, 0x53, 0x49, 0x41, 0x5f, 0x50, 0x41, 0x43, 0x49, 0x46, 0x49, 0x43, - 0x10, 0x04, 0x12, 0x0e, 0x0a, 0x0a, 0x55, 0x53, 0x41, 0x5f, 0x4f, 0x52, 0x45, 0x47, 0x4f, 0x4e, - 0x10, 0x05, 0x12, 0x0c, 0x0a, 0x08, 0x55, 0x53, 0x41, 0x5f, 0x49, 0x4f, 0x57, 0x41, 0x10, 0x06, - 0x12, 0x10, 0x0a, 0x0c, 0x55, 0x53, 0x41, 0x5f, 0x56, 0x49, 0x52, 0x47, 0x49, 0x4e, 0x49, 0x41, - 0x10, 0x07, 0x2a, 0x5b, 0x0a, 0x11, 0x47, 0x72, 0x6f, 0x75, 0x70, 0x52, 0x65, 0x73, 0x6f, 0x75, - 0x72, 0x63, 0x65, 0x54, 0x79, 0x70, 0x65, 0x12, 0x1d, 0x0a, 0x19, 0x52, 0x45, 0x53, 0x4f, 0x55, - 0x52, 0x43, 0x45, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, - 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x0c, 0x0a, 0x08, 0x49, 0x4e, 0x53, 0x54, 0x41, 0x4e, - 0x43, 0x45, 0x10, 0x01, 0x12, 0x19, 0x0a, 0x15, 0x41, 0x57, 0x53, 0x5f, 0x45, 0x4c, 0x42, 0x5f, - 0x4c, 0x4f, 0x41, 0x44, 0x5f, 0x42, 0x41, 0x4c, 0x41, 0x4e, 0x43, 0x45, 0x52, 0x10, 0x02, 0x42, - 0xaf, 0x02, 0xea, 0x41, 0x66, 0x0a, 0x26, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x66, 0x75, 0x6e, 0x63, - 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, - 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x46, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x3c, 0x70, - 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, - 0x7d, 0x2f, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6c, 0x6f, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x2f, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, - 0x2f, 0x7b, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x0a, 0x18, 0x63, 0x6f, 0x6d, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, - 0x6e, 0x67, 0x2e, 0x76, 0x33, 0x42, 0x0b, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x50, 0x72, 0x6f, - 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x67, 0x6f, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, - 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x61, 0x70, 0x69, 0x76, 0x33, 0x2f, 0x76, 0x32, 0x2f, 0x6d, 0x6f, - 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0x3b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, - 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, - 0x67, 0x2e, 0x56, 0x33, 0xca, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x5c, 0x43, 0x6c, - 0x6f, 0x75, 0x64, 0x5c, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5c, 0x56, - 0x33, 0xea, 0x02, 0x1d, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x3a, 0x3a, 0x43, 0x6c, 0x6f, 0x75, - 0x64, 0x3a, 0x3a, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x3a, 0x3a, 0x56, - 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x13, 0x0a, 0x0f, 0x43, 0x4f, 0x4e, 0x54, 0x41, 0x49, + 0x4e, 0x53, 0x5f, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x10, 0x01, 0x12, 0x17, 0x0a, 0x13, 0x4e, + 0x4f, 0x54, 0x5f, 0x43, 0x4f, 0x4e, 0x54, 0x41, 0x49, 0x4e, 0x53, 0x5f, 0x53, 0x54, 0x52, 0x49, + 0x4e, 0x47, 0x10, 0x02, 0x12, 0x11, 0x0a, 0x0d, 0x4d, 0x41, 0x54, 0x43, 0x48, 0x45, 0x53, 0x5f, + 0x52, 0x45, 0x47, 0x45, 0x58, 0x10, 0x03, 0x12, 0x15, 0x0a, 0x11, 0x4e, 0x4f, 0x54, 0x5f, 0x4d, + 0x41, 0x54, 0x43, 0x48, 0x45, 0x53, 0x5f, 0x52, 0x45, 0x47, 0x45, 0x58, 0x10, 0x04, 0x12, 0x15, + 0x0a, 0x11, 0x4d, 0x41, 0x54, 0x43, 0x48, 0x45, 0x53, 0x5f, 0x4a, 0x53, 0x4f, 0x4e, 0x5f, 0x50, + 0x41, 0x54, 0x48, 0x10, 0x05, 0x12, 0x19, 0x0a, 0x15, 0x4e, 0x4f, 0x54, 0x5f, 0x4d, 0x41, 0x54, + 0x43, 0x48, 0x45, 0x53, 0x5f, 0x4a, 0x53, 0x4f, 0x4e, 0x5f, 0x50, 0x41, 0x54, 0x48, 0x10, 0x06, + 0x42, 0x19, 0x0a, 0x17, 0x61, 0x64, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x5f, 0x6d, + 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x5f, 0x69, 0x6e, 0x66, 0x6f, 0x1a, 0x3d, 0x0a, 0x0f, 0x55, + 0x73, 0x65, 0x72, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, + 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, + 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x55, 0x0a, 0x0b, 0x43, 0x68, + 0x65, 0x63, 0x6b, 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, 0x12, 0x1c, 0x0a, 0x18, 0x43, 0x48, 0x45, + 0x43, 0x4b, 0x45, 0x52, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, + 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x16, 0x0a, 0x12, 0x53, 0x54, 0x41, 0x54, 0x49, + 0x43, 0x5f, 0x49, 0x50, 0x5f, 0x43, 0x48, 0x45, 0x43, 0x4b, 0x45, 0x52, 0x53, 0x10, 0x01, 0x12, + 0x10, 0x0a, 0x0c, 0x56, 0x50, 0x43, 0x5f, 0x43, 0x48, 0x45, 0x43, 0x4b, 0x45, 0x52, 0x53, 0x10, + 0x03, 0x3a, 0xf3, 0x01, 0xea, 0x41, 0xef, 0x01, 0x0a, 0x2b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, + 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, + 0x63, 0x6f, 0x6d, 0x2f, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x3b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x2f, + 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x75, 0x70, 0x74, 0x69, 0x6d, 0x65, + 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x73, 0x2f, 0x7b, 0x75, 0x70, + 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, + 0x67, 0x7d, 0x12, 0x45, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x73, 0x2f, 0x7b, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7d, + 0x2f, 0x75, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, + 0x69, 0x67, 0x73, 0x2f, 0x7b, 0x75, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x63, 0x68, 0x65, 0x63, + 0x6b, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x7d, 0x12, 0x39, 0x66, 0x6f, 0x6c, 0x64, 0x65, + 0x72, 0x73, 0x2f, 0x7b, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x7d, 0x2f, 0x75, 0x70, 0x74, 0x69, + 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x73, 0x2f, 0x7b, + 0x75, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x5f, 0x63, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x7d, 0x12, 0x01, 0x2a, 0x42, 0x0a, 0x0a, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, + 0x72, 0x63, 0x65, 0x42, 0x14, 0x0a, 0x12, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x5f, 0x72, 0x65, 0x71, + 0x75, 0x65, 0x73, 0x74, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x22, 0x8b, 0x01, 0x0a, 0x0d, 0x55, 0x70, + 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x49, 0x70, 0x12, 0x3f, 0x0a, 0x06, 0x72, + 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x27, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, + 0x76, 0x33, 0x2e, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x52, 0x65, + 0x67, 0x69, 0x6f, 0x6e, 0x52, 0x06, 0x72, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x12, 0x1a, 0x0a, 0x08, + 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, + 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1d, 0x0a, 0x0a, 0x69, 0x70, 0x5f, 0x61, + 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x69, 0x70, + 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x2a, 0x95, 0x01, 0x0a, 0x11, 0x55, 0x70, 0x74, 0x69, + 0x6d, 0x65, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x52, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x12, 0x16, 0x0a, + 0x12, 0x52, 0x45, 0x47, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, + 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x07, 0x0a, 0x03, 0x55, 0x53, 0x41, 0x10, 0x01, 0x12, 0x0a, + 0x0a, 0x06, 0x45, 0x55, 0x52, 0x4f, 0x50, 0x45, 0x10, 0x02, 0x12, 0x11, 0x0a, 0x0d, 0x53, 0x4f, + 0x55, 0x54, 0x48, 0x5f, 0x41, 0x4d, 0x45, 0x52, 0x49, 0x43, 0x41, 0x10, 0x03, 0x12, 0x10, 0x0a, + 0x0c, 0x41, 0x53, 0x49, 0x41, 0x5f, 0x50, 0x41, 0x43, 0x49, 0x46, 0x49, 0x43, 0x10, 0x04, 0x12, + 0x0e, 0x0a, 0x0a, 0x55, 0x53, 0x41, 0x5f, 0x4f, 0x52, 0x45, 0x47, 0x4f, 0x4e, 0x10, 0x05, 0x12, + 0x0c, 0x0a, 0x08, 0x55, 0x53, 0x41, 0x5f, 0x49, 0x4f, 0x57, 0x41, 0x10, 0x06, 0x12, 0x10, 0x0a, + 0x0c, 0x55, 0x53, 0x41, 0x5f, 0x56, 0x49, 0x52, 0x47, 0x49, 0x4e, 0x49, 0x41, 0x10, 0x07, 0x2a, + 0x5b, 0x0a, 0x11, 0x47, 0x72, 0x6f, 0x75, 0x70, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, + 0x54, 0x79, 0x70, 0x65, 0x12, 0x1d, 0x0a, 0x19, 0x52, 0x45, 0x53, 0x4f, 0x55, 0x52, 0x43, 0x45, + 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, + 0x44, 0x10, 0x00, 0x12, 0x0c, 0x0a, 0x08, 0x49, 0x4e, 0x53, 0x54, 0x41, 0x4e, 0x43, 0x45, 0x10, + 0x01, 0x12, 0x19, 0x0a, 0x15, 0x41, 0x57, 0x53, 0x5f, 0x45, 0x4c, 0x42, 0x5f, 0x4c, 0x4f, 0x41, + 0x44, 0x5f, 0x42, 0x41, 0x4c, 0x41, 0x4e, 0x43, 0x45, 0x52, 0x10, 0x02, 0x42, 0xaf, 0x02, 0xea, + 0x41, 0x66, 0x0a, 0x26, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, + 0x6e, 0x73, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2e, 0x63, 0x6f, + 0x6d, 0x2f, 0x46, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x3c, 0x70, 0x72, 0x6f, 0x6a, + 0x65, 0x63, 0x74, 0x73, 0x2f, 0x7b, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x7d, 0x2f, 0x6c, + 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x7d, 0x2f, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x7b, 0x66, + 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x7d, 0x0a, 0x18, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, + 0x76, 0x33, 0x42, 0x0b, 0x55, 0x70, 0x74, 0x69, 0x6d, 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, + 0x01, 0x5a, 0x41, 0x63, 0x6c, 0x6f, 0x75, 0x64, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x63, 0x6f, 0x6d, 0x2f, 0x67, 0x6f, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, + 0x67, 0x2f, 0x61, 0x70, 0x69, 0x76, 0x33, 0x2f, 0x76, 0x32, 0x2f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, + 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x62, 0x3b, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, + 0x6e, 0x67, 0x70, 0x62, 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x43, 0x6c, + 0x6f, 0x75, 0x64, 0x2e, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x56, + 0x33, 0xca, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x5c, 0x43, 0x6c, 0x6f, 0x75, 0x64, + 0x5c, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x5c, 0x56, 0x33, 0xea, 0x02, + 0x1d, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x3a, 0x3a, 0x43, 0x6c, 0x6f, 0x75, 0x64, 0x3a, 0x3a, + 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x3a, 0x3a, 0x56, 0x33, 0x62, 0x06, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( @@ -2514,176 +2489,6 @@ func file_google_monitoring_v3_uptime_proto_init() { if File_google_monitoring_v3_uptime_proto != nil { return } - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_uptime_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*InternalChecker); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*SyntheticMonitorTarget); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*UptimeCheckConfig); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[3].Exporter = func(v any, i int) any { - switch v := v.(*UptimeCheckIp); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[4].Exporter = func(v any, i int) any { - switch v := v.(*SyntheticMonitorTarget_CloudFunctionV2Target); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[5].Exporter = func(v any, i int) any { - switch v := v.(*UptimeCheckConfig_ResourceGroup); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[6].Exporter = func(v any, i int) any { - switch v := v.(*UptimeCheckConfig_PingConfig); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[7].Exporter = func(v any, i int) any { - switch v := v.(*UptimeCheckConfig_HttpCheck); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[8].Exporter = func(v any, i int) any { - switch v := v.(*UptimeCheckConfig_TcpCheck); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[9].Exporter = func(v any, i int) any { - switch v := v.(*UptimeCheckConfig_ContentMatcher); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[11].Exporter = func(v any, i int) any { - switch v := v.(*UptimeCheckConfig_HttpCheck_BasicAuthentication); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[12].Exporter = func(v any, i int) any { - switch v := v.(*UptimeCheckConfig_HttpCheck_ResponseStatusCode); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[13].Exporter = func(v any, i int) any { - switch v := v.(*UptimeCheckConfig_HttpCheck_ServiceAgentAuthentication); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_proto_msgTypes[15].Exporter = func(v any, i int) any { - switch v := v.(*UptimeCheckConfig_ContentMatcher_JsonPathMatcher); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } file_google_monitoring_v3_uptime_proto_msgTypes[1].OneofWrappers = []any{ (*SyntheticMonitorTarget_CloudFunctionV2)(nil), } diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/uptime_service.pb.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/uptime_service.pb.go index d4ba902fb07a2..d2958b865899a 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/uptime_service.pb.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/monitoringpb/uptime_service.pb.go @@ -14,7 +14,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.34.2 +// protoc-gen-go v1.35.2 // protoc v4.25.3 // source: google/monitoring/v3/uptime_service.proto @@ -73,11 +73,9 @@ type ListUptimeCheckConfigsRequest struct { func (x *ListUptimeCheckConfigsRequest) Reset() { *x = ListUptimeCheckConfigsRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListUptimeCheckConfigsRequest) String() string { @@ -88,7 +86,7 @@ func (*ListUptimeCheckConfigsRequest) ProtoMessage() {} func (x *ListUptimeCheckConfigsRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -152,11 +150,9 @@ type ListUptimeCheckConfigsResponse struct { func (x *ListUptimeCheckConfigsResponse) Reset() { *x = ListUptimeCheckConfigsResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListUptimeCheckConfigsResponse) String() string { @@ -167,7 +163,7 @@ func (*ListUptimeCheckConfigsResponse) ProtoMessage() {} func (x *ListUptimeCheckConfigsResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -217,11 +213,9 @@ type GetUptimeCheckConfigRequest struct { func (x *GetUptimeCheckConfigRequest) Reset() { *x = GetUptimeCheckConfigRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *GetUptimeCheckConfigRequest) String() string { @@ -232,7 +226,7 @@ func (*GetUptimeCheckConfigRequest) ProtoMessage() {} func (x *GetUptimeCheckConfigRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -272,11 +266,9 @@ type CreateUptimeCheckConfigRequest struct { func (x *CreateUptimeCheckConfigRequest) Reset() { *x = CreateUptimeCheckConfigRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[3] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *CreateUptimeCheckConfigRequest) String() string { @@ -287,7 +279,7 @@ func (*CreateUptimeCheckConfigRequest) ProtoMessage() {} func (x *CreateUptimeCheckConfigRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -343,11 +335,9 @@ type UpdateUptimeCheckConfigRequest struct { func (x *UpdateUptimeCheckConfigRequest) Reset() { *x = UpdateUptimeCheckConfigRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[4] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[4] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *UpdateUptimeCheckConfigRequest) String() string { @@ -358,7 +348,7 @@ func (*UpdateUptimeCheckConfigRequest) ProtoMessage() {} func (x *UpdateUptimeCheckConfigRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[4] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -401,11 +391,9 @@ type DeleteUptimeCheckConfigRequest struct { func (x *DeleteUptimeCheckConfigRequest) Reset() { *x = DeleteUptimeCheckConfigRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[5] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[5] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *DeleteUptimeCheckConfigRequest) String() string { @@ -416,7 +404,7 @@ func (*DeleteUptimeCheckConfigRequest) ProtoMessage() {} func (x *DeleteUptimeCheckConfigRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[5] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -459,11 +447,9 @@ type ListUptimeCheckIpsRequest struct { func (x *ListUptimeCheckIpsRequest) Reset() { *x = ListUptimeCheckIpsRequest{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[6] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[6] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListUptimeCheckIpsRequest) String() string { @@ -474,7 +460,7 @@ func (*ListUptimeCheckIpsRequest) ProtoMessage() {} func (x *ListUptimeCheckIpsRequest) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[6] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -523,11 +509,9 @@ type ListUptimeCheckIpsResponse struct { func (x *ListUptimeCheckIpsResponse) Reset() { *x = ListUptimeCheckIpsResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[7] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } + mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[7] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) } func (x *ListUptimeCheckIpsResponse) String() string { @@ -538,7 +522,7 @@ func (*ListUptimeCheckIpsResponse) ProtoMessage() {} func (x *ListUptimeCheckIpsResponse) ProtoReflect() protoreflect.Message { mi := &file_google_monitoring_v3_uptime_service_proto_msgTypes[7] - if protoimpl.UnsafeEnabled && x != nil { + if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { ms.StoreMessageInfo(mi) @@ -823,104 +807,6 @@ func file_google_monitoring_v3_uptime_service_proto_init() { return } file_google_monitoring_v3_uptime_proto_init() - if !protoimpl.UnsafeEnabled { - file_google_monitoring_v3_uptime_service_proto_msgTypes[0].Exporter = func(v any, i int) any { - switch v := v.(*ListUptimeCheckConfigsRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_service_proto_msgTypes[1].Exporter = func(v any, i int) any { - switch v := v.(*ListUptimeCheckConfigsResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_service_proto_msgTypes[2].Exporter = func(v any, i int) any { - switch v := v.(*GetUptimeCheckConfigRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_service_proto_msgTypes[3].Exporter = func(v any, i int) any { - switch v := v.(*CreateUptimeCheckConfigRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_service_proto_msgTypes[4].Exporter = func(v any, i int) any { - switch v := v.(*UpdateUptimeCheckConfigRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_service_proto_msgTypes[5].Exporter = func(v any, i int) any { - switch v := v.(*DeleteUptimeCheckConfigRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_service_proto_msgTypes[6].Exporter = func(v any, i int) any { - switch v := v.(*ListUptimeCheckIpsRequest); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_google_monitoring_v3_uptime_service_proto_msgTypes[7].Exporter = func(v any, i int) any { - switch v := v.(*ListUptimeCheckIpsResponse); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ @@ -969,7 +855,7 @@ type UptimeCheckServiceClient interface { // if the Uptime check configuration is referenced by an alert policy or // other dependent configs that would be rendered invalid by the deletion. DeleteUptimeCheckConfig(ctx context.Context, in *DeleteUptimeCheckConfigRequest, opts ...grpc.CallOption) (*emptypb.Empty, error) - // Returns the list of IP addresses that checkers run from + // Returns the list of IP addresses that checkers run from. ListUptimeCheckIps(ctx context.Context, in *ListUptimeCheckIpsRequest, opts ...grpc.CallOption) (*ListUptimeCheckIpsResponse, error) } @@ -1053,7 +939,7 @@ type UptimeCheckServiceServer interface { // if the Uptime check configuration is referenced by an alert policy or // other dependent configs that would be rendered invalid by the deletion. DeleteUptimeCheckConfig(context.Context, *DeleteUptimeCheckConfigRequest) (*emptypb.Empty, error) - // Returns the list of IP addresses that checkers run from + // Returns the list of IP addresses that checkers run from. ListUptimeCheckIps(context.Context, *ListUptimeCheckIpsRequest) (*ListUptimeCheckIpsResponse, error) } diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/notification_channel_client.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/notification_channel_client.go index 6f7fe5d7c493d..ad64cb1292a06 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/notification_channel_client.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/notification_channel_client.go @@ -19,6 +19,7 @@ package monitoring import ( "context" "fmt" + "log/slog" "math" "net/url" "time" @@ -329,6 +330,8 @@ type notificationChannelGRPCClient struct { // The x-goog-* metadata to be sent with each request. xGoogHeaders []string + + logger *slog.Logger } // NewNotificationChannelClient creates a new notification channel service client based on gRPC. @@ -356,6 +359,7 @@ func NewNotificationChannelClient(ctx context.Context, opts ...option.ClientOpti connPool: connPool, notificationChannelClient: monitoringpb.NewNotificationChannelServiceClient(connPool), CallOptions: &client.CallOptions, + logger: internaloption.GetLogger(opts), } c.setGoogleClientInfo() @@ -409,7 +413,7 @@ func (c *notificationChannelGRPCClient) ListNotificationChannelDescriptors(ctx c } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.notificationChannelClient.ListNotificationChannelDescriptors(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.notificationChannelClient.ListNotificationChannelDescriptors, req, settings.GRPC, c.logger, "ListNotificationChannelDescriptors") return err }, opts...) if err != nil { @@ -444,7 +448,7 @@ func (c *notificationChannelGRPCClient) GetNotificationChannelDescriptor(ctx con var resp *monitoringpb.NotificationChannelDescriptor err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.notificationChannelClient.GetNotificationChannelDescriptor(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.notificationChannelClient.GetNotificationChannelDescriptor, req, settings.GRPC, c.logger, "GetNotificationChannelDescriptor") return err }, opts...) if err != nil { @@ -473,7 +477,7 @@ func (c *notificationChannelGRPCClient) ListNotificationChannels(ctx context.Con } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.notificationChannelClient.ListNotificationChannels(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.notificationChannelClient.ListNotificationChannels, req, settings.GRPC, c.logger, "ListNotificationChannels") return err }, opts...) if err != nil { @@ -508,7 +512,7 @@ func (c *notificationChannelGRPCClient) GetNotificationChannel(ctx context.Conte var resp *monitoringpb.NotificationChannel err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.notificationChannelClient.GetNotificationChannel(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.notificationChannelClient.GetNotificationChannel, req, settings.GRPC, c.logger, "GetNotificationChannel") return err }, opts...) if err != nil { @@ -526,7 +530,7 @@ func (c *notificationChannelGRPCClient) CreateNotificationChannel(ctx context.Co var resp *monitoringpb.NotificationChannel err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.notificationChannelClient.CreateNotificationChannel(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.notificationChannelClient.CreateNotificationChannel, req, settings.GRPC, c.logger, "CreateNotificationChannel") return err }, opts...) if err != nil { @@ -544,7 +548,7 @@ func (c *notificationChannelGRPCClient) UpdateNotificationChannel(ctx context.Co var resp *monitoringpb.NotificationChannel err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.notificationChannelClient.UpdateNotificationChannel(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.notificationChannelClient.UpdateNotificationChannel, req, settings.GRPC, c.logger, "UpdateNotificationChannel") return err }, opts...) if err != nil { @@ -561,7 +565,7 @@ func (c *notificationChannelGRPCClient) DeleteNotificationChannel(ctx context.Co opts = append((*c.CallOptions).DeleteNotificationChannel[0:len((*c.CallOptions).DeleteNotificationChannel):len((*c.CallOptions).DeleteNotificationChannel)], opts...) err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - _, err = c.notificationChannelClient.DeleteNotificationChannel(ctx, req, settings.GRPC...) + _, err = executeRPC(ctx, c.notificationChannelClient.DeleteNotificationChannel, req, settings.GRPC, c.logger, "DeleteNotificationChannel") return err }, opts...) return err @@ -575,7 +579,7 @@ func (c *notificationChannelGRPCClient) SendNotificationChannelVerificationCode( opts = append((*c.CallOptions).SendNotificationChannelVerificationCode[0:len((*c.CallOptions).SendNotificationChannelVerificationCode):len((*c.CallOptions).SendNotificationChannelVerificationCode)], opts...) err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - _, err = c.notificationChannelClient.SendNotificationChannelVerificationCode(ctx, req, settings.GRPC...) + _, err = executeRPC(ctx, c.notificationChannelClient.SendNotificationChannelVerificationCode, req, settings.GRPC, c.logger, "SendNotificationChannelVerificationCode") return err }, opts...) return err @@ -590,7 +594,7 @@ func (c *notificationChannelGRPCClient) GetNotificationChannelVerificationCode(c var resp *monitoringpb.GetNotificationChannelVerificationCodeResponse err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.notificationChannelClient.GetNotificationChannelVerificationCode(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.notificationChannelClient.GetNotificationChannelVerificationCode, req, settings.GRPC, c.logger, "GetNotificationChannelVerificationCode") return err }, opts...) if err != nil { @@ -608,7 +612,7 @@ func (c *notificationChannelGRPCClient) VerifyNotificationChannel(ctx context.Co var resp *monitoringpb.NotificationChannel err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.notificationChannelClient.VerifyNotificationChannel(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.notificationChannelClient.VerifyNotificationChannel, req, settings.GRPC, c.logger, "VerifyNotificationChannel") return err }, opts...) if err != nil { diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/query_client.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/query_client.go index 3c111637e19d9..dcd19e6985227 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/query_client.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/query_client.go @@ -19,6 +19,7 @@ package monitoring import ( "context" "fmt" + "log/slog" "math" "net/url" @@ -105,7 +106,12 @@ func (c *QueryClient) Connection() *grpc.ClientConn { return c.internalClient.Connection() } -// QueryTimeSeries queries time series using Monitoring Query Language. +// QueryTimeSeries queries time series by using Monitoring Query Language (MQL). We recommend +// using PromQL instead of MQL. For more information about the status of MQL, +// see the MQL deprecation +// notice (at https://cloud.google.com/stackdriver/docs/deprecations/mql). +// +// Deprecated: QueryTimeSeries may be removed in a future version. func (c *QueryClient) QueryTimeSeries(ctx context.Context, req *monitoringpb.QueryTimeSeriesRequest, opts ...gax.CallOption) *TimeSeriesDataIterator { return c.internalClient.QueryTimeSeries(ctx, req, opts...) } @@ -125,6 +131,8 @@ type queryGRPCClient struct { // The x-goog-* metadata to be sent with each request. xGoogHeaders []string + + logger *slog.Logger } // NewQueryClient creates a new query service client based on gRPC. @@ -153,6 +161,7 @@ func NewQueryClient(ctx context.Context, opts ...option.ClientOption) (*QueryCli connPool: connPool, queryClient: monitoringpb.NewQueryServiceClient(connPool), CallOptions: &client.CallOptions, + logger: internaloption.GetLogger(opts), } c.setGoogleClientInfo() @@ -206,7 +215,7 @@ func (c *queryGRPCClient) QueryTimeSeries(ctx context.Context, req *monitoringpb } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.queryClient.QueryTimeSeries(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.queryClient.QueryTimeSeries, req, settings.GRPC, c.logger, "QueryTimeSeries") return err }, opts...) if err != nil { diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/service_monitoring_client.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/service_monitoring_client.go index 7776c425f9f84..206b7e4c1131d 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/service_monitoring_client.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/service_monitoring_client.go @@ -19,6 +19,7 @@ package monitoring import ( "context" "fmt" + "log/slog" "math" "net/url" "time" @@ -274,6 +275,8 @@ type serviceMonitoringGRPCClient struct { // The x-goog-* metadata to be sent with each request. xGoogHeaders []string + + logger *slog.Logger } // NewServiceMonitoringClient creates a new service monitoring service client based on gRPC. @@ -303,6 +306,7 @@ func NewServiceMonitoringClient(ctx context.Context, opts ...option.ClientOption connPool: connPool, serviceMonitoringClient: monitoringpb.NewServiceMonitoringServiceClient(connPool), CallOptions: &client.CallOptions, + logger: internaloption.GetLogger(opts), } c.setGoogleClientInfo() @@ -345,7 +349,7 @@ func (c *serviceMonitoringGRPCClient) CreateService(ctx context.Context, req *mo var resp *monitoringpb.Service err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.serviceMonitoringClient.CreateService(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.serviceMonitoringClient.CreateService, req, settings.GRPC, c.logger, "CreateService") return err }, opts...) if err != nil { @@ -363,7 +367,7 @@ func (c *serviceMonitoringGRPCClient) GetService(ctx context.Context, req *monit var resp *monitoringpb.Service err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.serviceMonitoringClient.GetService(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.serviceMonitoringClient.GetService, req, settings.GRPC, c.logger, "GetService") return err }, opts...) if err != nil { @@ -392,7 +396,7 @@ func (c *serviceMonitoringGRPCClient) ListServices(ctx context.Context, req *mon } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.serviceMonitoringClient.ListServices(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.serviceMonitoringClient.ListServices, req, settings.GRPC, c.logger, "ListServices") return err }, opts...) if err != nil { @@ -427,7 +431,7 @@ func (c *serviceMonitoringGRPCClient) UpdateService(ctx context.Context, req *mo var resp *monitoringpb.Service err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.serviceMonitoringClient.UpdateService(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.serviceMonitoringClient.UpdateService, req, settings.GRPC, c.logger, "UpdateService") return err }, opts...) if err != nil { @@ -444,7 +448,7 @@ func (c *serviceMonitoringGRPCClient) DeleteService(ctx context.Context, req *mo opts = append((*c.CallOptions).DeleteService[0:len((*c.CallOptions).DeleteService):len((*c.CallOptions).DeleteService)], opts...) err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - _, err = c.serviceMonitoringClient.DeleteService(ctx, req, settings.GRPC...) + _, err = executeRPC(ctx, c.serviceMonitoringClient.DeleteService, req, settings.GRPC, c.logger, "DeleteService") return err }, opts...) return err @@ -459,7 +463,7 @@ func (c *serviceMonitoringGRPCClient) CreateServiceLevelObjective(ctx context.Co var resp *monitoringpb.ServiceLevelObjective err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.serviceMonitoringClient.CreateServiceLevelObjective(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.serviceMonitoringClient.CreateServiceLevelObjective, req, settings.GRPC, c.logger, "CreateServiceLevelObjective") return err }, opts...) if err != nil { @@ -477,7 +481,7 @@ func (c *serviceMonitoringGRPCClient) GetServiceLevelObjective(ctx context.Conte var resp *monitoringpb.ServiceLevelObjective err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.serviceMonitoringClient.GetServiceLevelObjective(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.serviceMonitoringClient.GetServiceLevelObjective, req, settings.GRPC, c.logger, "GetServiceLevelObjective") return err }, opts...) if err != nil { @@ -506,7 +510,7 @@ func (c *serviceMonitoringGRPCClient) ListServiceLevelObjectives(ctx context.Con } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.serviceMonitoringClient.ListServiceLevelObjectives(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.serviceMonitoringClient.ListServiceLevelObjectives, req, settings.GRPC, c.logger, "ListServiceLevelObjectives") return err }, opts...) if err != nil { @@ -541,7 +545,7 @@ func (c *serviceMonitoringGRPCClient) UpdateServiceLevelObjective(ctx context.Co var resp *monitoringpb.ServiceLevelObjective err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.serviceMonitoringClient.UpdateServiceLevelObjective(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.serviceMonitoringClient.UpdateServiceLevelObjective, req, settings.GRPC, c.logger, "UpdateServiceLevelObjective") return err }, opts...) if err != nil { @@ -558,7 +562,7 @@ func (c *serviceMonitoringGRPCClient) DeleteServiceLevelObjective(ctx context.Co opts = append((*c.CallOptions).DeleteServiceLevelObjective[0:len((*c.CallOptions).DeleteServiceLevelObjective):len((*c.CallOptions).DeleteServiceLevelObjective)], opts...) err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - _, err = c.serviceMonitoringClient.DeleteServiceLevelObjective(ctx, req, settings.GRPC...) + _, err = executeRPC(ctx, c.serviceMonitoringClient.DeleteServiceLevelObjective, req, settings.GRPC, c.logger, "DeleteServiceLevelObjective") return err }, opts...) return err diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/snooze_client.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/snooze_client.go index 32cad577e3ff5..ce238659ed902 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/snooze_client.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/snooze_client.go @@ -19,6 +19,7 @@ package monitoring import ( "context" "fmt" + "log/slog" "math" "net/url" "time" @@ -181,6 +182,8 @@ type snoozeGRPCClient struct { // The x-goog-* metadata to be sent with each request. xGoogHeaders []string + + logger *slog.Logger } // NewSnoozeClient creates a new snooze service client based on gRPC. @@ -209,6 +212,7 @@ func NewSnoozeClient(ctx context.Context, opts ...option.ClientOption) (*SnoozeC connPool: connPool, snoozeClient: monitoringpb.NewSnoozeServiceClient(connPool), CallOptions: &client.CallOptions, + logger: internaloption.GetLogger(opts), } c.setGoogleClientInfo() @@ -251,7 +255,7 @@ func (c *snoozeGRPCClient) CreateSnooze(ctx context.Context, req *monitoringpb.C var resp *monitoringpb.Snooze err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.snoozeClient.CreateSnooze(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.snoozeClient.CreateSnooze, req, settings.GRPC, c.logger, "CreateSnooze") return err }, opts...) if err != nil { @@ -280,7 +284,7 @@ func (c *snoozeGRPCClient) ListSnoozes(ctx context.Context, req *monitoringpb.Li } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.snoozeClient.ListSnoozes(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.snoozeClient.ListSnoozes, req, settings.GRPC, c.logger, "ListSnoozes") return err }, opts...) if err != nil { @@ -315,7 +319,7 @@ func (c *snoozeGRPCClient) GetSnooze(ctx context.Context, req *monitoringpb.GetS var resp *monitoringpb.Snooze err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.snoozeClient.GetSnooze(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.snoozeClient.GetSnooze, req, settings.GRPC, c.logger, "GetSnooze") return err }, opts...) if err != nil { @@ -333,7 +337,7 @@ func (c *snoozeGRPCClient) UpdateSnooze(ctx context.Context, req *monitoringpb.U var resp *monitoringpb.Snooze err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.snoozeClient.UpdateSnooze(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.snoozeClient.UpdateSnooze, req, settings.GRPC, c.logger, "UpdateSnooze") return err }, opts...) if err != nil { diff --git a/vendor/cloud.google.com/go/monitoring/apiv3/v2/uptime_check_client.go b/vendor/cloud.google.com/go/monitoring/apiv3/v2/uptime_check_client.go index d3815251374da..6f0c7feca5a18 100644 --- a/vendor/cloud.google.com/go/monitoring/apiv3/v2/uptime_check_client.go +++ b/vendor/cloud.google.com/go/monitoring/apiv3/v2/uptime_check_client.go @@ -19,6 +19,7 @@ package monitoring import ( "context" "fmt" + "log/slog" "math" "net/url" "time" @@ -206,7 +207,7 @@ func (c *UptimeCheckClient) DeleteUptimeCheckConfig(ctx context.Context, req *mo return c.internalClient.DeleteUptimeCheckConfig(ctx, req, opts...) } -// ListUptimeCheckIps returns the list of IP addresses that checkers run from +// ListUptimeCheckIps returns the list of IP addresses that checkers run from. func (c *UptimeCheckClient) ListUptimeCheckIps(ctx context.Context, req *monitoringpb.ListUptimeCheckIpsRequest, opts ...gax.CallOption) *UptimeCheckIpIterator { return c.internalClient.ListUptimeCheckIps(ctx, req, opts...) } @@ -226,6 +227,8 @@ type uptimeCheckGRPCClient struct { // The x-goog-* metadata to be sent with each request. xGoogHeaders []string + + logger *slog.Logger } // NewUptimeCheckClient creates a new uptime check service client based on gRPC. @@ -259,6 +262,7 @@ func NewUptimeCheckClient(ctx context.Context, opts ...option.ClientOption) (*Up connPool: connPool, uptimeCheckClient: monitoringpb.NewUptimeCheckServiceClient(connPool), CallOptions: &client.CallOptions, + logger: internaloption.GetLogger(opts), } c.setGoogleClientInfo() @@ -312,7 +316,7 @@ func (c *uptimeCheckGRPCClient) ListUptimeCheckConfigs(ctx context.Context, req } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.uptimeCheckClient.ListUptimeCheckConfigs(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.uptimeCheckClient.ListUptimeCheckConfigs, req, settings.GRPC, c.logger, "ListUptimeCheckConfigs") return err }, opts...) if err != nil { @@ -347,7 +351,7 @@ func (c *uptimeCheckGRPCClient) GetUptimeCheckConfig(ctx context.Context, req *m var resp *monitoringpb.UptimeCheckConfig err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.uptimeCheckClient.GetUptimeCheckConfig(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.uptimeCheckClient.GetUptimeCheckConfig, req, settings.GRPC, c.logger, "GetUptimeCheckConfig") return err }, opts...) if err != nil { @@ -365,7 +369,7 @@ func (c *uptimeCheckGRPCClient) CreateUptimeCheckConfig(ctx context.Context, req var resp *monitoringpb.UptimeCheckConfig err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.uptimeCheckClient.CreateUptimeCheckConfig(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.uptimeCheckClient.CreateUptimeCheckConfig, req, settings.GRPC, c.logger, "CreateUptimeCheckConfig") return err }, opts...) if err != nil { @@ -383,7 +387,7 @@ func (c *uptimeCheckGRPCClient) UpdateUptimeCheckConfig(ctx context.Context, req var resp *monitoringpb.UptimeCheckConfig err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.uptimeCheckClient.UpdateUptimeCheckConfig(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.uptimeCheckClient.UpdateUptimeCheckConfig, req, settings.GRPC, c.logger, "UpdateUptimeCheckConfig") return err }, opts...) if err != nil { @@ -400,7 +404,7 @@ func (c *uptimeCheckGRPCClient) DeleteUptimeCheckConfig(ctx context.Context, req opts = append((*c.CallOptions).DeleteUptimeCheckConfig[0:len((*c.CallOptions).DeleteUptimeCheckConfig):len((*c.CallOptions).DeleteUptimeCheckConfig)], opts...) err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - _, err = c.uptimeCheckClient.DeleteUptimeCheckConfig(ctx, req, settings.GRPC...) + _, err = executeRPC(ctx, c.uptimeCheckClient.DeleteUptimeCheckConfig, req, settings.GRPC, c.logger, "DeleteUptimeCheckConfig") return err }, opts...) return err @@ -423,7 +427,7 @@ func (c *uptimeCheckGRPCClient) ListUptimeCheckIps(ctx context.Context, req *mon } err := gax.Invoke(ctx, func(ctx context.Context, settings gax.CallSettings) error { var err error - resp, err = c.uptimeCheckClient.ListUptimeCheckIps(ctx, req, settings.GRPC...) + resp, err = executeRPC(ctx, c.uptimeCheckClient.ListUptimeCheckIps, req, settings.GRPC, c.logger, "ListUptimeCheckIps") return err }, opts...) if err != nil { diff --git a/vendor/cloud.google.com/go/monitoring/internal/version.go b/vendor/cloud.google.com/go/monitoring/internal/version.go index 96b26337cb742..08bddba748611 100644 --- a/vendor/cloud.google.com/go/monitoring/internal/version.go +++ b/vendor/cloud.google.com/go/monitoring/internal/version.go @@ -15,4 +15,4 @@ package internal // Version is the current tagged release of the library. -const Version = "1.21.2" +const Version = "1.22.1" diff --git a/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/README.md b/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/README.md index c77d5eb154461..ea391705f251c 100644 --- a/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/README.md +++ b/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/README.md @@ -3,7 +3,14 @@ [![Docs](https://godoc.org/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric?status.svg)](https://pkg.go.dev/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric) [![Apache License][license-image]][license-url] -OpenTelemetry Google Cloud Monitoring Exporter allow the user to send collected metrics to Google Cloud. +OpenTelemetry Google Cloud Monitoring Exporter allows the user to send collected metrics to Google Cloud. + +To get started with instrumentation in Google Cloud, see [Generate traces and metrics with +Go](https://cloud.google.com/stackdriver/docs/instrumentation/setup/go). + +To learn more about instrumentation and observability, including opinionated recommendations +for Google Cloud Observability, visit [Instrumentation and +observability](https://cloud.google.com/stackdriver/docs/instrumentation/overview). [Google Cloud Monitoring](https://cloud.google.com/monitoring) provides visibility into the performance, uptime, and overall health of cloud-powered applications. It collects metrics, events, and metadata from Google Cloud, Amazon Web Services, hosted uptime probes, application instrumentation, and a variety of common application components including Cassandra, Nginx, Apache Web Server, Elasticsearch, and many others. Operations ingests that data and generates insights via dashboards, charts, and alerts. Cloud Monitoring alerting helps you collaborate by integrating with Slack, PagerDuty, and more. diff --git a/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/metric.go b/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/metric.go index ba0012e25a916..b0ab713c6d09f 100644 --- a/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/metric.go +++ b/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/metric.go @@ -68,7 +68,7 @@ type key struct { libraryname string } -func keyOf(metrics metricdata.Metrics, library instrumentation.Library) key { +func keyOf(metrics metricdata.Metrics, library instrumentation.Scope) key { return key{ name: metrics.Name, libraryname: library.Name, @@ -426,7 +426,7 @@ func recordToMdpbKindType(a metricdata.Aggregation) (googlemetricpb.MetricDescri } // recordToMpb converts data from records to Metric proto type for Cloud Monitoring. -func (me *metricExporter) recordToMpb(metrics metricdata.Metrics, attributes attribute.Set, library instrumentation.Library, extraLabels *attribute.Set) *googlemetricpb.Metric { +func (me *metricExporter) recordToMpb(metrics metricdata.Metrics, attributes attribute.Set, library instrumentation.Scope, extraLabels *attribute.Set) *googlemetricpb.Metric { me.mdLock.RLock() defer me.mdLock.RUnlock() k := keyOf(metrics, library) diff --git a/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/option.go b/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/option.go index 11b96067d557d..701b10b101473 100644 --- a/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/option.go +++ b/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/option.go @@ -92,7 +92,7 @@ type options struct { // WithProjectID sets Google Cloud Platform project as projectID. // Without using this option, it automatically detects the project ID // from the default credential detection process. -// Please find the detailed order of the default credentail detection proecess on the doc: +// Please find the detailed order of the default credential detection process on the doc: // https://godoc.org/golang.org/x/oauth2/google#FindDefaultCredentials func WithProjectID(id string) func(o *options) { return func(o *options) { diff --git a/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/version.go b/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/version.go index e31119fc1293f..a8054fec34bdd 100644 --- a/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/version.go +++ b/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric/version.go @@ -17,5 +17,5 @@ package metric // Version is the current release version of the OpenTelemetry // Operations Metric Exporter in use. func Version() string { - return "0.48.1" + return "0.49.0" } diff --git a/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping/resourcemapping.go b/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping/resourcemapping.go index 4b5af517fe62d..510391b824aaf 100644 --- a/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping/resourcemapping.go +++ b/vendor/github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping/resourcemapping.go @@ -221,9 +221,8 @@ func commonResourceAttributesToMonitoredResource(cloudPlatform string, attrs Rea return createMonitoredResource(k8sPod, attrs) } else if _, ok := attrs.GetString(string(semconv.K8SNodeNameKey)); ok { return createMonitoredResource(k8sNode, attrs) - } else { - return createMonitoredResource(k8sCluster, attrs) } + return createMonitoredResource(k8sCluster, attrs) } // Fallback to generic_task diff --git a/vendor/github.com/census-instrumentation/opencensus-proto/AUTHORS b/vendor/github.com/census-instrumentation/opencensus-proto/AUTHORS deleted file mode 100644 index e068e731ea78b..0000000000000 --- a/vendor/github.com/census-instrumentation/opencensus-proto/AUTHORS +++ /dev/null @@ -1 +0,0 @@ -Google Inc. \ No newline at end of file diff --git a/vendor/github.com/census-instrumentation/opencensus-proto/LICENSE b/vendor/github.com/census-instrumentation/opencensus-proto/LICENSE deleted file mode 100644 index d645695673349..0000000000000 --- a/vendor/github.com/census-instrumentation/opencensus-proto/LICENSE +++ /dev/null @@ -1,202 +0,0 @@ - - Apache License - Version 2.0, January 2004 - http://www.apache.org/licenses/ - - TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION - - 1. Definitions. - - "License" shall mean the terms and conditions for use, reproduction, - and distribution as defined by Sections 1 through 9 of this document. - - "Licensor" shall mean the copyright owner or entity authorized by - the copyright owner that is granting the License. - - "Legal Entity" shall mean the union of the acting entity and all - other entities that control, are controlled by, or are under common - control with that entity. For the purposes of this definition, - "control" means (i) the power, direct or indirect, to cause the - direction or management of such entity, whether by contract or - otherwise, or (ii) ownership of fifty percent (50%) or more of the - outstanding shares, or (iii) beneficial ownership of such entity. - - "You" (or "Your") shall mean an individual or Legal Entity - exercising permissions granted by this License. - - "Source" form shall mean the preferred form for making modifications, - including but not limited to software source code, documentation - source, and configuration files. - - "Object" form shall mean any form resulting from mechanical - transformation or translation of a Source form, including but - not limited to compiled object code, generated documentation, - and conversions to other media types. - - "Work" shall mean the work of authorship, whether in Source or - Object form, made available under the License, as indicated by a - copyright notice that is included in or attached to the work - (an example is provided in the Appendix below). - - "Derivative Works" shall mean any work, whether in Source or Object - form, that is based on (or derived from) the Work and for which the - editorial revisions, annotations, elaborations, or other modifications - represent, as a whole, an original work of authorship. For the purposes - of this License, Derivative Works shall not include works that remain - separable from, or merely link (or bind by name) to the interfaces of, - the Work and Derivative Works thereof. - - "Contribution" shall mean any work of authorship, including - the original version of the Work and any modifications or additions - to that Work or Derivative Works thereof, that is intentionally - submitted to Licensor for inclusion in the Work by the copyright owner - or by an individual or Legal Entity authorized to submit on behalf of - the copyright owner. For the purposes of this definition, "submitted" - means any form of electronic, verbal, or written communication sent - to the Licensor or its representatives, including but not limited to - communication on electronic mailing lists, source code control systems, - and issue tracking systems that are managed by, or on behalf of, the - Licensor for the purpose of discussing and improving the Work, but - excluding communication that is conspicuously marked or otherwise - designated in writing by the copyright owner as "Not a Contribution." - - "Contributor" shall mean Licensor and any individual or Legal Entity - on behalf of whom a Contribution has been received by Licensor and - subsequently incorporated within the Work. - - 2. Grant of Copyright License. Subject to the terms and conditions of - this License, each Contributor hereby grants to You a perpetual, - worldwide, non-exclusive, no-charge, royalty-free, irrevocable - copyright license to reproduce, prepare Derivative Works of, - publicly display, publicly perform, sublicense, and distribute the - Work and such Derivative Works in Source or Object form. - - 3. Grant of Patent License. Subject to the terms and conditions of - this License, each Contributor hereby grants to You a perpetual, - worldwide, non-exclusive, no-charge, royalty-free, irrevocable - (except as stated in this section) patent license to make, have made, - use, offer to sell, sell, import, and otherwise transfer the Work, - where such license applies only to those patent claims licensable - by such Contributor that are necessarily infringed by their - Contribution(s) alone or by combination of their Contribution(s) - with the Work to which such Contribution(s) was submitted. If You - institute patent litigation against any entity (including a - cross-claim or counterclaim in a lawsuit) alleging that the Work - or a Contribution incorporated within the Work constitutes direct - or contributory patent infringement, then any patent licenses - granted to You under this License for that Work shall terminate - as of the date such litigation is filed. - - 4. Redistribution. You may reproduce and distribute copies of the - Work or Derivative Works thereof in any medium, with or without - modifications, and in Source or Object form, provided that You - meet the following conditions: - - (a) You must give any other recipients of the Work or - Derivative Works a copy of this License; and - - (b) You must cause any modified files to carry prominent notices - stating that You changed the files; and - - (c) You must retain, in the Source form of any Derivative Works - that You distribute, all copyright, patent, trademark, and - attribution notices from the Source form of the Work, - excluding those notices that do not pertain to any part of - the Derivative Works; and - - (d) If the Work includes a "NOTICE" text file as part of its - distribution, then any Derivative Works that You distribute must - include a readable copy of the attribution notices contained - within such NOTICE file, excluding those notices that do not - pertain to any part of the Derivative Works, in at least one - of the following places: within a NOTICE text file distributed - as part of the Derivative Works; within the Source form or - documentation, if provided along with the Derivative Works; or, - within a display generated by the Derivative Works, if and - wherever such third-party notices normally appear. The contents - of the NOTICE file are for informational purposes only and - do not modify the License. You may add Your own attribution - notices within Derivative Works that You distribute, alongside - or as an addendum to the NOTICE text from the Work, provided - that such additional attribution notices cannot be construed - as modifying the License. - - You may add Your own copyright statement to Your modifications and - may provide additional or different license terms and conditions - for use, reproduction, or distribution of Your modifications, or - for any such Derivative Works as a whole, provided Your use, - reproduction, and distribution of the Work otherwise complies with - the conditions stated in this License. - - 5. Submission of Contributions. Unless You explicitly state otherwise, - any Contribution intentionally submitted for inclusion in the Work - by You to the Licensor shall be under the terms and conditions of - this License, without any additional terms or conditions. - Notwithstanding the above, nothing herein shall supersede or modify - the terms of any separate license agreement you may have executed - with Licensor regarding such Contributions. - - 6. Trademarks. This License does not grant permission to use the trade - names, trademarks, service marks, or product names of the Licensor, - except as required for reasonable and customary use in describing the - origin of the Work and reproducing the content of the NOTICE file. - - 7. Disclaimer of Warranty. Unless required by applicable law or - agreed to in writing, Licensor provides the Work (and each - Contributor provides its Contributions) on an "AS IS" BASIS, - WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or - implied, including, without limitation, any warranties or conditions - of TITLE, NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A - PARTICULAR PURPOSE. You are solely responsible for determining the - appropriateness of using or redistributing the Work and assume any - risks associated with Your exercise of permissions under this License. - - 8. Limitation of Liability. In no event and under no legal theory, - whether in tort (including negligence), contract, or otherwise, - unless required by applicable law (such as deliberate and grossly - negligent acts) or agreed to in writing, shall any Contributor be - liable to You for damages, including any direct, indirect, special, - incidental, or consequential damages of any character arising as a - result of this License or out of the use or inability to use the - Work (including but not limited to damages for loss of goodwill, - work stoppage, computer failure or malfunction, or any and all - other commercial damages or losses), even if such Contributor - has been advised of the possibility of such damages. - - 9. Accepting Warranty or Additional Liability. While redistributing - the Work or Derivative Works thereof, You may choose to offer, - and charge a fee for, acceptance of support, warranty, indemnity, - or other liability obligations and/or rights consistent with this - License. However, in accepting such obligations, You may act only - on Your own behalf and on Your sole responsibility, not on behalf - of any other Contributor, and only if You agree to indemnify, - defend, and hold each Contributor harmless for any liability - incurred by, or claims asserted against, such Contributor by reason - of your accepting any such warranty or additional liability. - - END OF TERMS AND CONDITIONS - - APPENDIX: How to apply the Apache License to your work. - - To apply the Apache License to your work, attach the following - boilerplate notice, with the fields enclosed by brackets "[]" - replaced with your own identifying information. (Don't include - the brackets!) The text should be enclosed in the appropriate - comment syntax for the file format. We also recommend that a - file or class name and description of purpose be included on the - same "printed page" as the copyright notice for easier - identification within third-party archives. - - Copyright [yyyy] [name of copyright owner] - - Licensed under the Apache License, Version 2.0 (the "License"); - you may not use this file except in compliance with the License. - You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - - Unless required by applicable law or agreed to in writing, software - distributed under the License is distributed on an "AS IS" BASIS, - WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - See the License for the specific language governing permissions and - limitations under the License. diff --git a/vendor/github.com/census-instrumentation/opencensus-proto/gen-go/resource/v1/resource.pb.go b/vendor/github.com/census-instrumentation/opencensus-proto/gen-go/resource/v1/resource.pb.go deleted file mode 100644 index 194dd70dfbd87..0000000000000 --- a/vendor/github.com/census-instrumentation/opencensus-proto/gen-go/resource/v1/resource.pb.go +++ /dev/null @@ -1,189 +0,0 @@ -// Copyright 2018, OpenCensus Authors -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -// Code generated by protoc-gen-go. DO NOT EDIT. -// versions: -// protoc-gen-go v1.26.0 -// protoc v3.17.3 -// source: opencensus/proto/resource/v1/resource.proto - -package v1 - -import ( - protoreflect "google.golang.org/protobuf/reflect/protoreflect" - protoimpl "google.golang.org/protobuf/runtime/protoimpl" - reflect "reflect" - sync "sync" -) - -const ( - // Verify that this generated code is sufficiently up-to-date. - _ = protoimpl.EnforceVersion(20 - protoimpl.MinVersion) - // Verify that runtime/protoimpl is sufficiently up-to-date. - _ = protoimpl.EnforceVersion(protoimpl.MaxVersion - 20) -) - -// Resource information. -type Resource struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - // Type identifier for the resource. - Type string `protobuf:"bytes,1,opt,name=type,proto3" json:"type,omitempty"` - // Set of labels that describe the resource. - Labels map[string]string `protobuf:"bytes,2,rep,name=labels,proto3" json:"labels,omitempty" protobuf_key:"bytes,1,opt,name=key,proto3" protobuf_val:"bytes,2,opt,name=value,proto3"` -} - -func (x *Resource) Reset() { - *x = Resource{} - if protoimpl.UnsafeEnabled { - mi := &file_opencensus_proto_resource_v1_resource_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *Resource) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*Resource) ProtoMessage() {} - -func (x *Resource) ProtoReflect() protoreflect.Message { - mi := &file_opencensus_proto_resource_v1_resource_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use Resource.ProtoReflect.Descriptor instead. -func (*Resource) Descriptor() ([]byte, []int) { - return file_opencensus_proto_resource_v1_resource_proto_rawDescGZIP(), []int{0} -} - -func (x *Resource) GetType() string { - if x != nil { - return x.Type - } - return "" -} - -func (x *Resource) GetLabels() map[string]string { - if x != nil { - return x.Labels - } - return nil -} - -var File_opencensus_proto_resource_v1_resource_proto protoreflect.FileDescriptor - -var file_opencensus_proto_resource_v1_resource_proto_rawDesc = []byte{ - 0x0a, 0x2b, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2f, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x2f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x2f, 0x76, 0x31, 0x2f, 0x72, - 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x1c, 0x6f, - 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, - 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x22, 0xa5, 0x01, 0x0a, 0x08, - 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x12, 0x12, 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, - 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, 0x4a, 0x0a, 0x06, - 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x32, 0x2e, 0x6f, - 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, - 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x52, 0x65, 0x73, 0x6f, - 0x75, 0x72, 0x63, 0x65, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, - 0x52, 0x06, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x1a, 0x39, 0x0a, 0x0b, 0x4c, 0x61, 0x62, 0x65, - 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, - 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, - 0x02, 0x38, 0x01, 0x42, 0x9b, 0x01, 0x0a, 0x1f, 0x69, 0x6f, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, - 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x72, 0x65, 0x73, 0x6f, - 0x75, 0x72, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x42, 0x0d, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, - 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x45, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, - 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2d, 0x69, 0x6e, 0x73, 0x74, - 0x72, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2f, 0x6f, 0x70, 0x65, 0x6e, - 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2d, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x65, 0x6e, - 0x2d, 0x67, 0x6f, 0x2f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x2f, 0x76, 0x31, 0xea, - 0x02, 0x1f, 0x4f, 0x70, 0x65, 0x6e, 0x43, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x3a, 0x3a, 0x50, 0x72, - 0x6f, 0x74, 0x6f, 0x3a, 0x3a, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x3a, 0x3a, 0x56, - 0x31, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, -} - -var ( - file_opencensus_proto_resource_v1_resource_proto_rawDescOnce sync.Once - file_opencensus_proto_resource_v1_resource_proto_rawDescData = file_opencensus_proto_resource_v1_resource_proto_rawDesc -) - -func file_opencensus_proto_resource_v1_resource_proto_rawDescGZIP() []byte { - file_opencensus_proto_resource_v1_resource_proto_rawDescOnce.Do(func() { - file_opencensus_proto_resource_v1_resource_proto_rawDescData = protoimpl.X.CompressGZIP(file_opencensus_proto_resource_v1_resource_proto_rawDescData) - }) - return file_opencensus_proto_resource_v1_resource_proto_rawDescData -} - -var file_opencensus_proto_resource_v1_resource_proto_msgTypes = make([]protoimpl.MessageInfo, 2) -var file_opencensus_proto_resource_v1_resource_proto_goTypes = []interface{}{ - (*Resource)(nil), // 0: opencensus.proto.resource.v1.Resource - nil, // 1: opencensus.proto.resource.v1.Resource.LabelsEntry -} -var file_opencensus_proto_resource_v1_resource_proto_depIdxs = []int32{ - 1, // 0: opencensus.proto.resource.v1.Resource.labels:type_name -> opencensus.proto.resource.v1.Resource.LabelsEntry - 1, // [1:1] is the sub-list for method output_type - 1, // [1:1] is the sub-list for method input_type - 1, // [1:1] is the sub-list for extension type_name - 1, // [1:1] is the sub-list for extension extendee - 0, // [0:1] is the sub-list for field type_name -} - -func init() { file_opencensus_proto_resource_v1_resource_proto_init() } -func file_opencensus_proto_resource_v1_resource_proto_init() { - if File_opencensus_proto_resource_v1_resource_proto != nil { - return - } - if !protoimpl.UnsafeEnabled { - file_opencensus_proto_resource_v1_resource_proto_msgTypes[0].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*Resource); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } - type x struct{} - out := protoimpl.TypeBuilder{ - File: protoimpl.DescBuilder{ - GoPackagePath: reflect.TypeOf(x{}).PkgPath(), - RawDescriptor: file_opencensus_proto_resource_v1_resource_proto_rawDesc, - NumEnums: 0, - NumMessages: 2, - NumExtensions: 0, - NumServices: 0, - }, - GoTypes: file_opencensus_proto_resource_v1_resource_proto_goTypes, - DependencyIndexes: file_opencensus_proto_resource_v1_resource_proto_depIdxs, - MessageInfos: file_opencensus_proto_resource_v1_resource_proto_msgTypes, - }.Build() - File_opencensus_proto_resource_v1_resource_proto = out.File - file_opencensus_proto_resource_v1_resource_proto_rawDesc = nil - file_opencensus_proto_resource_v1_resource_proto_goTypes = nil - file_opencensus_proto_resource_v1_resource_proto_depIdxs = nil -} diff --git a/vendor/github.com/census-instrumentation/opencensus-proto/gen-go/trace/v1/trace.pb.go b/vendor/github.com/census-instrumentation/opencensus-proto/gen-go/trace/v1/trace.pb.go deleted file mode 100644 index d35612ca05806..0000000000000 --- a/vendor/github.com/census-instrumentation/opencensus-proto/gen-go/trace/v1/trace.pb.go +++ /dev/null @@ -1,2235 +0,0 @@ -// Copyright 2017, OpenCensus Authors -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -// Code generated by protoc-gen-go. DO NOT EDIT. -// versions: -// protoc-gen-go v1.26.0 -// protoc v3.17.3 -// source: opencensus/proto/trace/v1/trace.proto - -package v1 - -import ( - v1 "github.com/census-instrumentation/opencensus-proto/gen-go/resource/v1" - protoreflect "google.golang.org/protobuf/reflect/protoreflect" - protoimpl "google.golang.org/protobuf/runtime/protoimpl" - timestamppb "google.golang.org/protobuf/types/known/timestamppb" - wrapperspb "google.golang.org/protobuf/types/known/wrapperspb" - reflect "reflect" - sync "sync" -) - -const ( - // Verify that this generated code is sufficiently up-to-date. - _ = protoimpl.EnforceVersion(20 - protoimpl.MinVersion) - // Verify that runtime/protoimpl is sufficiently up-to-date. - _ = protoimpl.EnforceVersion(protoimpl.MaxVersion - 20) -) - -// Type of span. Can be used to specify additional relationships between spans -// in addition to a parent/child relationship. -type Span_SpanKind int32 - -const ( - // Unspecified. - Span_SPAN_KIND_UNSPECIFIED Span_SpanKind = 0 - // Indicates that the span covers server-side handling of an RPC or other - // remote network request. - Span_SERVER Span_SpanKind = 1 - // Indicates that the span covers the client-side wrapper around an RPC or - // other remote request. - Span_CLIENT Span_SpanKind = 2 -) - -// Enum value maps for Span_SpanKind. -var ( - Span_SpanKind_name = map[int32]string{ - 0: "SPAN_KIND_UNSPECIFIED", - 1: "SERVER", - 2: "CLIENT", - } - Span_SpanKind_value = map[string]int32{ - "SPAN_KIND_UNSPECIFIED": 0, - "SERVER": 1, - "CLIENT": 2, - } -) - -func (x Span_SpanKind) Enum() *Span_SpanKind { - p := new(Span_SpanKind) - *p = x - return p -} - -func (x Span_SpanKind) String() string { - return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) -} - -func (Span_SpanKind) Descriptor() protoreflect.EnumDescriptor { - return file_opencensus_proto_trace_v1_trace_proto_enumTypes[0].Descriptor() -} - -func (Span_SpanKind) Type() protoreflect.EnumType { - return &file_opencensus_proto_trace_v1_trace_proto_enumTypes[0] -} - -func (x Span_SpanKind) Number() protoreflect.EnumNumber { - return protoreflect.EnumNumber(x) -} - -// Deprecated: Use Span_SpanKind.Descriptor instead. -func (Span_SpanKind) EnumDescriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_proto_rawDescGZIP(), []int{0, 0} -} - -// Indicates whether the message was sent or received. -type Span_TimeEvent_MessageEvent_Type int32 - -const ( - // Unknown event type. - Span_TimeEvent_MessageEvent_TYPE_UNSPECIFIED Span_TimeEvent_MessageEvent_Type = 0 - // Indicates a sent message. - Span_TimeEvent_MessageEvent_SENT Span_TimeEvent_MessageEvent_Type = 1 - // Indicates a received message. - Span_TimeEvent_MessageEvent_RECEIVED Span_TimeEvent_MessageEvent_Type = 2 -) - -// Enum value maps for Span_TimeEvent_MessageEvent_Type. -var ( - Span_TimeEvent_MessageEvent_Type_name = map[int32]string{ - 0: "TYPE_UNSPECIFIED", - 1: "SENT", - 2: "RECEIVED", - } - Span_TimeEvent_MessageEvent_Type_value = map[string]int32{ - "TYPE_UNSPECIFIED": 0, - "SENT": 1, - "RECEIVED": 2, - } -) - -func (x Span_TimeEvent_MessageEvent_Type) Enum() *Span_TimeEvent_MessageEvent_Type { - p := new(Span_TimeEvent_MessageEvent_Type) - *p = x - return p -} - -func (x Span_TimeEvent_MessageEvent_Type) String() string { - return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) -} - -func (Span_TimeEvent_MessageEvent_Type) Descriptor() protoreflect.EnumDescriptor { - return file_opencensus_proto_trace_v1_trace_proto_enumTypes[1].Descriptor() -} - -func (Span_TimeEvent_MessageEvent_Type) Type() protoreflect.EnumType { - return &file_opencensus_proto_trace_v1_trace_proto_enumTypes[1] -} - -func (x Span_TimeEvent_MessageEvent_Type) Number() protoreflect.EnumNumber { - return protoreflect.EnumNumber(x) -} - -// Deprecated: Use Span_TimeEvent_MessageEvent_Type.Descriptor instead. -func (Span_TimeEvent_MessageEvent_Type) EnumDescriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_proto_rawDescGZIP(), []int{0, 2, 1, 0} -} - -// The relationship of the current span relative to the linked span: child, -// parent, or unspecified. -type Span_Link_Type int32 - -const ( - // The relationship of the two spans is unknown, or known but other - // than parent-child. - Span_Link_TYPE_UNSPECIFIED Span_Link_Type = 0 - // The linked span is a child of the current span. - Span_Link_CHILD_LINKED_SPAN Span_Link_Type = 1 - // The linked span is a parent of the current span. - Span_Link_PARENT_LINKED_SPAN Span_Link_Type = 2 -) - -// Enum value maps for Span_Link_Type. -var ( - Span_Link_Type_name = map[int32]string{ - 0: "TYPE_UNSPECIFIED", - 1: "CHILD_LINKED_SPAN", - 2: "PARENT_LINKED_SPAN", - } - Span_Link_Type_value = map[string]int32{ - "TYPE_UNSPECIFIED": 0, - "CHILD_LINKED_SPAN": 1, - "PARENT_LINKED_SPAN": 2, - } -) - -func (x Span_Link_Type) Enum() *Span_Link_Type { - p := new(Span_Link_Type) - *p = x - return p -} - -func (x Span_Link_Type) String() string { - return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) -} - -func (Span_Link_Type) Descriptor() protoreflect.EnumDescriptor { - return file_opencensus_proto_trace_v1_trace_proto_enumTypes[2].Descriptor() -} - -func (Span_Link_Type) Type() protoreflect.EnumType { - return &file_opencensus_proto_trace_v1_trace_proto_enumTypes[2] -} - -func (x Span_Link_Type) Number() protoreflect.EnumNumber { - return protoreflect.EnumNumber(x) -} - -// Deprecated: Use Span_Link_Type.Descriptor instead. -func (Span_Link_Type) EnumDescriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_proto_rawDescGZIP(), []int{0, 4, 0} -} - -// A span represents a single operation within a trace. Spans can be -// nested to form a trace tree. Spans may also be linked to other spans -// from the same or different trace. And form graphs. Often, a trace -// contains a root span that describes the end-to-end latency, and one -// or more subspans for its sub-operations. A trace can also contain -// multiple root spans, or none at all. Spans do not need to be -// contiguous - there may be gaps or overlaps between spans in a trace. -// -// The next id is 17. -// TODO(bdrutu): Add an example. -type Span struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - // A unique identifier for a trace. All spans from the same trace share - // the same `trace_id`. The ID is a 16-byte array. An ID with all zeroes - // is considered invalid. - // - // This field is semantically required. Receiver should generate new - // random trace_id if empty or invalid trace_id was received. - // - // This field is required. - TraceId []byte `protobuf:"bytes,1,opt,name=trace_id,json=traceId,proto3" json:"trace_id,omitempty"` - // A unique identifier for a span within a trace, assigned when the span - // is created. The ID is an 8-byte array. An ID with all zeroes is considered - // invalid. - // - // This field is semantically required. Receiver should generate new - // random span_id if empty or invalid span_id was received. - // - // This field is required. - SpanId []byte `protobuf:"bytes,2,opt,name=span_id,json=spanId,proto3" json:"span_id,omitempty"` - // The Tracestate on the span. - Tracestate *Span_Tracestate `protobuf:"bytes,15,opt,name=tracestate,proto3" json:"tracestate,omitempty"` - // The `span_id` of this span's parent span. If this is a root span, then this - // field must be empty. The ID is an 8-byte array. - ParentSpanId []byte `protobuf:"bytes,3,opt,name=parent_span_id,json=parentSpanId,proto3" json:"parent_span_id,omitempty"` - // A description of the span's operation. - // - // For example, the name can be a qualified method name or a file name - // and a line number where the operation is called. A best practice is to use - // the same display name at the same call point in an application. - // This makes it easier to correlate spans in different traces. - // - // This field is semantically required to be set to non-empty string. - // When null or empty string received - receiver may use string "name" - // as a replacement. There might be smarted algorithms implemented by - // receiver to fix the empty span name. - // - // This field is required. - Name *TruncatableString `protobuf:"bytes,4,opt,name=name,proto3" json:"name,omitempty"` - // Distinguishes between spans generated in a particular context. For example, - // two spans with the same name may be distinguished using `CLIENT` (caller) - // and `SERVER` (callee) to identify queueing latency associated with the span. - Kind Span_SpanKind `protobuf:"varint,14,opt,name=kind,proto3,enum=opencensus.proto.trace.v1.Span_SpanKind" json:"kind,omitempty"` - // The start time of the span. On the client side, this is the time kept by - // the local machine where the span execution starts. On the server side, this - // is the time when the server's application handler starts running. - // - // This field is semantically required. When not set on receive - - // receiver should set it to the value of end_time field if it was - // set. Or to the current time if neither was set. It is important to - // keep end_time > start_time for consistency. - // - // This field is required. - StartTime *timestamppb.Timestamp `protobuf:"bytes,5,opt,name=start_time,json=startTime,proto3" json:"start_time,omitempty"` - // The end time of the span. On the client side, this is the time kept by - // the local machine where the span execution ends. On the server side, this - // is the time when the server application handler stops running. - // - // This field is semantically required. When not set on receive - - // receiver should set it to start_time value. It is important to - // keep end_time > start_time for consistency. - // - // This field is required. - EndTime *timestamppb.Timestamp `protobuf:"bytes,6,opt,name=end_time,json=endTime,proto3" json:"end_time,omitempty"` - // A set of attributes on the span. - Attributes *Span_Attributes `protobuf:"bytes,7,opt,name=attributes,proto3" json:"attributes,omitempty"` - // A stack trace captured at the start of the span. - StackTrace *StackTrace `protobuf:"bytes,8,opt,name=stack_trace,json=stackTrace,proto3" json:"stack_trace,omitempty"` - // The included time events. - TimeEvents *Span_TimeEvents `protobuf:"bytes,9,opt,name=time_events,json=timeEvents,proto3" json:"time_events,omitempty"` - // The included links. - Links *Span_Links `protobuf:"bytes,10,opt,name=links,proto3" json:"links,omitempty"` - // An optional final status for this span. Semantically when Status - // wasn't set it is means span ended without errors and assume - // Status.Ok (code = 0). - Status *Status `protobuf:"bytes,11,opt,name=status,proto3" json:"status,omitempty"` - // An optional resource that is associated with this span. If not set, this span - // should be part of a batch that does include the resource information, unless resource - // information is unknown. - Resource *v1.Resource `protobuf:"bytes,16,opt,name=resource,proto3" json:"resource,omitempty"` - // A highly recommended but not required flag that identifies when a - // trace crosses a process boundary. True when the parent_span belongs - // to the same process as the current span. This flag is most commonly - // used to indicate the need to adjust time as clocks in different - // processes may not be synchronized. - SameProcessAsParentSpan *wrapperspb.BoolValue `protobuf:"bytes,12,opt,name=same_process_as_parent_span,json=sameProcessAsParentSpan,proto3" json:"same_process_as_parent_span,omitempty"` - // An optional number of child spans that were generated while this span - // was active. If set, allows an implementation to detect missing child spans. - ChildSpanCount *wrapperspb.UInt32Value `protobuf:"bytes,13,opt,name=child_span_count,json=childSpanCount,proto3" json:"child_span_count,omitempty"` -} - -func (x *Span) Reset() { - *x = Span{} - if protoimpl.UnsafeEnabled { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *Span) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*Span) ProtoMessage() {} - -func (x *Span) ProtoReflect() protoreflect.Message { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use Span.ProtoReflect.Descriptor instead. -func (*Span) Descriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_proto_rawDescGZIP(), []int{0} -} - -func (x *Span) GetTraceId() []byte { - if x != nil { - return x.TraceId - } - return nil -} - -func (x *Span) GetSpanId() []byte { - if x != nil { - return x.SpanId - } - return nil -} - -func (x *Span) GetTracestate() *Span_Tracestate { - if x != nil { - return x.Tracestate - } - return nil -} - -func (x *Span) GetParentSpanId() []byte { - if x != nil { - return x.ParentSpanId - } - return nil -} - -func (x *Span) GetName() *TruncatableString { - if x != nil { - return x.Name - } - return nil -} - -func (x *Span) GetKind() Span_SpanKind { - if x != nil { - return x.Kind - } - return Span_SPAN_KIND_UNSPECIFIED -} - -func (x *Span) GetStartTime() *timestamppb.Timestamp { - if x != nil { - return x.StartTime - } - return nil -} - -func (x *Span) GetEndTime() *timestamppb.Timestamp { - if x != nil { - return x.EndTime - } - return nil -} - -func (x *Span) GetAttributes() *Span_Attributes { - if x != nil { - return x.Attributes - } - return nil -} - -func (x *Span) GetStackTrace() *StackTrace { - if x != nil { - return x.StackTrace - } - return nil -} - -func (x *Span) GetTimeEvents() *Span_TimeEvents { - if x != nil { - return x.TimeEvents - } - return nil -} - -func (x *Span) GetLinks() *Span_Links { - if x != nil { - return x.Links - } - return nil -} - -func (x *Span) GetStatus() *Status { - if x != nil { - return x.Status - } - return nil -} - -func (x *Span) GetResource() *v1.Resource { - if x != nil { - return x.Resource - } - return nil -} - -func (x *Span) GetSameProcessAsParentSpan() *wrapperspb.BoolValue { - if x != nil { - return x.SameProcessAsParentSpan - } - return nil -} - -func (x *Span) GetChildSpanCount() *wrapperspb.UInt32Value { - if x != nil { - return x.ChildSpanCount - } - return nil -} - -// The `Status` type defines a logical error model that is suitable for different -// programming environments, including REST APIs and RPC APIs. This proto's fields -// are a subset of those of -// [google.rpc.Status](https://github.com/googleapis/googleapis/blob/master/google/rpc/status.proto), -// which is used by [gRPC](https://github.com/grpc). -type Status struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - // The status code. This is optional field. It is safe to assume 0 (OK) - // when not set. - Code int32 `protobuf:"varint,1,opt,name=code,proto3" json:"code,omitempty"` - // A developer-facing error message, which should be in English. - Message string `protobuf:"bytes,2,opt,name=message,proto3" json:"message,omitempty"` -} - -func (x *Status) Reset() { - *x = Status{} - if protoimpl.UnsafeEnabled { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *Status) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*Status) ProtoMessage() {} - -func (x *Status) ProtoReflect() protoreflect.Message { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use Status.ProtoReflect.Descriptor instead. -func (*Status) Descriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_proto_rawDescGZIP(), []int{1} -} - -func (x *Status) GetCode() int32 { - if x != nil { - return x.Code - } - return 0 -} - -func (x *Status) GetMessage() string { - if x != nil { - return x.Message - } - return "" -} - -// The value of an Attribute. -type AttributeValue struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - // The type of the value. - // - // Types that are assignable to Value: - // *AttributeValue_StringValue - // *AttributeValue_IntValue - // *AttributeValue_BoolValue - // *AttributeValue_DoubleValue - Value isAttributeValue_Value `protobuf_oneof:"value"` -} - -func (x *AttributeValue) Reset() { - *x = AttributeValue{} - if protoimpl.UnsafeEnabled { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *AttributeValue) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*AttributeValue) ProtoMessage() {} - -func (x *AttributeValue) ProtoReflect() protoreflect.Message { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use AttributeValue.ProtoReflect.Descriptor instead. -func (*AttributeValue) Descriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_proto_rawDescGZIP(), []int{2} -} - -func (m *AttributeValue) GetValue() isAttributeValue_Value { - if m != nil { - return m.Value - } - return nil -} - -func (x *AttributeValue) GetStringValue() *TruncatableString { - if x, ok := x.GetValue().(*AttributeValue_StringValue); ok { - return x.StringValue - } - return nil -} - -func (x *AttributeValue) GetIntValue() int64 { - if x, ok := x.GetValue().(*AttributeValue_IntValue); ok { - return x.IntValue - } - return 0 -} - -func (x *AttributeValue) GetBoolValue() bool { - if x, ok := x.GetValue().(*AttributeValue_BoolValue); ok { - return x.BoolValue - } - return false -} - -func (x *AttributeValue) GetDoubleValue() float64 { - if x, ok := x.GetValue().(*AttributeValue_DoubleValue); ok { - return x.DoubleValue - } - return 0 -} - -type isAttributeValue_Value interface { - isAttributeValue_Value() -} - -type AttributeValue_StringValue struct { - // A string up to 256 bytes long. - StringValue *TruncatableString `protobuf:"bytes,1,opt,name=string_value,json=stringValue,proto3,oneof"` -} - -type AttributeValue_IntValue struct { - // A 64-bit signed integer. - IntValue int64 `protobuf:"varint,2,opt,name=int_value,json=intValue,proto3,oneof"` -} - -type AttributeValue_BoolValue struct { - // A Boolean value represented by `true` or `false`. - BoolValue bool `protobuf:"varint,3,opt,name=bool_value,json=boolValue,proto3,oneof"` -} - -type AttributeValue_DoubleValue struct { - // A double value. - DoubleValue float64 `protobuf:"fixed64,4,opt,name=double_value,json=doubleValue,proto3,oneof"` -} - -func (*AttributeValue_StringValue) isAttributeValue_Value() {} - -func (*AttributeValue_IntValue) isAttributeValue_Value() {} - -func (*AttributeValue_BoolValue) isAttributeValue_Value() {} - -func (*AttributeValue_DoubleValue) isAttributeValue_Value() {} - -// The call stack which originated this span. -type StackTrace struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - // Stack frames in this stack trace. - StackFrames *StackTrace_StackFrames `protobuf:"bytes,1,opt,name=stack_frames,json=stackFrames,proto3" json:"stack_frames,omitempty"` - // The hash ID is used to conserve network bandwidth for duplicate - // stack traces within a single trace. - // - // Often multiple spans will have identical stack traces. - // The first occurrence of a stack trace should contain both - // `stack_frames` and a value in `stack_trace_hash_id`. - // - // Subsequent spans within the same request can refer - // to that stack trace by setting only `stack_trace_hash_id`. - // - // TODO: describe how to deal with the case where stack_trace_hash_id is - // zero because it was not set. - StackTraceHashId uint64 `protobuf:"varint,2,opt,name=stack_trace_hash_id,json=stackTraceHashId,proto3" json:"stack_trace_hash_id,omitempty"` -} - -func (x *StackTrace) Reset() { - *x = StackTrace{} - if protoimpl.UnsafeEnabled { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *StackTrace) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*StackTrace) ProtoMessage() {} - -func (x *StackTrace) ProtoReflect() protoreflect.Message { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use StackTrace.ProtoReflect.Descriptor instead. -func (*StackTrace) Descriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_proto_rawDescGZIP(), []int{3} -} - -func (x *StackTrace) GetStackFrames() *StackTrace_StackFrames { - if x != nil { - return x.StackFrames - } - return nil -} - -func (x *StackTrace) GetStackTraceHashId() uint64 { - if x != nil { - return x.StackTraceHashId - } - return 0 -} - -// A description of a binary module. -type Module struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - // TODO: document the meaning of this field. - // For example: main binary, kernel modules, and dynamic libraries - // such as libc.so, sharedlib.so. - Module *TruncatableString `protobuf:"bytes,1,opt,name=module,proto3" json:"module,omitempty"` - // A unique identifier for the module, usually a hash of its - // contents. - BuildId *TruncatableString `protobuf:"bytes,2,opt,name=build_id,json=buildId,proto3" json:"build_id,omitempty"` -} - -func (x *Module) Reset() { - *x = Module{} - if protoimpl.UnsafeEnabled { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[4] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *Module) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*Module) ProtoMessage() {} - -func (x *Module) ProtoReflect() protoreflect.Message { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[4] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use Module.ProtoReflect.Descriptor instead. -func (*Module) Descriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_proto_rawDescGZIP(), []int{4} -} - -func (x *Module) GetModule() *TruncatableString { - if x != nil { - return x.Module - } - return nil -} - -func (x *Module) GetBuildId() *TruncatableString { - if x != nil { - return x.BuildId - } - return nil -} - -// A string that might be shortened to a specified length. -type TruncatableString struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - // The shortened string. For example, if the original string was 500 bytes long and - // the limit of the string was 128 bytes, then this value contains the first 128 - // bytes of the 500-byte string. Note that truncation always happens on a - // character boundary, to ensure that a truncated string is still valid UTF-8. - // Because it may contain multi-byte characters, the size of the truncated string - // may be less than the truncation limit. - Value string `protobuf:"bytes,1,opt,name=value,proto3" json:"value,omitempty"` - // The number of bytes removed from the original string. If this - // value is 0, then the string was not shortened. - TruncatedByteCount int32 `protobuf:"varint,2,opt,name=truncated_byte_count,json=truncatedByteCount,proto3" json:"truncated_byte_count,omitempty"` -} - -func (x *TruncatableString) Reset() { - *x = TruncatableString{} - if protoimpl.UnsafeEnabled { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[5] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *TruncatableString) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*TruncatableString) ProtoMessage() {} - -func (x *TruncatableString) ProtoReflect() protoreflect.Message { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[5] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use TruncatableString.ProtoReflect.Descriptor instead. -func (*TruncatableString) Descriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_proto_rawDescGZIP(), []int{5} -} - -func (x *TruncatableString) GetValue() string { - if x != nil { - return x.Value - } - return "" -} - -func (x *TruncatableString) GetTruncatedByteCount() int32 { - if x != nil { - return x.TruncatedByteCount - } - return 0 -} - -// This field conveys information about request position in multiple distributed tracing graphs. -// It is a list of Tracestate.Entry with a maximum of 32 members in the list. -// -// See the https://github.com/w3c/distributed-tracing for more details about this field. -type Span_Tracestate struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - // A list of entries that represent the Tracestate. - Entries []*Span_Tracestate_Entry `protobuf:"bytes,1,rep,name=entries,proto3" json:"entries,omitempty"` -} - -func (x *Span_Tracestate) Reset() { - *x = Span_Tracestate{} - if protoimpl.UnsafeEnabled { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[6] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *Span_Tracestate) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*Span_Tracestate) ProtoMessage() {} - -func (x *Span_Tracestate) ProtoReflect() protoreflect.Message { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[6] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use Span_Tracestate.ProtoReflect.Descriptor instead. -func (*Span_Tracestate) Descriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_proto_rawDescGZIP(), []int{0, 0} -} - -func (x *Span_Tracestate) GetEntries() []*Span_Tracestate_Entry { - if x != nil { - return x.Entries - } - return nil -} - -// A set of attributes, each with a key and a value. -type Span_Attributes struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - // The set of attributes. The value can be a string, an integer, a double - // or the Boolean values `true` or `false`. Note, global attributes like - // server name can be set as tags using resource API. Examples of attributes: - // - // "/http/user_agent": "Mozilla/5.0 (Macintosh; Intel Mac OS X 10_14_2) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/71.0.3578.98 Safari/537.36" - // "/http/server_latency": 300 - // "abc.com/myattribute": true - // "abc.com/score": 10.239 - AttributeMap map[string]*AttributeValue `protobuf:"bytes,1,rep,name=attribute_map,json=attributeMap,proto3" json:"attribute_map,omitempty" protobuf_key:"bytes,1,opt,name=key,proto3" protobuf_val:"bytes,2,opt,name=value,proto3"` - // The number of attributes that were discarded. Attributes can be discarded - // because their keys are too long or because there are too many attributes. - // If this value is 0, then no attributes were dropped. - DroppedAttributesCount int32 `protobuf:"varint,2,opt,name=dropped_attributes_count,json=droppedAttributesCount,proto3" json:"dropped_attributes_count,omitempty"` -} - -func (x *Span_Attributes) Reset() { - *x = Span_Attributes{} - if protoimpl.UnsafeEnabled { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[7] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *Span_Attributes) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*Span_Attributes) ProtoMessage() {} - -func (x *Span_Attributes) ProtoReflect() protoreflect.Message { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[7] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use Span_Attributes.ProtoReflect.Descriptor instead. -func (*Span_Attributes) Descriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_proto_rawDescGZIP(), []int{0, 1} -} - -func (x *Span_Attributes) GetAttributeMap() map[string]*AttributeValue { - if x != nil { - return x.AttributeMap - } - return nil -} - -func (x *Span_Attributes) GetDroppedAttributesCount() int32 { - if x != nil { - return x.DroppedAttributesCount - } - return 0 -} - -// A time-stamped annotation or message event in the Span. -type Span_TimeEvent struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - // The time the event occurred. - Time *timestamppb.Timestamp `protobuf:"bytes,1,opt,name=time,proto3" json:"time,omitempty"` - // A `TimeEvent` can contain either an `Annotation` object or a - // `MessageEvent` object, but not both. - // - // Types that are assignable to Value: - // *Span_TimeEvent_Annotation_ - // *Span_TimeEvent_MessageEvent_ - Value isSpan_TimeEvent_Value `protobuf_oneof:"value"` -} - -func (x *Span_TimeEvent) Reset() { - *x = Span_TimeEvent{} - if protoimpl.UnsafeEnabled { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[8] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *Span_TimeEvent) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*Span_TimeEvent) ProtoMessage() {} - -func (x *Span_TimeEvent) ProtoReflect() protoreflect.Message { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[8] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use Span_TimeEvent.ProtoReflect.Descriptor instead. -func (*Span_TimeEvent) Descriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_proto_rawDescGZIP(), []int{0, 2} -} - -func (x *Span_TimeEvent) GetTime() *timestamppb.Timestamp { - if x != nil { - return x.Time - } - return nil -} - -func (m *Span_TimeEvent) GetValue() isSpan_TimeEvent_Value { - if m != nil { - return m.Value - } - return nil -} - -func (x *Span_TimeEvent) GetAnnotation() *Span_TimeEvent_Annotation { - if x, ok := x.GetValue().(*Span_TimeEvent_Annotation_); ok { - return x.Annotation - } - return nil -} - -func (x *Span_TimeEvent) GetMessageEvent() *Span_TimeEvent_MessageEvent { - if x, ok := x.GetValue().(*Span_TimeEvent_MessageEvent_); ok { - return x.MessageEvent - } - return nil -} - -type isSpan_TimeEvent_Value interface { - isSpan_TimeEvent_Value() -} - -type Span_TimeEvent_Annotation_ struct { - // A text annotation with a set of attributes. - Annotation *Span_TimeEvent_Annotation `protobuf:"bytes,2,opt,name=annotation,proto3,oneof"` -} - -type Span_TimeEvent_MessageEvent_ struct { - // An event describing a message sent/received between Spans. - MessageEvent *Span_TimeEvent_MessageEvent `protobuf:"bytes,3,opt,name=message_event,json=messageEvent,proto3,oneof"` -} - -func (*Span_TimeEvent_Annotation_) isSpan_TimeEvent_Value() {} - -func (*Span_TimeEvent_MessageEvent_) isSpan_TimeEvent_Value() {} - -// A collection of `TimeEvent`s. A `TimeEvent` is a time-stamped annotation -// on the span, consisting of either user-supplied key-value pairs, or -// details of a message sent/received between Spans. -type Span_TimeEvents struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - // A collection of `TimeEvent`s. - TimeEvent []*Span_TimeEvent `protobuf:"bytes,1,rep,name=time_event,json=timeEvent,proto3" json:"time_event,omitempty"` - // The number of dropped annotations in all the included time events. - // If the value is 0, then no annotations were dropped. - DroppedAnnotationsCount int32 `protobuf:"varint,2,opt,name=dropped_annotations_count,json=droppedAnnotationsCount,proto3" json:"dropped_annotations_count,omitempty"` - // The number of dropped message events in all the included time events. - // If the value is 0, then no message events were dropped. - DroppedMessageEventsCount int32 `protobuf:"varint,3,opt,name=dropped_message_events_count,json=droppedMessageEventsCount,proto3" json:"dropped_message_events_count,omitempty"` -} - -func (x *Span_TimeEvents) Reset() { - *x = Span_TimeEvents{} - if protoimpl.UnsafeEnabled { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[9] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *Span_TimeEvents) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*Span_TimeEvents) ProtoMessage() {} - -func (x *Span_TimeEvents) ProtoReflect() protoreflect.Message { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[9] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use Span_TimeEvents.ProtoReflect.Descriptor instead. -func (*Span_TimeEvents) Descriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_proto_rawDescGZIP(), []int{0, 3} -} - -func (x *Span_TimeEvents) GetTimeEvent() []*Span_TimeEvent { - if x != nil { - return x.TimeEvent - } - return nil -} - -func (x *Span_TimeEvents) GetDroppedAnnotationsCount() int32 { - if x != nil { - return x.DroppedAnnotationsCount - } - return 0 -} - -func (x *Span_TimeEvents) GetDroppedMessageEventsCount() int32 { - if x != nil { - return x.DroppedMessageEventsCount - } - return 0 -} - -// A pointer from the current span to another span in the same trace or in a -// different trace. For example, this can be used in batching operations, -// where a single batch handler processes multiple requests from different -// traces or when the handler receives a request from a different project. -type Span_Link struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - // A unique identifier of a trace that this linked span is part of. The ID is a - // 16-byte array. - TraceId []byte `protobuf:"bytes,1,opt,name=trace_id,json=traceId,proto3" json:"trace_id,omitempty"` - // A unique identifier for the linked span. The ID is an 8-byte array. - SpanId []byte `protobuf:"bytes,2,opt,name=span_id,json=spanId,proto3" json:"span_id,omitempty"` - // The relationship of the current span relative to the linked span. - Type Span_Link_Type `protobuf:"varint,3,opt,name=type,proto3,enum=opencensus.proto.trace.v1.Span_Link_Type" json:"type,omitempty"` - // A set of attributes on the link. - Attributes *Span_Attributes `protobuf:"bytes,4,opt,name=attributes,proto3" json:"attributes,omitempty"` - // The Tracestate associated with the link. - Tracestate *Span_Tracestate `protobuf:"bytes,5,opt,name=tracestate,proto3" json:"tracestate,omitempty"` -} - -func (x *Span_Link) Reset() { - *x = Span_Link{} - if protoimpl.UnsafeEnabled { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[10] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *Span_Link) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*Span_Link) ProtoMessage() {} - -func (x *Span_Link) ProtoReflect() protoreflect.Message { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[10] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use Span_Link.ProtoReflect.Descriptor instead. -func (*Span_Link) Descriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_proto_rawDescGZIP(), []int{0, 4} -} - -func (x *Span_Link) GetTraceId() []byte { - if x != nil { - return x.TraceId - } - return nil -} - -func (x *Span_Link) GetSpanId() []byte { - if x != nil { - return x.SpanId - } - return nil -} - -func (x *Span_Link) GetType() Span_Link_Type { - if x != nil { - return x.Type - } - return Span_Link_TYPE_UNSPECIFIED -} - -func (x *Span_Link) GetAttributes() *Span_Attributes { - if x != nil { - return x.Attributes - } - return nil -} - -func (x *Span_Link) GetTracestate() *Span_Tracestate { - if x != nil { - return x.Tracestate - } - return nil -} - -// A collection of links, which are references from this span to a span -// in the same or different trace. -type Span_Links struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - // A collection of links. - Link []*Span_Link `protobuf:"bytes,1,rep,name=link,proto3" json:"link,omitempty"` - // The number of dropped links after the maximum size was enforced. If - // this value is 0, then no links were dropped. - DroppedLinksCount int32 `protobuf:"varint,2,opt,name=dropped_links_count,json=droppedLinksCount,proto3" json:"dropped_links_count,omitempty"` -} - -func (x *Span_Links) Reset() { - *x = Span_Links{} - if protoimpl.UnsafeEnabled { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[11] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *Span_Links) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*Span_Links) ProtoMessage() {} - -func (x *Span_Links) ProtoReflect() protoreflect.Message { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[11] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use Span_Links.ProtoReflect.Descriptor instead. -func (*Span_Links) Descriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_proto_rawDescGZIP(), []int{0, 5} -} - -func (x *Span_Links) GetLink() []*Span_Link { - if x != nil { - return x.Link - } - return nil -} - -func (x *Span_Links) GetDroppedLinksCount() int32 { - if x != nil { - return x.DroppedLinksCount - } - return 0 -} - -type Span_Tracestate_Entry struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - // The key must begin with a lowercase letter, and can only contain - // lowercase letters 'a'-'z', digits '0'-'9', underscores '_', dashes - // '-', asterisks '*', and forward slashes '/'. - Key string `protobuf:"bytes,1,opt,name=key,proto3" json:"key,omitempty"` - // The value is opaque string up to 256 characters printable ASCII - // RFC0020 characters (i.e., the range 0x20 to 0x7E) except ',' and '='. - // Note that this also excludes tabs, newlines, carriage returns, etc. - Value string `protobuf:"bytes,2,opt,name=value,proto3" json:"value,omitempty"` -} - -func (x *Span_Tracestate_Entry) Reset() { - *x = Span_Tracestate_Entry{} - if protoimpl.UnsafeEnabled { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[12] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *Span_Tracestate_Entry) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*Span_Tracestate_Entry) ProtoMessage() {} - -func (x *Span_Tracestate_Entry) ProtoReflect() protoreflect.Message { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[12] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use Span_Tracestate_Entry.ProtoReflect.Descriptor instead. -func (*Span_Tracestate_Entry) Descriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_proto_rawDescGZIP(), []int{0, 0, 0} -} - -func (x *Span_Tracestate_Entry) GetKey() string { - if x != nil { - return x.Key - } - return "" -} - -func (x *Span_Tracestate_Entry) GetValue() string { - if x != nil { - return x.Value - } - return "" -} - -// A text annotation with a set of attributes. -type Span_TimeEvent_Annotation struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - // A user-supplied message describing the event. - Description *TruncatableString `protobuf:"bytes,1,opt,name=description,proto3" json:"description,omitempty"` - // A set of attributes on the annotation. - Attributes *Span_Attributes `protobuf:"bytes,2,opt,name=attributes,proto3" json:"attributes,omitempty"` -} - -func (x *Span_TimeEvent_Annotation) Reset() { - *x = Span_TimeEvent_Annotation{} - if protoimpl.UnsafeEnabled { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[14] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *Span_TimeEvent_Annotation) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*Span_TimeEvent_Annotation) ProtoMessage() {} - -func (x *Span_TimeEvent_Annotation) ProtoReflect() protoreflect.Message { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[14] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use Span_TimeEvent_Annotation.ProtoReflect.Descriptor instead. -func (*Span_TimeEvent_Annotation) Descriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_proto_rawDescGZIP(), []int{0, 2, 0} -} - -func (x *Span_TimeEvent_Annotation) GetDescription() *TruncatableString { - if x != nil { - return x.Description - } - return nil -} - -func (x *Span_TimeEvent_Annotation) GetAttributes() *Span_Attributes { - if x != nil { - return x.Attributes - } - return nil -} - -// An event describing a message sent/received between Spans. -type Span_TimeEvent_MessageEvent struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - // The type of MessageEvent. Indicates whether the message was sent or - // received. - Type Span_TimeEvent_MessageEvent_Type `protobuf:"varint,1,opt,name=type,proto3,enum=opencensus.proto.trace.v1.Span_TimeEvent_MessageEvent_Type" json:"type,omitempty"` - // An identifier for the MessageEvent's message that can be used to match - // SENT and RECEIVED MessageEvents. For example, this field could - // represent a sequence ID for a streaming RPC. It is recommended to be - // unique within a Span. - Id uint64 `protobuf:"varint,2,opt,name=id,proto3" json:"id,omitempty"` - // The number of uncompressed bytes sent or received. - UncompressedSize uint64 `protobuf:"varint,3,opt,name=uncompressed_size,json=uncompressedSize,proto3" json:"uncompressed_size,omitempty"` - // The number of compressed bytes sent or received. If zero, assumed to - // be the same size as uncompressed. - CompressedSize uint64 `protobuf:"varint,4,opt,name=compressed_size,json=compressedSize,proto3" json:"compressed_size,omitempty"` -} - -func (x *Span_TimeEvent_MessageEvent) Reset() { - *x = Span_TimeEvent_MessageEvent{} - if protoimpl.UnsafeEnabled { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[15] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *Span_TimeEvent_MessageEvent) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*Span_TimeEvent_MessageEvent) ProtoMessage() {} - -func (x *Span_TimeEvent_MessageEvent) ProtoReflect() protoreflect.Message { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[15] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use Span_TimeEvent_MessageEvent.ProtoReflect.Descriptor instead. -func (*Span_TimeEvent_MessageEvent) Descriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_proto_rawDescGZIP(), []int{0, 2, 1} -} - -func (x *Span_TimeEvent_MessageEvent) GetType() Span_TimeEvent_MessageEvent_Type { - if x != nil { - return x.Type - } - return Span_TimeEvent_MessageEvent_TYPE_UNSPECIFIED -} - -func (x *Span_TimeEvent_MessageEvent) GetId() uint64 { - if x != nil { - return x.Id - } - return 0 -} - -func (x *Span_TimeEvent_MessageEvent) GetUncompressedSize() uint64 { - if x != nil { - return x.UncompressedSize - } - return 0 -} - -func (x *Span_TimeEvent_MessageEvent) GetCompressedSize() uint64 { - if x != nil { - return x.CompressedSize - } - return 0 -} - -// A single stack frame in a stack trace. -type StackTrace_StackFrame struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - // The fully-qualified name that uniquely identifies the function or - // method that is active in this frame. - FunctionName *TruncatableString `protobuf:"bytes,1,opt,name=function_name,json=functionName,proto3" json:"function_name,omitempty"` - // An un-mangled function name, if `function_name` is - // [mangled](http://www.avabodh.com/cxxin/namemangling.html). The name can - // be fully qualified. - OriginalFunctionName *TruncatableString `protobuf:"bytes,2,opt,name=original_function_name,json=originalFunctionName,proto3" json:"original_function_name,omitempty"` - // The name of the source file where the function call appears. - FileName *TruncatableString `protobuf:"bytes,3,opt,name=file_name,json=fileName,proto3" json:"file_name,omitempty"` - // The line number in `file_name` where the function call appears. - LineNumber int64 `protobuf:"varint,4,opt,name=line_number,json=lineNumber,proto3" json:"line_number,omitempty"` - // The column number where the function call appears, if available. - // This is important in JavaScript because of its anonymous functions. - ColumnNumber int64 `protobuf:"varint,5,opt,name=column_number,json=columnNumber,proto3" json:"column_number,omitempty"` - // The binary module from where the code was loaded. - LoadModule *Module `protobuf:"bytes,6,opt,name=load_module,json=loadModule,proto3" json:"load_module,omitempty"` - // The version of the deployed source code. - SourceVersion *TruncatableString `protobuf:"bytes,7,opt,name=source_version,json=sourceVersion,proto3" json:"source_version,omitempty"` -} - -func (x *StackTrace_StackFrame) Reset() { - *x = StackTrace_StackFrame{} - if protoimpl.UnsafeEnabled { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[16] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *StackTrace_StackFrame) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*StackTrace_StackFrame) ProtoMessage() {} - -func (x *StackTrace_StackFrame) ProtoReflect() protoreflect.Message { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[16] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use StackTrace_StackFrame.ProtoReflect.Descriptor instead. -func (*StackTrace_StackFrame) Descriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_proto_rawDescGZIP(), []int{3, 0} -} - -func (x *StackTrace_StackFrame) GetFunctionName() *TruncatableString { - if x != nil { - return x.FunctionName - } - return nil -} - -func (x *StackTrace_StackFrame) GetOriginalFunctionName() *TruncatableString { - if x != nil { - return x.OriginalFunctionName - } - return nil -} - -func (x *StackTrace_StackFrame) GetFileName() *TruncatableString { - if x != nil { - return x.FileName - } - return nil -} - -func (x *StackTrace_StackFrame) GetLineNumber() int64 { - if x != nil { - return x.LineNumber - } - return 0 -} - -func (x *StackTrace_StackFrame) GetColumnNumber() int64 { - if x != nil { - return x.ColumnNumber - } - return 0 -} - -func (x *StackTrace_StackFrame) GetLoadModule() *Module { - if x != nil { - return x.LoadModule - } - return nil -} - -func (x *StackTrace_StackFrame) GetSourceVersion() *TruncatableString { - if x != nil { - return x.SourceVersion - } - return nil -} - -// A collection of stack frames, which can be truncated. -type StackTrace_StackFrames struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - // Stack frames in this call stack. - Frame []*StackTrace_StackFrame `protobuf:"bytes,1,rep,name=frame,proto3" json:"frame,omitempty"` - // The number of stack frames that were dropped because there - // were too many stack frames. - // If this value is 0, then no stack frames were dropped. - DroppedFramesCount int32 `protobuf:"varint,2,opt,name=dropped_frames_count,json=droppedFramesCount,proto3" json:"dropped_frames_count,omitempty"` -} - -func (x *StackTrace_StackFrames) Reset() { - *x = StackTrace_StackFrames{} - if protoimpl.UnsafeEnabled { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[17] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *StackTrace_StackFrames) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*StackTrace_StackFrames) ProtoMessage() {} - -func (x *StackTrace_StackFrames) ProtoReflect() protoreflect.Message { - mi := &file_opencensus_proto_trace_v1_trace_proto_msgTypes[17] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use StackTrace_StackFrames.ProtoReflect.Descriptor instead. -func (*StackTrace_StackFrames) Descriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_proto_rawDescGZIP(), []int{3, 1} -} - -func (x *StackTrace_StackFrames) GetFrame() []*StackTrace_StackFrame { - if x != nil { - return x.Frame - } - return nil -} - -func (x *StackTrace_StackFrames) GetDroppedFramesCount() int32 { - if x != nil { - return x.DroppedFramesCount - } - return 0 -} - -var File_opencensus_proto_trace_v1_trace_proto protoreflect.FileDescriptor - -var file_opencensus_proto_trace_v1_trace_proto_rawDesc = []byte{ - 0x0a, 0x25, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2f, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x2f, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2f, 0x76, 0x31, 0x2f, 0x74, 0x72, 0x61, 0x63, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x19, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, - 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, - 0x76, 0x31, 0x1a, 0x2b, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2f, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x2f, 0x76, 0x31, - 0x2f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, - 0x1f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, - 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x1a, 0x1e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2f, 0x77, 0x72, 0x61, 0x70, 0x70, 0x65, 0x72, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x22, 0x91, 0x16, 0x0a, 0x04, 0x53, 0x70, 0x61, 0x6e, 0x12, 0x19, 0x0a, 0x08, 0x74, 0x72, 0x61, - 0x63, 0x65, 0x5f, 0x69, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x07, 0x74, 0x72, 0x61, - 0x63, 0x65, 0x49, 0x64, 0x12, 0x17, 0x0a, 0x07, 0x73, 0x70, 0x61, 0x6e, 0x5f, 0x69, 0x64, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x06, 0x73, 0x70, 0x61, 0x6e, 0x49, 0x64, 0x12, 0x4a, 0x0a, - 0x0a, 0x74, 0x72, 0x61, 0x63, 0x65, 0x73, 0x74, 0x61, 0x74, 0x65, 0x18, 0x0f, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x2a, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x53, 0x70, - 0x61, 0x6e, 0x2e, 0x54, 0x72, 0x61, 0x63, 0x65, 0x73, 0x74, 0x61, 0x74, 0x65, 0x52, 0x0a, 0x74, - 0x72, 0x61, 0x63, 0x65, 0x73, 0x74, 0x61, 0x74, 0x65, 0x12, 0x24, 0x0a, 0x0e, 0x70, 0x61, 0x72, - 0x65, 0x6e, 0x74, 0x5f, 0x73, 0x70, 0x61, 0x6e, 0x5f, 0x69, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, - 0x0c, 0x52, 0x0c, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x53, 0x70, 0x61, 0x6e, 0x49, 0x64, 0x12, - 0x40, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, - 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x54, 0x72, 0x75, 0x6e, 0x63, 0x61, - 0x74, 0x61, 0x62, 0x6c, 0x65, 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x52, 0x04, 0x6e, 0x61, 0x6d, - 0x65, 0x12, 0x3c, 0x0a, 0x04, 0x6b, 0x69, 0x6e, 0x64, 0x18, 0x0e, 0x20, 0x01, 0x28, 0x0e, 0x32, - 0x28, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x53, 0x70, 0x61, 0x6e, - 0x2e, 0x53, 0x70, 0x61, 0x6e, 0x4b, 0x69, 0x6e, 0x64, 0x52, 0x04, 0x6b, 0x69, 0x6e, 0x64, 0x12, - 0x39, 0x0a, 0x0a, 0x73, 0x74, 0x61, 0x72, 0x74, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x05, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x52, - 0x09, 0x73, 0x74, 0x61, 0x72, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x12, 0x35, 0x0a, 0x08, 0x65, 0x6e, - 0x64, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, - 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x52, 0x07, 0x65, 0x6e, 0x64, 0x54, 0x69, 0x6d, - 0x65, 0x12, 0x4a, 0x0a, 0x0a, 0x61, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x73, 0x18, - 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, - 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, - 0x31, 0x2e, 0x53, 0x70, 0x61, 0x6e, 0x2e, 0x41, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, - 0x73, 0x52, 0x0a, 0x61, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x73, 0x12, 0x46, 0x0a, - 0x0b, 0x73, 0x74, 0x61, 0x63, 0x6b, 0x5f, 0x74, 0x72, 0x61, 0x63, 0x65, 0x18, 0x08, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x53, - 0x74, 0x61, 0x63, 0x6b, 0x54, 0x72, 0x61, 0x63, 0x65, 0x52, 0x0a, 0x73, 0x74, 0x61, 0x63, 0x6b, - 0x54, 0x72, 0x61, 0x63, 0x65, 0x12, 0x4b, 0x0a, 0x0b, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x65, 0x76, - 0x65, 0x6e, 0x74, 0x73, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x6f, 0x70, 0x65, - 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, - 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x53, 0x70, 0x61, 0x6e, 0x2e, 0x54, 0x69, 0x6d, 0x65, - 0x45, 0x76, 0x65, 0x6e, 0x74, 0x73, 0x52, 0x0a, 0x74, 0x69, 0x6d, 0x65, 0x45, 0x76, 0x65, 0x6e, - 0x74, 0x73, 0x12, 0x3b, 0x0a, 0x05, 0x6c, 0x69, 0x6e, 0x6b, 0x73, 0x18, 0x0a, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x25, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x53, 0x70, - 0x61, 0x6e, 0x2e, 0x4c, 0x69, 0x6e, 0x6b, 0x73, 0x52, 0x05, 0x6c, 0x69, 0x6e, 0x6b, 0x73, 0x12, - 0x39, 0x0a, 0x06, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x21, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x53, 0x74, 0x61, 0x74, - 0x75, 0x73, 0x52, 0x06, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x12, 0x42, 0x0a, 0x08, 0x72, 0x65, - 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x18, 0x10, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x26, 0x2e, 0x6f, - 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, - 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x52, 0x65, 0x73, 0x6f, - 0x75, 0x72, 0x63, 0x65, 0x52, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x12, 0x58, - 0x0a, 0x1b, 0x73, 0x61, 0x6d, 0x65, 0x5f, 0x70, 0x72, 0x6f, 0x63, 0x65, 0x73, 0x73, 0x5f, 0x61, - 0x73, 0x5f, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x5f, 0x73, 0x70, 0x61, 0x6e, 0x18, 0x0c, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, - 0x17, 0x73, 0x61, 0x6d, 0x65, 0x50, 0x72, 0x6f, 0x63, 0x65, 0x73, 0x73, 0x41, 0x73, 0x50, 0x61, - 0x72, 0x65, 0x6e, 0x74, 0x53, 0x70, 0x61, 0x6e, 0x12, 0x46, 0x0a, 0x10, 0x63, 0x68, 0x69, 0x6c, - 0x64, 0x5f, 0x73, 0x70, 0x61, 0x6e, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x0d, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, - 0x52, 0x0e, 0x63, 0x68, 0x69, 0x6c, 0x64, 0x53, 0x70, 0x61, 0x6e, 0x43, 0x6f, 0x75, 0x6e, 0x74, - 0x1a, 0x89, 0x01, 0x0a, 0x0a, 0x54, 0x72, 0x61, 0x63, 0x65, 0x73, 0x74, 0x61, 0x74, 0x65, 0x12, - 0x4a, 0x0a, 0x07, 0x65, 0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, - 0x32, 0x30, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x53, 0x70, 0x61, - 0x6e, 0x2e, 0x54, 0x72, 0x61, 0x63, 0x65, 0x73, 0x74, 0x61, 0x74, 0x65, 0x2e, 0x45, 0x6e, 0x74, - 0x72, 0x79, 0x52, 0x07, 0x65, 0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, 0x1a, 0x2f, 0x0a, 0x05, 0x45, - 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x1a, 0x95, 0x02, 0x0a, - 0x0a, 0x41, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x73, 0x12, 0x61, 0x0a, 0x0d, 0x61, - 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x5f, 0x6d, 0x61, 0x70, 0x18, 0x01, 0x20, 0x03, - 0x28, 0x0b, 0x32, 0x3c, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x53, - 0x70, 0x61, 0x6e, 0x2e, 0x41, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x73, 0x2e, 0x41, - 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x4d, 0x61, 0x70, 0x45, 0x6e, 0x74, 0x72, 0x79, - 0x52, 0x0c, 0x61, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x4d, 0x61, 0x70, 0x12, 0x38, - 0x0a, 0x18, 0x64, 0x72, 0x6f, 0x70, 0x70, 0x65, 0x64, 0x5f, 0x61, 0x74, 0x74, 0x72, 0x69, 0x62, - 0x75, 0x74, 0x65, 0x73, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, - 0x52, 0x16, 0x64, 0x72, 0x6f, 0x70, 0x70, 0x65, 0x64, 0x41, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, - 0x74, 0x65, 0x73, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x1a, 0x6a, 0x0a, 0x11, 0x41, 0x74, 0x74, 0x72, - 0x69, 0x62, 0x75, 0x74, 0x65, 0x4d, 0x61, 0x70, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, - 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, - 0x3f, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x29, - 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x41, 0x74, 0x74, 0x72, 0x69, - 0x62, 0x75, 0x74, 0x65, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, - 0x3a, 0x02, 0x38, 0x01, 0x1a, 0xa4, 0x05, 0x0a, 0x09, 0x54, 0x69, 0x6d, 0x65, 0x45, 0x76, 0x65, - 0x6e, 0x74, 0x12, 0x2e, 0x0a, 0x04, 0x74, 0x69, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x52, 0x04, 0x74, 0x69, - 0x6d, 0x65, 0x12, 0x56, 0x0a, 0x0a, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x34, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, - 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, - 0x76, 0x31, 0x2e, 0x53, 0x70, 0x61, 0x6e, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x45, 0x76, 0x65, 0x6e, - 0x74, 0x2e, 0x41, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x48, 0x00, 0x52, 0x0a, - 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x5d, 0x0a, 0x0d, 0x6d, 0x65, - 0x73, 0x73, 0x61, 0x67, 0x65, 0x5f, 0x65, 0x76, 0x65, 0x6e, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x36, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x53, 0x70, - 0x61, 0x6e, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x45, 0x76, 0x65, 0x6e, 0x74, 0x2e, 0x4d, 0x65, 0x73, - 0x73, 0x61, 0x67, 0x65, 0x45, 0x76, 0x65, 0x6e, 0x74, 0x48, 0x00, 0x52, 0x0c, 0x6d, 0x65, 0x73, - 0x73, 0x61, 0x67, 0x65, 0x45, 0x76, 0x65, 0x6e, 0x74, 0x1a, 0xa8, 0x01, 0x0a, 0x0a, 0x41, 0x6e, - 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4e, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, - 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x54, 0x72, 0x75, 0x6e, 0x63, 0x61, - 0x74, 0x61, 0x62, 0x6c, 0x65, 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x52, 0x0b, 0x64, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4a, 0x0a, 0x0a, 0x61, 0x74, 0x74, 0x72, - 0x69, 0x62, 0x75, 0x74, 0x65, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x6f, - 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, - 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x53, 0x70, 0x61, 0x6e, 0x2e, 0x41, 0x74, - 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x73, 0x52, 0x0a, 0x61, 0x74, 0x74, 0x72, 0x69, 0x62, - 0x75, 0x74, 0x65, 0x73, 0x1a, 0xfb, 0x01, 0x0a, 0x0c, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, - 0x45, 0x76, 0x65, 0x6e, 0x74, 0x12, 0x4f, 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x0e, 0x32, 0x3b, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, - 0x53, 0x70, 0x61, 0x6e, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x45, 0x76, 0x65, 0x6e, 0x74, 0x2e, 0x4d, - 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x45, 0x76, 0x65, 0x6e, 0x74, 0x2e, 0x54, 0x79, 0x70, 0x65, - 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, 0x0e, 0x0a, 0x02, 0x69, 0x64, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x04, 0x52, 0x02, 0x69, 0x64, 0x12, 0x2b, 0x0a, 0x11, 0x75, 0x6e, 0x63, 0x6f, 0x6d, 0x70, - 0x72, 0x65, 0x73, 0x73, 0x65, 0x64, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, - 0x04, 0x52, 0x10, 0x75, 0x6e, 0x63, 0x6f, 0x6d, 0x70, 0x72, 0x65, 0x73, 0x73, 0x65, 0x64, 0x53, - 0x69, 0x7a, 0x65, 0x12, 0x27, 0x0a, 0x0f, 0x63, 0x6f, 0x6d, 0x70, 0x72, 0x65, 0x73, 0x73, 0x65, - 0x64, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x04, 0x52, 0x0e, 0x63, 0x6f, - 0x6d, 0x70, 0x72, 0x65, 0x73, 0x73, 0x65, 0x64, 0x53, 0x69, 0x7a, 0x65, 0x22, 0x34, 0x0a, 0x04, - 0x54, 0x79, 0x70, 0x65, 0x12, 0x14, 0x0a, 0x10, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x53, - 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x08, 0x0a, 0x04, 0x53, 0x45, - 0x4e, 0x54, 0x10, 0x01, 0x12, 0x0c, 0x0a, 0x08, 0x52, 0x45, 0x43, 0x45, 0x49, 0x56, 0x45, 0x44, - 0x10, 0x02, 0x42, 0x07, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x1a, 0xd3, 0x01, 0x0a, 0x0a, - 0x54, 0x69, 0x6d, 0x65, 0x45, 0x76, 0x65, 0x6e, 0x74, 0x73, 0x12, 0x48, 0x0a, 0x0a, 0x74, 0x69, - 0x6d, 0x65, 0x5f, 0x65, 0x76, 0x65, 0x6e, 0x74, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x29, - 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x53, 0x70, 0x61, 0x6e, 0x2e, - 0x54, 0x69, 0x6d, 0x65, 0x45, 0x76, 0x65, 0x6e, 0x74, 0x52, 0x09, 0x74, 0x69, 0x6d, 0x65, 0x45, - 0x76, 0x65, 0x6e, 0x74, 0x12, 0x3a, 0x0a, 0x19, 0x64, 0x72, 0x6f, 0x70, 0x70, 0x65, 0x64, 0x5f, - 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x5f, 0x63, 0x6f, 0x75, 0x6e, - 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x17, 0x64, 0x72, 0x6f, 0x70, 0x70, 0x65, 0x64, - 0x41, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x43, 0x6f, 0x75, 0x6e, 0x74, - 0x12, 0x3f, 0x0a, 0x1c, 0x64, 0x72, 0x6f, 0x70, 0x70, 0x65, 0x64, 0x5f, 0x6d, 0x65, 0x73, 0x73, - 0x61, 0x67, 0x65, 0x5f, 0x65, 0x76, 0x65, 0x6e, 0x74, 0x73, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, - 0x18, 0x03, 0x20, 0x01, 0x28, 0x05, 0x52, 0x19, 0x64, 0x72, 0x6f, 0x70, 0x70, 0x65, 0x64, 0x4d, - 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x45, 0x76, 0x65, 0x6e, 0x74, 0x73, 0x43, 0x6f, 0x75, 0x6e, - 0x74, 0x1a, 0xde, 0x02, 0x0a, 0x04, 0x4c, 0x69, 0x6e, 0x6b, 0x12, 0x19, 0x0a, 0x08, 0x74, 0x72, - 0x61, 0x63, 0x65, 0x5f, 0x69, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x07, 0x74, 0x72, - 0x61, 0x63, 0x65, 0x49, 0x64, 0x12, 0x17, 0x0a, 0x07, 0x73, 0x70, 0x61, 0x6e, 0x5f, 0x69, 0x64, - 0x18, 0x02, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x06, 0x73, 0x70, 0x61, 0x6e, 0x49, 0x64, 0x12, 0x3d, - 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x29, 0x2e, 0x6f, - 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, - 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x53, 0x70, 0x61, 0x6e, 0x2e, 0x4c, 0x69, - 0x6e, 0x6b, 0x2e, 0x54, 0x79, 0x70, 0x65, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, 0x4a, 0x0a, - 0x0a, 0x61, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x2a, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x53, 0x70, - 0x61, 0x6e, 0x2e, 0x41, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x73, 0x52, 0x0a, 0x61, - 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x73, 0x12, 0x4a, 0x0a, 0x0a, 0x74, 0x72, 0x61, - 0x63, 0x65, 0x73, 0x74, 0x61, 0x74, 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, - 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x53, 0x70, 0x61, 0x6e, 0x2e, 0x54, - 0x72, 0x61, 0x63, 0x65, 0x73, 0x74, 0x61, 0x74, 0x65, 0x52, 0x0a, 0x74, 0x72, 0x61, 0x63, 0x65, - 0x73, 0x74, 0x61, 0x74, 0x65, 0x22, 0x4b, 0x0a, 0x04, 0x54, 0x79, 0x70, 0x65, 0x12, 0x14, 0x0a, - 0x10, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, - 0x44, 0x10, 0x00, 0x12, 0x15, 0x0a, 0x11, 0x43, 0x48, 0x49, 0x4c, 0x44, 0x5f, 0x4c, 0x49, 0x4e, - 0x4b, 0x45, 0x44, 0x5f, 0x53, 0x50, 0x41, 0x4e, 0x10, 0x01, 0x12, 0x16, 0x0a, 0x12, 0x50, 0x41, - 0x52, 0x45, 0x4e, 0x54, 0x5f, 0x4c, 0x49, 0x4e, 0x4b, 0x45, 0x44, 0x5f, 0x53, 0x50, 0x41, 0x4e, - 0x10, 0x02, 0x1a, 0x71, 0x0a, 0x05, 0x4c, 0x69, 0x6e, 0x6b, 0x73, 0x12, 0x38, 0x0a, 0x04, 0x6c, - 0x69, 0x6e, 0x6b, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x6f, 0x70, 0x65, 0x6e, - 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, - 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x53, 0x70, 0x61, 0x6e, 0x2e, 0x4c, 0x69, 0x6e, 0x6b, 0x52, - 0x04, 0x6c, 0x69, 0x6e, 0x6b, 0x12, 0x2e, 0x0a, 0x13, 0x64, 0x72, 0x6f, 0x70, 0x70, 0x65, 0x64, - 0x5f, 0x6c, 0x69, 0x6e, 0x6b, 0x73, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x05, 0x52, 0x11, 0x64, 0x72, 0x6f, 0x70, 0x70, 0x65, 0x64, 0x4c, 0x69, 0x6e, 0x6b, 0x73, - 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x22, 0x3d, 0x0a, 0x08, 0x53, 0x70, 0x61, 0x6e, 0x4b, 0x69, 0x6e, - 0x64, 0x12, 0x19, 0x0a, 0x15, 0x53, 0x50, 0x41, 0x4e, 0x5f, 0x4b, 0x49, 0x4e, 0x44, 0x5f, 0x55, - 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x0a, 0x0a, 0x06, - 0x53, 0x45, 0x52, 0x56, 0x45, 0x52, 0x10, 0x01, 0x12, 0x0a, 0x0a, 0x06, 0x43, 0x4c, 0x49, 0x45, - 0x4e, 0x54, 0x10, 0x02, 0x22, 0x36, 0x0a, 0x06, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x12, 0x12, - 0x0a, 0x04, 0x63, 0x6f, 0x64, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x04, 0x63, 0x6f, - 0x64, 0x65, 0x12, 0x18, 0x0a, 0x07, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x18, 0x02, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x07, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x22, 0xd1, 0x01, 0x0a, - 0x0e, 0x41, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, - 0x51, 0x0a, 0x0c, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, - 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, - 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, - 0x31, 0x2e, 0x54, 0x72, 0x75, 0x6e, 0x63, 0x61, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x53, 0x74, 0x72, - 0x69, 0x6e, 0x67, 0x48, 0x00, 0x52, 0x0b, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x56, 0x61, 0x6c, - 0x75, 0x65, 0x12, 0x1d, 0x0a, 0x09, 0x69, 0x6e, 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x08, 0x69, 0x6e, 0x74, 0x56, 0x61, 0x6c, 0x75, - 0x65, 0x12, 0x1f, 0x0a, 0x0a, 0x62, 0x6f, 0x6f, 0x6c, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, - 0x03, 0x20, 0x01, 0x28, 0x08, 0x48, 0x00, 0x52, 0x09, 0x62, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, - 0x75, 0x65, 0x12, 0x23, 0x0a, 0x0c, 0x64, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x5f, 0x76, 0x61, 0x6c, - 0x75, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x01, 0x48, 0x00, 0x52, 0x0b, 0x64, 0x6f, 0x75, 0x62, - 0x6c, 0x65, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x07, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, - 0x22, 0x8b, 0x06, 0x0a, 0x0a, 0x53, 0x74, 0x61, 0x63, 0x6b, 0x54, 0x72, 0x61, 0x63, 0x65, 0x12, - 0x54, 0x0a, 0x0c, 0x73, 0x74, 0x61, 0x63, 0x6b, 0x5f, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x73, 0x18, - 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x31, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, - 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, - 0x31, 0x2e, 0x53, 0x74, 0x61, 0x63, 0x6b, 0x54, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x53, 0x74, 0x61, - 0x63, 0x6b, 0x46, 0x72, 0x61, 0x6d, 0x65, 0x73, 0x52, 0x0b, 0x73, 0x74, 0x61, 0x63, 0x6b, 0x46, - 0x72, 0x61, 0x6d, 0x65, 0x73, 0x12, 0x2d, 0x0a, 0x13, 0x73, 0x74, 0x61, 0x63, 0x6b, 0x5f, 0x74, - 0x72, 0x61, 0x63, 0x65, 0x5f, 0x68, 0x61, 0x73, 0x68, 0x5f, 0x69, 0x64, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x04, 0x52, 0x10, 0x73, 0x74, 0x61, 0x63, 0x6b, 0x54, 0x72, 0x61, 0x63, 0x65, 0x48, 0x61, - 0x73, 0x68, 0x49, 0x64, 0x1a, 0xed, 0x03, 0x0a, 0x0a, 0x53, 0x74, 0x61, 0x63, 0x6b, 0x46, 0x72, - 0x61, 0x6d, 0x65, 0x12, 0x51, 0x0a, 0x0d, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x5f, - 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x6f, 0x70, 0x65, - 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, - 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x54, 0x72, 0x75, 0x6e, 0x63, 0x61, 0x74, 0x61, 0x62, - 0x6c, 0x65, 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x52, 0x0c, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, - 0x6f, 0x6e, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x62, 0x0a, 0x16, 0x6f, 0x72, 0x69, 0x67, 0x69, 0x6e, - 0x61, 0x6c, 0x5f, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6e, 0x61, 0x6d, 0x65, - 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, - 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, - 0x76, 0x31, 0x2e, 0x54, 0x72, 0x75, 0x6e, 0x63, 0x61, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x53, 0x74, - 0x72, 0x69, 0x6e, 0x67, 0x52, 0x14, 0x6f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x61, 0x6c, 0x46, 0x75, - 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x49, 0x0a, 0x09, 0x66, 0x69, - 0x6c, 0x65, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, - 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x54, 0x72, 0x75, 0x6e, 0x63, 0x61, - 0x74, 0x61, 0x62, 0x6c, 0x65, 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x52, 0x08, 0x66, 0x69, 0x6c, - 0x65, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x1f, 0x0a, 0x0b, 0x6c, 0x69, 0x6e, 0x65, 0x5f, 0x6e, 0x75, - 0x6d, 0x62, 0x65, 0x72, 0x18, 0x04, 0x20, 0x01, 0x28, 0x03, 0x52, 0x0a, 0x6c, 0x69, 0x6e, 0x65, - 0x4e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x12, 0x23, 0x0a, 0x0d, 0x63, 0x6f, 0x6c, 0x75, 0x6d, 0x6e, - 0x5f, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x18, 0x05, 0x20, 0x01, 0x28, 0x03, 0x52, 0x0c, 0x63, - 0x6f, 0x6c, 0x75, 0x6d, 0x6e, 0x4e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x12, 0x42, 0x0a, 0x0b, 0x6c, - 0x6f, 0x61, 0x64, 0x5f, 0x6d, 0x6f, 0x64, 0x75, 0x6c, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x21, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x4d, 0x6f, 0x64, - 0x75, 0x6c, 0x65, 0x52, 0x0a, 0x6c, 0x6f, 0x61, 0x64, 0x4d, 0x6f, 0x64, 0x75, 0x6c, 0x65, 0x12, - 0x53, 0x0a, 0x0e, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, - 0x6e, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, - 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, - 0x2e, 0x76, 0x31, 0x2e, 0x54, 0x72, 0x75, 0x6e, 0x63, 0x61, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x53, - 0x74, 0x72, 0x69, 0x6e, 0x67, 0x52, 0x0d, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x56, 0x65, 0x72, - 0x73, 0x69, 0x6f, 0x6e, 0x1a, 0x87, 0x01, 0x0a, 0x0b, 0x53, 0x74, 0x61, 0x63, 0x6b, 0x46, 0x72, - 0x61, 0x6d, 0x65, 0x73, 0x12, 0x46, 0x0a, 0x05, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, - 0x03, 0x28, 0x0b, 0x32, 0x30, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, - 0x53, 0x74, 0x61, 0x63, 0x6b, 0x54, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x53, 0x74, 0x61, 0x63, 0x6b, - 0x46, 0x72, 0x61, 0x6d, 0x65, 0x52, 0x05, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x12, 0x30, 0x0a, 0x14, - 0x64, 0x72, 0x6f, 0x70, 0x70, 0x65, 0x64, 0x5f, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x73, 0x5f, 0x63, - 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x12, 0x64, 0x72, 0x6f, 0x70, - 0x70, 0x65, 0x64, 0x46, 0x72, 0x61, 0x6d, 0x65, 0x73, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x22, 0x97, - 0x01, 0x0a, 0x06, 0x4d, 0x6f, 0x64, 0x75, 0x6c, 0x65, 0x12, 0x44, 0x0a, 0x06, 0x6d, 0x6f, 0x64, - 0x75, 0x6c, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x6f, 0x70, 0x65, 0x6e, - 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, - 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x54, 0x72, 0x75, 0x6e, 0x63, 0x61, 0x74, 0x61, 0x62, 0x6c, - 0x65, 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x52, 0x06, 0x6d, 0x6f, 0x64, 0x75, 0x6c, 0x65, 0x12, - 0x47, 0x0a, 0x08, 0x62, 0x75, 0x69, 0x6c, 0x64, 0x5f, 0x69, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x2c, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x54, 0x72, - 0x75, 0x6e, 0x63, 0x61, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x52, - 0x07, 0x62, 0x75, 0x69, 0x6c, 0x64, 0x49, 0x64, 0x22, 0x5b, 0x0a, 0x11, 0x54, 0x72, 0x75, 0x6e, - 0x63, 0x61, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x12, 0x14, 0x0a, - 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, - 0x6c, 0x75, 0x65, 0x12, 0x30, 0x0a, 0x14, 0x74, 0x72, 0x75, 0x6e, 0x63, 0x61, 0x74, 0x65, 0x64, - 0x5f, 0x62, 0x79, 0x74, 0x65, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x05, 0x52, 0x12, 0x74, 0x72, 0x75, 0x6e, 0x63, 0x61, 0x74, 0x65, 0x64, 0x42, 0x79, 0x74, 0x65, - 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x42, 0x8f, 0x01, 0x0a, 0x1c, 0x69, 0x6f, 0x2e, 0x6f, 0x70, 0x65, - 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, - 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x42, 0x0a, 0x54, 0x72, 0x61, 0x63, 0x65, 0x50, 0x72, 0x6f, - 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x42, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, 0x2e, 0x63, 0x6f, 0x6d, - 0x2f, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2d, 0x69, 0x6e, 0x73, 0x74, 0x72, 0x75, 0x6d, 0x65, - 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2f, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, - 0x75, 0x73, 0x2d, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x65, 0x6e, 0x2d, 0x67, 0x6f, 0x2f, - 0x74, 0x72, 0x61, 0x63, 0x65, 0x2f, 0x76, 0x31, 0xea, 0x02, 0x1c, 0x4f, 0x70, 0x65, 0x6e, 0x43, - 0x65, 0x6e, 0x73, 0x75, 0x73, 0x3a, 0x3a, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x3a, 0x3a, 0x54, 0x72, - 0x61, 0x63, 0x65, 0x3a, 0x3a, 0x56, 0x31, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, -} - -var ( - file_opencensus_proto_trace_v1_trace_proto_rawDescOnce sync.Once - file_opencensus_proto_trace_v1_trace_proto_rawDescData = file_opencensus_proto_trace_v1_trace_proto_rawDesc -) - -func file_opencensus_proto_trace_v1_trace_proto_rawDescGZIP() []byte { - file_opencensus_proto_trace_v1_trace_proto_rawDescOnce.Do(func() { - file_opencensus_proto_trace_v1_trace_proto_rawDescData = protoimpl.X.CompressGZIP(file_opencensus_proto_trace_v1_trace_proto_rawDescData) - }) - return file_opencensus_proto_trace_v1_trace_proto_rawDescData -} - -var file_opencensus_proto_trace_v1_trace_proto_enumTypes = make([]protoimpl.EnumInfo, 3) -var file_opencensus_proto_trace_v1_trace_proto_msgTypes = make([]protoimpl.MessageInfo, 18) -var file_opencensus_proto_trace_v1_trace_proto_goTypes = []interface{}{ - (Span_SpanKind)(0), // 0: opencensus.proto.trace.v1.Span.SpanKind - (Span_TimeEvent_MessageEvent_Type)(0), // 1: opencensus.proto.trace.v1.Span.TimeEvent.MessageEvent.Type - (Span_Link_Type)(0), // 2: opencensus.proto.trace.v1.Span.Link.Type - (*Span)(nil), // 3: opencensus.proto.trace.v1.Span - (*Status)(nil), // 4: opencensus.proto.trace.v1.Status - (*AttributeValue)(nil), // 5: opencensus.proto.trace.v1.AttributeValue - (*StackTrace)(nil), // 6: opencensus.proto.trace.v1.StackTrace - (*Module)(nil), // 7: opencensus.proto.trace.v1.Module - (*TruncatableString)(nil), // 8: opencensus.proto.trace.v1.TruncatableString - (*Span_Tracestate)(nil), // 9: opencensus.proto.trace.v1.Span.Tracestate - (*Span_Attributes)(nil), // 10: opencensus.proto.trace.v1.Span.Attributes - (*Span_TimeEvent)(nil), // 11: opencensus.proto.trace.v1.Span.TimeEvent - (*Span_TimeEvents)(nil), // 12: opencensus.proto.trace.v1.Span.TimeEvents - (*Span_Link)(nil), // 13: opencensus.proto.trace.v1.Span.Link - (*Span_Links)(nil), // 14: opencensus.proto.trace.v1.Span.Links - (*Span_Tracestate_Entry)(nil), // 15: opencensus.proto.trace.v1.Span.Tracestate.Entry - nil, // 16: opencensus.proto.trace.v1.Span.Attributes.AttributeMapEntry - (*Span_TimeEvent_Annotation)(nil), // 17: opencensus.proto.trace.v1.Span.TimeEvent.Annotation - (*Span_TimeEvent_MessageEvent)(nil), // 18: opencensus.proto.trace.v1.Span.TimeEvent.MessageEvent - (*StackTrace_StackFrame)(nil), // 19: opencensus.proto.trace.v1.StackTrace.StackFrame - (*StackTrace_StackFrames)(nil), // 20: opencensus.proto.trace.v1.StackTrace.StackFrames - (*timestamppb.Timestamp)(nil), // 21: google.protobuf.Timestamp - (*v1.Resource)(nil), // 22: opencensus.proto.resource.v1.Resource - (*wrapperspb.BoolValue)(nil), // 23: google.protobuf.BoolValue - (*wrapperspb.UInt32Value)(nil), // 24: google.protobuf.UInt32Value -} -var file_opencensus_proto_trace_v1_trace_proto_depIdxs = []int32{ - 9, // 0: opencensus.proto.trace.v1.Span.tracestate:type_name -> opencensus.proto.trace.v1.Span.Tracestate - 8, // 1: opencensus.proto.trace.v1.Span.name:type_name -> opencensus.proto.trace.v1.TruncatableString - 0, // 2: opencensus.proto.trace.v1.Span.kind:type_name -> opencensus.proto.trace.v1.Span.SpanKind - 21, // 3: opencensus.proto.trace.v1.Span.start_time:type_name -> google.protobuf.Timestamp - 21, // 4: opencensus.proto.trace.v1.Span.end_time:type_name -> google.protobuf.Timestamp - 10, // 5: opencensus.proto.trace.v1.Span.attributes:type_name -> opencensus.proto.trace.v1.Span.Attributes - 6, // 6: opencensus.proto.trace.v1.Span.stack_trace:type_name -> opencensus.proto.trace.v1.StackTrace - 12, // 7: opencensus.proto.trace.v1.Span.time_events:type_name -> opencensus.proto.trace.v1.Span.TimeEvents - 14, // 8: opencensus.proto.trace.v1.Span.links:type_name -> opencensus.proto.trace.v1.Span.Links - 4, // 9: opencensus.proto.trace.v1.Span.status:type_name -> opencensus.proto.trace.v1.Status - 22, // 10: opencensus.proto.trace.v1.Span.resource:type_name -> opencensus.proto.resource.v1.Resource - 23, // 11: opencensus.proto.trace.v1.Span.same_process_as_parent_span:type_name -> google.protobuf.BoolValue - 24, // 12: opencensus.proto.trace.v1.Span.child_span_count:type_name -> google.protobuf.UInt32Value - 8, // 13: opencensus.proto.trace.v1.AttributeValue.string_value:type_name -> opencensus.proto.trace.v1.TruncatableString - 20, // 14: opencensus.proto.trace.v1.StackTrace.stack_frames:type_name -> opencensus.proto.trace.v1.StackTrace.StackFrames - 8, // 15: opencensus.proto.trace.v1.Module.module:type_name -> opencensus.proto.trace.v1.TruncatableString - 8, // 16: opencensus.proto.trace.v1.Module.build_id:type_name -> opencensus.proto.trace.v1.TruncatableString - 15, // 17: opencensus.proto.trace.v1.Span.Tracestate.entries:type_name -> opencensus.proto.trace.v1.Span.Tracestate.Entry - 16, // 18: opencensus.proto.trace.v1.Span.Attributes.attribute_map:type_name -> opencensus.proto.trace.v1.Span.Attributes.AttributeMapEntry - 21, // 19: opencensus.proto.trace.v1.Span.TimeEvent.time:type_name -> google.protobuf.Timestamp - 17, // 20: opencensus.proto.trace.v1.Span.TimeEvent.annotation:type_name -> opencensus.proto.trace.v1.Span.TimeEvent.Annotation - 18, // 21: opencensus.proto.trace.v1.Span.TimeEvent.message_event:type_name -> opencensus.proto.trace.v1.Span.TimeEvent.MessageEvent - 11, // 22: opencensus.proto.trace.v1.Span.TimeEvents.time_event:type_name -> opencensus.proto.trace.v1.Span.TimeEvent - 2, // 23: opencensus.proto.trace.v1.Span.Link.type:type_name -> opencensus.proto.trace.v1.Span.Link.Type - 10, // 24: opencensus.proto.trace.v1.Span.Link.attributes:type_name -> opencensus.proto.trace.v1.Span.Attributes - 9, // 25: opencensus.proto.trace.v1.Span.Link.tracestate:type_name -> opencensus.proto.trace.v1.Span.Tracestate - 13, // 26: opencensus.proto.trace.v1.Span.Links.link:type_name -> opencensus.proto.trace.v1.Span.Link - 5, // 27: opencensus.proto.trace.v1.Span.Attributes.AttributeMapEntry.value:type_name -> opencensus.proto.trace.v1.AttributeValue - 8, // 28: opencensus.proto.trace.v1.Span.TimeEvent.Annotation.description:type_name -> opencensus.proto.trace.v1.TruncatableString - 10, // 29: opencensus.proto.trace.v1.Span.TimeEvent.Annotation.attributes:type_name -> opencensus.proto.trace.v1.Span.Attributes - 1, // 30: opencensus.proto.trace.v1.Span.TimeEvent.MessageEvent.type:type_name -> opencensus.proto.trace.v1.Span.TimeEvent.MessageEvent.Type - 8, // 31: opencensus.proto.trace.v1.StackTrace.StackFrame.function_name:type_name -> opencensus.proto.trace.v1.TruncatableString - 8, // 32: opencensus.proto.trace.v1.StackTrace.StackFrame.original_function_name:type_name -> opencensus.proto.trace.v1.TruncatableString - 8, // 33: opencensus.proto.trace.v1.StackTrace.StackFrame.file_name:type_name -> opencensus.proto.trace.v1.TruncatableString - 7, // 34: opencensus.proto.trace.v1.StackTrace.StackFrame.load_module:type_name -> opencensus.proto.trace.v1.Module - 8, // 35: opencensus.proto.trace.v1.StackTrace.StackFrame.source_version:type_name -> opencensus.proto.trace.v1.TruncatableString - 19, // 36: opencensus.proto.trace.v1.StackTrace.StackFrames.frame:type_name -> opencensus.proto.trace.v1.StackTrace.StackFrame - 37, // [37:37] is the sub-list for method output_type - 37, // [37:37] is the sub-list for method input_type - 37, // [37:37] is the sub-list for extension type_name - 37, // [37:37] is the sub-list for extension extendee - 0, // [0:37] is the sub-list for field type_name -} - -func init() { file_opencensus_proto_trace_v1_trace_proto_init() } -func file_opencensus_proto_trace_v1_trace_proto_init() { - if File_opencensus_proto_trace_v1_trace_proto != nil { - return - } - if !protoimpl.UnsafeEnabled { - file_opencensus_proto_trace_v1_trace_proto_msgTypes[0].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*Span); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_opencensus_proto_trace_v1_trace_proto_msgTypes[1].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*Status); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_opencensus_proto_trace_v1_trace_proto_msgTypes[2].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*AttributeValue); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_opencensus_proto_trace_v1_trace_proto_msgTypes[3].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*StackTrace); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_opencensus_proto_trace_v1_trace_proto_msgTypes[4].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*Module); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_opencensus_proto_trace_v1_trace_proto_msgTypes[5].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*TruncatableString); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_opencensus_proto_trace_v1_trace_proto_msgTypes[6].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*Span_Tracestate); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_opencensus_proto_trace_v1_trace_proto_msgTypes[7].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*Span_Attributes); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_opencensus_proto_trace_v1_trace_proto_msgTypes[8].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*Span_TimeEvent); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_opencensus_proto_trace_v1_trace_proto_msgTypes[9].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*Span_TimeEvents); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_opencensus_proto_trace_v1_trace_proto_msgTypes[10].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*Span_Link); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_opencensus_proto_trace_v1_trace_proto_msgTypes[11].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*Span_Links); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_opencensus_proto_trace_v1_trace_proto_msgTypes[12].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*Span_Tracestate_Entry); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_opencensus_proto_trace_v1_trace_proto_msgTypes[14].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*Span_TimeEvent_Annotation); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_opencensus_proto_trace_v1_trace_proto_msgTypes[15].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*Span_TimeEvent_MessageEvent); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_opencensus_proto_trace_v1_trace_proto_msgTypes[16].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*StackTrace_StackFrame); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_opencensus_proto_trace_v1_trace_proto_msgTypes[17].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*StackTrace_StackFrames); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } - file_opencensus_proto_trace_v1_trace_proto_msgTypes[2].OneofWrappers = []interface{}{ - (*AttributeValue_StringValue)(nil), - (*AttributeValue_IntValue)(nil), - (*AttributeValue_BoolValue)(nil), - (*AttributeValue_DoubleValue)(nil), - } - file_opencensus_proto_trace_v1_trace_proto_msgTypes[8].OneofWrappers = []interface{}{ - (*Span_TimeEvent_Annotation_)(nil), - (*Span_TimeEvent_MessageEvent_)(nil), - } - type x struct{} - out := protoimpl.TypeBuilder{ - File: protoimpl.DescBuilder{ - GoPackagePath: reflect.TypeOf(x{}).PkgPath(), - RawDescriptor: file_opencensus_proto_trace_v1_trace_proto_rawDesc, - NumEnums: 3, - NumMessages: 18, - NumExtensions: 0, - NumServices: 0, - }, - GoTypes: file_opencensus_proto_trace_v1_trace_proto_goTypes, - DependencyIndexes: file_opencensus_proto_trace_v1_trace_proto_depIdxs, - EnumInfos: file_opencensus_proto_trace_v1_trace_proto_enumTypes, - MessageInfos: file_opencensus_proto_trace_v1_trace_proto_msgTypes, - }.Build() - File_opencensus_proto_trace_v1_trace_proto = out.File - file_opencensus_proto_trace_v1_trace_proto_rawDesc = nil - file_opencensus_proto_trace_v1_trace_proto_goTypes = nil - file_opencensus_proto_trace_v1_trace_proto_depIdxs = nil -} diff --git a/vendor/github.com/census-instrumentation/opencensus-proto/gen-go/trace/v1/trace_config.pb.go b/vendor/github.com/census-instrumentation/opencensus-proto/gen-go/trace/v1/trace_config.pb.go deleted file mode 100644 index ee62b2e358edd..0000000000000 --- a/vendor/github.com/census-instrumentation/opencensus-proto/gen-go/trace/v1/trace_config.pb.go +++ /dev/null @@ -1,555 +0,0 @@ -// Copyright 2018, OpenCensus Authors -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -// Code generated by protoc-gen-go. DO NOT EDIT. -// versions: -// protoc-gen-go v1.26.0 -// protoc v3.17.3 -// source: opencensus/proto/trace/v1/trace_config.proto - -package v1 - -import ( - protoreflect "google.golang.org/protobuf/reflect/protoreflect" - protoimpl "google.golang.org/protobuf/runtime/protoimpl" - reflect "reflect" - sync "sync" -) - -const ( - // Verify that this generated code is sufficiently up-to-date. - _ = protoimpl.EnforceVersion(20 - protoimpl.MinVersion) - // Verify that runtime/protoimpl is sufficiently up-to-date. - _ = protoimpl.EnforceVersion(protoimpl.MaxVersion - 20) -) - -// How spans should be sampled: -// - Always off -// - Always on -// - Always follow the parent Span's decision (off if no parent). -type ConstantSampler_ConstantDecision int32 - -const ( - ConstantSampler_ALWAYS_OFF ConstantSampler_ConstantDecision = 0 - ConstantSampler_ALWAYS_ON ConstantSampler_ConstantDecision = 1 - ConstantSampler_ALWAYS_PARENT ConstantSampler_ConstantDecision = 2 -) - -// Enum value maps for ConstantSampler_ConstantDecision. -var ( - ConstantSampler_ConstantDecision_name = map[int32]string{ - 0: "ALWAYS_OFF", - 1: "ALWAYS_ON", - 2: "ALWAYS_PARENT", - } - ConstantSampler_ConstantDecision_value = map[string]int32{ - "ALWAYS_OFF": 0, - "ALWAYS_ON": 1, - "ALWAYS_PARENT": 2, - } -) - -func (x ConstantSampler_ConstantDecision) Enum() *ConstantSampler_ConstantDecision { - p := new(ConstantSampler_ConstantDecision) - *p = x - return p -} - -func (x ConstantSampler_ConstantDecision) String() string { - return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) -} - -func (ConstantSampler_ConstantDecision) Descriptor() protoreflect.EnumDescriptor { - return file_opencensus_proto_trace_v1_trace_config_proto_enumTypes[0].Descriptor() -} - -func (ConstantSampler_ConstantDecision) Type() protoreflect.EnumType { - return &file_opencensus_proto_trace_v1_trace_config_proto_enumTypes[0] -} - -func (x ConstantSampler_ConstantDecision) Number() protoreflect.EnumNumber { - return protoreflect.EnumNumber(x) -} - -// Deprecated: Use ConstantSampler_ConstantDecision.Descriptor instead. -func (ConstantSampler_ConstantDecision) EnumDescriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_config_proto_rawDescGZIP(), []int{2, 0} -} - -// Global configuration of the trace service. All fields must be specified, or -// the default (zero) values will be used for each type. -type TraceConfig struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - // The global default sampler used to make decisions on span sampling. - // - // Types that are assignable to Sampler: - // *TraceConfig_ProbabilitySampler - // *TraceConfig_ConstantSampler - // *TraceConfig_RateLimitingSampler - Sampler isTraceConfig_Sampler `protobuf_oneof:"sampler"` - // The global default max number of attributes per span. - MaxNumberOfAttributes int64 `protobuf:"varint,4,opt,name=max_number_of_attributes,json=maxNumberOfAttributes,proto3" json:"max_number_of_attributes,omitempty"` - // The global default max number of annotation events per span. - MaxNumberOfAnnotations int64 `protobuf:"varint,5,opt,name=max_number_of_annotations,json=maxNumberOfAnnotations,proto3" json:"max_number_of_annotations,omitempty"` - // The global default max number of message events per span. - MaxNumberOfMessageEvents int64 `protobuf:"varint,6,opt,name=max_number_of_message_events,json=maxNumberOfMessageEvents,proto3" json:"max_number_of_message_events,omitempty"` - // The global default max number of link entries per span. - MaxNumberOfLinks int64 `protobuf:"varint,7,opt,name=max_number_of_links,json=maxNumberOfLinks,proto3" json:"max_number_of_links,omitempty"` -} - -func (x *TraceConfig) Reset() { - *x = TraceConfig{} - if protoimpl.UnsafeEnabled { - mi := &file_opencensus_proto_trace_v1_trace_config_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *TraceConfig) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*TraceConfig) ProtoMessage() {} - -func (x *TraceConfig) ProtoReflect() protoreflect.Message { - mi := &file_opencensus_proto_trace_v1_trace_config_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use TraceConfig.ProtoReflect.Descriptor instead. -func (*TraceConfig) Descriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_config_proto_rawDescGZIP(), []int{0} -} - -func (m *TraceConfig) GetSampler() isTraceConfig_Sampler { - if m != nil { - return m.Sampler - } - return nil -} - -func (x *TraceConfig) GetProbabilitySampler() *ProbabilitySampler { - if x, ok := x.GetSampler().(*TraceConfig_ProbabilitySampler); ok { - return x.ProbabilitySampler - } - return nil -} - -func (x *TraceConfig) GetConstantSampler() *ConstantSampler { - if x, ok := x.GetSampler().(*TraceConfig_ConstantSampler); ok { - return x.ConstantSampler - } - return nil -} - -func (x *TraceConfig) GetRateLimitingSampler() *RateLimitingSampler { - if x, ok := x.GetSampler().(*TraceConfig_RateLimitingSampler); ok { - return x.RateLimitingSampler - } - return nil -} - -func (x *TraceConfig) GetMaxNumberOfAttributes() int64 { - if x != nil { - return x.MaxNumberOfAttributes - } - return 0 -} - -func (x *TraceConfig) GetMaxNumberOfAnnotations() int64 { - if x != nil { - return x.MaxNumberOfAnnotations - } - return 0 -} - -func (x *TraceConfig) GetMaxNumberOfMessageEvents() int64 { - if x != nil { - return x.MaxNumberOfMessageEvents - } - return 0 -} - -func (x *TraceConfig) GetMaxNumberOfLinks() int64 { - if x != nil { - return x.MaxNumberOfLinks - } - return 0 -} - -type isTraceConfig_Sampler interface { - isTraceConfig_Sampler() -} - -type TraceConfig_ProbabilitySampler struct { - ProbabilitySampler *ProbabilitySampler `protobuf:"bytes,1,opt,name=probability_sampler,json=probabilitySampler,proto3,oneof"` -} - -type TraceConfig_ConstantSampler struct { - ConstantSampler *ConstantSampler `protobuf:"bytes,2,opt,name=constant_sampler,json=constantSampler,proto3,oneof"` -} - -type TraceConfig_RateLimitingSampler struct { - RateLimitingSampler *RateLimitingSampler `protobuf:"bytes,3,opt,name=rate_limiting_sampler,json=rateLimitingSampler,proto3,oneof"` -} - -func (*TraceConfig_ProbabilitySampler) isTraceConfig_Sampler() {} - -func (*TraceConfig_ConstantSampler) isTraceConfig_Sampler() {} - -func (*TraceConfig_RateLimitingSampler) isTraceConfig_Sampler() {} - -// Sampler that tries to uniformly sample traces with a given probability. -// The probability of sampling a trace is equal to that of the specified probability. -type ProbabilitySampler struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - // The desired probability of sampling. Must be within [0.0, 1.0]. - SamplingProbability float64 `protobuf:"fixed64,1,opt,name=samplingProbability,proto3" json:"samplingProbability,omitempty"` -} - -func (x *ProbabilitySampler) Reset() { - *x = ProbabilitySampler{} - if protoimpl.UnsafeEnabled { - mi := &file_opencensus_proto_trace_v1_trace_config_proto_msgTypes[1] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *ProbabilitySampler) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*ProbabilitySampler) ProtoMessage() {} - -func (x *ProbabilitySampler) ProtoReflect() protoreflect.Message { - mi := &file_opencensus_proto_trace_v1_trace_config_proto_msgTypes[1] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use ProbabilitySampler.ProtoReflect.Descriptor instead. -func (*ProbabilitySampler) Descriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_config_proto_rawDescGZIP(), []int{1} -} - -func (x *ProbabilitySampler) GetSamplingProbability() float64 { - if x != nil { - return x.SamplingProbability - } - return 0 -} - -// Sampler that always makes a constant decision on span sampling. -type ConstantSampler struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - Decision ConstantSampler_ConstantDecision `protobuf:"varint,1,opt,name=decision,proto3,enum=opencensus.proto.trace.v1.ConstantSampler_ConstantDecision" json:"decision,omitempty"` -} - -func (x *ConstantSampler) Reset() { - *x = ConstantSampler{} - if protoimpl.UnsafeEnabled { - mi := &file_opencensus_proto_trace_v1_trace_config_proto_msgTypes[2] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *ConstantSampler) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*ConstantSampler) ProtoMessage() {} - -func (x *ConstantSampler) ProtoReflect() protoreflect.Message { - mi := &file_opencensus_proto_trace_v1_trace_config_proto_msgTypes[2] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use ConstantSampler.ProtoReflect.Descriptor instead. -func (*ConstantSampler) Descriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_config_proto_rawDescGZIP(), []int{2} -} - -func (x *ConstantSampler) GetDecision() ConstantSampler_ConstantDecision { - if x != nil { - return x.Decision - } - return ConstantSampler_ALWAYS_OFF -} - -// Sampler that tries to sample with a rate per time window. -type RateLimitingSampler struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - // Rate per second. - Qps int64 `protobuf:"varint,1,opt,name=qps,proto3" json:"qps,omitempty"` -} - -func (x *RateLimitingSampler) Reset() { - *x = RateLimitingSampler{} - if protoimpl.UnsafeEnabled { - mi := &file_opencensus_proto_trace_v1_trace_config_proto_msgTypes[3] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *RateLimitingSampler) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*RateLimitingSampler) ProtoMessage() {} - -func (x *RateLimitingSampler) ProtoReflect() protoreflect.Message { - mi := &file_opencensus_proto_trace_v1_trace_config_proto_msgTypes[3] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use RateLimitingSampler.ProtoReflect.Descriptor instead. -func (*RateLimitingSampler) Descriptor() ([]byte, []int) { - return file_opencensus_proto_trace_v1_trace_config_proto_rawDescGZIP(), []int{3} -} - -func (x *RateLimitingSampler) GetQps() int64 { - if x != nil { - return x.Qps - } - return 0 -} - -var File_opencensus_proto_trace_v1_trace_config_proto protoreflect.FileDescriptor - -var file_opencensus_proto_trace_v1_trace_config_proto_rawDesc = []byte{ - 0x0a, 0x2c, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2f, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x2f, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2f, 0x76, 0x31, 0x2f, 0x74, 0x72, 0x61, 0x63, - 0x65, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x19, - 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x22, 0x9c, 0x04, 0x0a, 0x0b, 0x54, 0x72, - 0x61, 0x63, 0x65, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x60, 0x0a, 0x13, 0x70, 0x72, 0x6f, - 0x62, 0x61, 0x62, 0x69, 0x6c, 0x69, 0x74, 0x79, 0x5f, 0x73, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x72, - 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2d, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, - 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, - 0x76, 0x31, 0x2e, 0x50, 0x72, 0x6f, 0x62, 0x61, 0x62, 0x69, 0x6c, 0x69, 0x74, 0x79, 0x53, 0x61, - 0x6d, 0x70, 0x6c, 0x65, 0x72, 0x48, 0x00, 0x52, 0x12, 0x70, 0x72, 0x6f, 0x62, 0x61, 0x62, 0x69, - 0x6c, 0x69, 0x74, 0x79, 0x53, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x72, 0x12, 0x57, 0x0a, 0x10, 0x63, - 0x6f, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x74, 0x5f, 0x73, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x72, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, - 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, - 0x31, 0x2e, 0x43, 0x6f, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x74, 0x53, 0x61, 0x6d, 0x70, 0x6c, 0x65, - 0x72, 0x48, 0x00, 0x52, 0x0f, 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x74, 0x53, 0x61, 0x6d, - 0x70, 0x6c, 0x65, 0x72, 0x12, 0x64, 0x0a, 0x15, 0x72, 0x61, 0x74, 0x65, 0x5f, 0x6c, 0x69, 0x6d, - 0x69, 0x74, 0x69, 0x6e, 0x67, 0x5f, 0x73, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x72, 0x18, 0x03, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x2e, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x2e, - 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x69, 0x6e, 0x67, 0x53, 0x61, 0x6d, 0x70, - 0x6c, 0x65, 0x72, 0x48, 0x00, 0x52, 0x13, 0x72, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, - 0x69, 0x6e, 0x67, 0x53, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x72, 0x12, 0x37, 0x0a, 0x18, 0x6d, 0x61, - 0x78, 0x5f, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x5f, 0x6f, 0x66, 0x5f, 0x61, 0x74, 0x74, 0x72, - 0x69, 0x62, 0x75, 0x74, 0x65, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, 0x03, 0x52, 0x15, 0x6d, 0x61, - 0x78, 0x4e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x4f, 0x66, 0x41, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, - 0x74, 0x65, 0x73, 0x12, 0x39, 0x0a, 0x19, 0x6d, 0x61, 0x78, 0x5f, 0x6e, 0x75, 0x6d, 0x62, 0x65, - 0x72, 0x5f, 0x6f, 0x66, 0x5f, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, - 0x18, 0x05, 0x20, 0x01, 0x28, 0x03, 0x52, 0x16, 0x6d, 0x61, 0x78, 0x4e, 0x75, 0x6d, 0x62, 0x65, - 0x72, 0x4f, 0x66, 0x41, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x3e, - 0x0a, 0x1c, 0x6d, 0x61, 0x78, 0x5f, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x5f, 0x6f, 0x66, 0x5f, - 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x5f, 0x65, 0x76, 0x65, 0x6e, 0x74, 0x73, 0x18, 0x06, - 0x20, 0x01, 0x28, 0x03, 0x52, 0x18, 0x6d, 0x61, 0x78, 0x4e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x4f, - 0x66, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x45, 0x76, 0x65, 0x6e, 0x74, 0x73, 0x12, 0x2d, - 0x0a, 0x13, 0x6d, 0x61, 0x78, 0x5f, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x5f, 0x6f, 0x66, 0x5f, - 0x6c, 0x69, 0x6e, 0x6b, 0x73, 0x18, 0x07, 0x20, 0x01, 0x28, 0x03, 0x52, 0x10, 0x6d, 0x61, 0x78, - 0x4e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x4f, 0x66, 0x4c, 0x69, 0x6e, 0x6b, 0x73, 0x42, 0x09, 0x0a, - 0x07, 0x73, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x72, 0x22, 0x46, 0x0a, 0x12, 0x50, 0x72, 0x6f, 0x62, - 0x61, 0x62, 0x69, 0x6c, 0x69, 0x74, 0x79, 0x53, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x72, 0x12, 0x30, - 0x0a, 0x13, 0x73, 0x61, 0x6d, 0x70, 0x6c, 0x69, 0x6e, 0x67, 0x50, 0x72, 0x6f, 0x62, 0x61, 0x62, - 0x69, 0x6c, 0x69, 0x74, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x01, 0x52, 0x13, 0x73, 0x61, 0x6d, - 0x70, 0x6c, 0x69, 0x6e, 0x67, 0x50, 0x72, 0x6f, 0x62, 0x61, 0x62, 0x69, 0x6c, 0x69, 0x74, 0x79, - 0x22, 0xb0, 0x01, 0x0a, 0x0f, 0x43, 0x6f, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x74, 0x53, 0x61, 0x6d, - 0x70, 0x6c, 0x65, 0x72, 0x12, 0x57, 0x0a, 0x08, 0x64, 0x65, 0x63, 0x69, 0x73, 0x69, 0x6f, 0x6e, - 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x3b, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, - 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, - 0x76, 0x31, 0x2e, 0x43, 0x6f, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x74, 0x53, 0x61, 0x6d, 0x70, 0x6c, - 0x65, 0x72, 0x2e, 0x43, 0x6f, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x74, 0x44, 0x65, 0x63, 0x69, 0x73, - 0x69, 0x6f, 0x6e, 0x52, 0x08, 0x64, 0x65, 0x63, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x22, 0x44, 0x0a, - 0x10, 0x43, 0x6f, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x74, 0x44, 0x65, 0x63, 0x69, 0x73, 0x69, 0x6f, - 0x6e, 0x12, 0x0e, 0x0a, 0x0a, 0x41, 0x4c, 0x57, 0x41, 0x59, 0x53, 0x5f, 0x4f, 0x46, 0x46, 0x10, - 0x00, 0x12, 0x0d, 0x0a, 0x09, 0x41, 0x4c, 0x57, 0x41, 0x59, 0x53, 0x5f, 0x4f, 0x4e, 0x10, 0x01, - 0x12, 0x11, 0x0a, 0x0d, 0x41, 0x4c, 0x57, 0x41, 0x59, 0x53, 0x5f, 0x50, 0x41, 0x52, 0x45, 0x4e, - 0x54, 0x10, 0x02, 0x22, 0x27, 0x0a, 0x13, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, - 0x69, 0x6e, 0x67, 0x53, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x72, 0x12, 0x10, 0x0a, 0x03, 0x71, 0x70, - 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x03, 0x52, 0x03, 0x71, 0x70, 0x73, 0x42, 0x95, 0x01, 0x0a, - 0x1c, 0x69, 0x6f, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x31, 0x42, 0x10, 0x54, - 0x72, 0x61, 0x63, 0x65, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, - 0x01, 0x5a, 0x42, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x63, 0x65, - 0x6e, 0x73, 0x75, 0x73, 0x2d, 0x69, 0x6e, 0x73, 0x74, 0x72, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x2f, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2d, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x65, 0x6e, 0x2d, 0x67, 0x6f, 0x2f, 0x74, 0x72, 0x61, - 0x63, 0x65, 0x2f, 0x76, 0x31, 0xea, 0x02, 0x1c, 0x4f, 0x70, 0x65, 0x6e, 0x43, 0x65, 0x6e, 0x73, - 0x75, 0x73, 0x3a, 0x3a, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x3a, 0x3a, 0x54, 0x72, 0x61, 0x63, 0x65, - 0x3a, 0x3a, 0x56, 0x31, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, -} - -var ( - file_opencensus_proto_trace_v1_trace_config_proto_rawDescOnce sync.Once - file_opencensus_proto_trace_v1_trace_config_proto_rawDescData = file_opencensus_proto_trace_v1_trace_config_proto_rawDesc -) - -func file_opencensus_proto_trace_v1_trace_config_proto_rawDescGZIP() []byte { - file_opencensus_proto_trace_v1_trace_config_proto_rawDescOnce.Do(func() { - file_opencensus_proto_trace_v1_trace_config_proto_rawDescData = protoimpl.X.CompressGZIP(file_opencensus_proto_trace_v1_trace_config_proto_rawDescData) - }) - return file_opencensus_proto_trace_v1_trace_config_proto_rawDescData -} - -var file_opencensus_proto_trace_v1_trace_config_proto_enumTypes = make([]protoimpl.EnumInfo, 1) -var file_opencensus_proto_trace_v1_trace_config_proto_msgTypes = make([]protoimpl.MessageInfo, 4) -var file_opencensus_proto_trace_v1_trace_config_proto_goTypes = []interface{}{ - (ConstantSampler_ConstantDecision)(0), // 0: opencensus.proto.trace.v1.ConstantSampler.ConstantDecision - (*TraceConfig)(nil), // 1: opencensus.proto.trace.v1.TraceConfig - (*ProbabilitySampler)(nil), // 2: opencensus.proto.trace.v1.ProbabilitySampler - (*ConstantSampler)(nil), // 3: opencensus.proto.trace.v1.ConstantSampler - (*RateLimitingSampler)(nil), // 4: opencensus.proto.trace.v1.RateLimitingSampler -} -var file_opencensus_proto_trace_v1_trace_config_proto_depIdxs = []int32{ - 2, // 0: opencensus.proto.trace.v1.TraceConfig.probability_sampler:type_name -> opencensus.proto.trace.v1.ProbabilitySampler - 3, // 1: opencensus.proto.trace.v1.TraceConfig.constant_sampler:type_name -> opencensus.proto.trace.v1.ConstantSampler - 4, // 2: opencensus.proto.trace.v1.TraceConfig.rate_limiting_sampler:type_name -> opencensus.proto.trace.v1.RateLimitingSampler - 0, // 3: opencensus.proto.trace.v1.ConstantSampler.decision:type_name -> opencensus.proto.trace.v1.ConstantSampler.ConstantDecision - 4, // [4:4] is the sub-list for method output_type - 4, // [4:4] is the sub-list for method input_type - 4, // [4:4] is the sub-list for extension type_name - 4, // [4:4] is the sub-list for extension extendee - 0, // [0:4] is the sub-list for field type_name -} - -func init() { file_opencensus_proto_trace_v1_trace_config_proto_init() } -func file_opencensus_proto_trace_v1_trace_config_proto_init() { - if File_opencensus_proto_trace_v1_trace_config_proto != nil { - return - } - if !protoimpl.UnsafeEnabled { - file_opencensus_proto_trace_v1_trace_config_proto_msgTypes[0].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*TraceConfig); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_opencensus_proto_trace_v1_trace_config_proto_msgTypes[1].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ProbabilitySampler); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_opencensus_proto_trace_v1_trace_config_proto_msgTypes[2].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ConstantSampler); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_opencensus_proto_trace_v1_trace_config_proto_msgTypes[3].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*RateLimitingSampler); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } - file_opencensus_proto_trace_v1_trace_config_proto_msgTypes[0].OneofWrappers = []interface{}{ - (*TraceConfig_ProbabilitySampler)(nil), - (*TraceConfig_ConstantSampler)(nil), - (*TraceConfig_RateLimitingSampler)(nil), - } - type x struct{} - out := protoimpl.TypeBuilder{ - File: protoimpl.DescBuilder{ - GoPackagePath: reflect.TypeOf(x{}).PkgPath(), - RawDescriptor: file_opencensus_proto_trace_v1_trace_config_proto_rawDesc, - NumEnums: 1, - NumMessages: 4, - NumExtensions: 0, - NumServices: 0, - }, - GoTypes: file_opencensus_proto_trace_v1_trace_config_proto_goTypes, - DependencyIndexes: file_opencensus_proto_trace_v1_trace_config_proto_depIdxs, - EnumInfos: file_opencensus_proto_trace_v1_trace_config_proto_enumTypes, - MessageInfos: file_opencensus_proto_trace_v1_trace_config_proto_msgTypes, - }.Build() - File_opencensus_proto_trace_v1_trace_config_proto = out.File - file_opencensus_proto_trace_v1_trace_config_proto_rawDesc = nil - file_opencensus_proto_trace_v1_trace_config_proto_goTypes = nil - file_opencensus_proto_trace_v1_trace_config_proto_depIdxs = nil -} diff --git a/vendor/github.com/envoyproxy/go-control-plane/LICENSE b/vendor/github.com/envoyproxy/go-control-plane/envoy/LICENSE similarity index 100% rename from vendor/github.com/envoyproxy/go-control-plane/LICENSE rename to vendor/github.com/envoyproxy/go-control-plane/envoy/LICENSE diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/certs.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/certs.pb.go index 13d644dba61ca..5ff08553ee409 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/certs.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/certs.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/admin/v3/certs.proto package adminv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/clusters.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/clusters.pb.go index 06b79187fd65a..7870dd05b0bff 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/clusters.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/clusters.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/admin/v3/clusters.proto package adminv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/config_dump.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/config_dump.pb.go index ef711d966f8ef..bd042b83c50b3 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/config_dump.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/config_dump.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/admin/v3/config_dump.proto package adminv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/config_dump_shared.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/config_dump_shared.pb.go index feb0921ae2338..79d3fcdb4cc2d 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/config_dump_shared.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/config_dump_shared.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/admin/v3/config_dump_shared.proto package adminv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/init_dump.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/init_dump.pb.go index 388c1de3262b3..e0a29a2573eed 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/init_dump.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/init_dump.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/admin/v3/init_dump.proto package adminv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/listeners.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/listeners.pb.go index ac6015fac5253..a361d2fc0266e 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/listeners.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/listeners.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/admin/v3/listeners.proto package adminv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/memory.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/memory.pb.go index 32de56ce3b0f5..3a0be261c6e43 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/memory.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/memory.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/admin/v3/memory.proto package adminv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/metrics.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/metrics.pb.go index 3b718959600cd..16da30945411d 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/metrics.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/metrics.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/admin/v3/metrics.proto package adminv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/mutex_stats.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/mutex_stats.pb.go index 44f35183dd9a7..13c29bab793be 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/mutex_stats.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/mutex_stats.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/admin/v3/mutex_stats.proto package adminv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/server_info.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/server_info.pb.go index 4538ff30f158e..e619d8eec4556 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/server_info.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/server_info.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/admin/v3/server_info.proto package adminv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/tap.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/tap.pb.go index f30e4500e46ee..4f5e11d87c11c 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/tap.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/admin/v3/tap.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/admin/v3/tap.proto package adminv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/annotations/deprecation.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/annotations/deprecation.pb.go index 258fcfe2fbdc4..cdcac235f5e86 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/annotations/deprecation.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/annotations/deprecation.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/annotations/deprecation.proto package annotations diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/annotations/resource.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/annotations/resource.pb.go index 828c87c5e3b7e..c55fabc1ed6fc 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/annotations/resource.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/annotations/resource.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/annotations/resource.proto package annotations diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/accesslog/v3/accesslog.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/accesslog/v3/accesslog.pb.go index 34996d4975fbe..8db944005b205 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/accesslog/v3/accesslog.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/accesslog/v3/accesslog.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/accesslog/v3/accesslog.proto package accesslogv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/bootstrap/v3/bootstrap.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/bootstrap/v3/bootstrap.pb.go index 893acf21e34e1..d108cfa8640fa 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/bootstrap/v3/bootstrap.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/bootstrap/v3/bootstrap.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/bootstrap/v3/bootstrap.proto package bootstrapv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/cluster/v3/circuit_breaker.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/cluster/v3/circuit_breaker.pb.go index cffadb9d88253..aadfc1306cb42 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/cluster/v3/circuit_breaker.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/cluster/v3/circuit_breaker.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/cluster/v3/circuit_breaker.proto package clusterv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/cluster/v3/cluster.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/cluster/v3/cluster.pb.go index b82b06506a50b..b58c7e2e05328 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/cluster/v3/cluster.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/cluster/v3/cluster.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/cluster/v3/cluster.proto package clusterv3 @@ -858,6 +858,12 @@ type Cluster struct { // :ref:`STRICT_DNS` // and :ref:`LOGICAL_DNS` // this setting is ignored. + // This field is deprecated in favor of using the :ref:`cluster_type` + // extension point and configuring it with :ref:`DnsCluster`. + // If :ref:`cluster_type` is configured with + // :ref:`DnsCluster`, this field will be ignored. + // + // Deprecated: Marked as deprecated in envoy/config/cluster/v3/cluster.proto. DnsRefreshRate *durationpb.Duration `protobuf:"bytes,16,opt,name=dns_refresh_rate,json=dnsRefreshRate,proto3" json:"dns_refresh_rate,omitempty"` // DNS jitter can be optionally specified if the cluster type is either // :ref:`STRICT_DNS`, @@ -868,6 +874,12 @@ type Cluster struct { // :ref:`STRICT_DNS` // and :ref:`LOGICAL_DNS` // this setting is ignored. + // This field is deprecated in favor of using the :ref:`cluster_type` + // extension point and configuring it with :ref:`DnsCluster`. + // If :ref:`cluster_type` is configured with + // :ref:`DnsCluster`, this field will be ignored. + // + // Deprecated: Marked as deprecated in envoy/config/cluster/v3/cluster.proto. DnsJitter *durationpb.Duration `protobuf:"bytes,58,opt,name=dns_jitter,json=dnsJitter,proto3" json:"dns_jitter,omitempty"` // If the DNS failure refresh rate is specified and the cluster type is either // :ref:`STRICT_DNS`, @@ -877,14 +889,31 @@ type Cluster struct { // other than :ref:`STRICT_DNS` and // :ref:`LOGICAL_DNS` this setting is // ignored. + // This field is deprecated in favor of using the :ref:`cluster_type` + // extension point and configuring it with :ref:`DnsCluster`. + // If :ref:`cluster_type` is configured with + // :ref:`DnsCluster`, this field will be ignored. + // + // Deprecated: Marked as deprecated in envoy/config/cluster/v3/cluster.proto. DnsFailureRefreshRate *Cluster_RefreshRate `protobuf:"bytes,44,opt,name=dns_failure_refresh_rate,json=dnsFailureRefreshRate,proto3" json:"dns_failure_refresh_rate,omitempty"` // Optional configuration for setting cluster's DNS refresh rate. If the value is set to true, // cluster's DNS refresh rate will be set to resource record's TTL which comes from DNS // resolution. + // This field is deprecated in favor of using the :ref:`cluster_type` + // extension point and configuring it with :ref:`DnsCluster`. + // If :ref:`cluster_type` is configured with + // :ref:`DnsCluster`, this field will be ignored. + // + // Deprecated: Marked as deprecated in envoy/config/cluster/v3/cluster.proto. RespectDnsTtl bool `protobuf:"varint,39,opt,name=respect_dns_ttl,json=respectDnsTtl,proto3" json:"respect_dns_ttl,omitempty"` // The DNS IP address resolution policy. If this setting is not specified, the // value defaults to // :ref:`AUTO`. + // For logical and strict dns cluster, this field is deprecated in favor of using the + // :ref:`cluster_type` + // extension point and configuring it with :ref:`DnsCluster`. + // If :ref:`cluster_type` is configured with + // :ref:`DnsCluster`, this field will be ignored. DnsLookupFamily Cluster_DnsLookupFamily `protobuf:"varint,17,opt,name=dns_lookup_family,json=dnsLookupFamily,proto3,enum=envoy.config.cluster.v3.Cluster_DnsLookupFamily" json:"dns_lookup_family,omitempty"` // If DNS resolvers are specified and the cluster type is either // :ref:`STRICT_DNS`, @@ -923,6 +952,9 @@ type Cluster struct { // During the transition period when both “dns_resolution_config“ and “typed_dns_resolver_config“ exists, // when “typed_dns_resolver_config“ is in place, Envoy will use it and ignore “dns_resolution_config“. // When “typed_dns_resolver_config“ is missing, the default behavior is in place. + // Also note that this field is deprecated for logical dns and strict dns clusters and will be ignored when + // :ref:`cluster_type` is configured with + // :ref:`DnsCluster`. // [#extension-category: envoy.network.dns_resolver] TypedDnsResolverConfig *v32.TypedExtensionConfig `protobuf:"bytes,55,opt,name=typed_dns_resolver_config,json=typedDnsResolverConfig,proto3" json:"typed_dns_resolver_config,omitempty"` // Optional configuration for having cluster readiness block on warm-up. Currently, only applicable for @@ -1265,6 +1297,7 @@ func (x *Cluster) GetTypedExtensionProtocolOptions() map[string]*anypb.Any { return nil } +// Deprecated: Marked as deprecated in envoy/config/cluster/v3/cluster.proto. func (x *Cluster) GetDnsRefreshRate() *durationpb.Duration { if x != nil { return x.DnsRefreshRate @@ -1272,6 +1305,7 @@ func (x *Cluster) GetDnsRefreshRate() *durationpb.Duration { return nil } +// Deprecated: Marked as deprecated in envoy/config/cluster/v3/cluster.proto. func (x *Cluster) GetDnsJitter() *durationpb.Duration { if x != nil { return x.DnsJitter @@ -1279,6 +1313,7 @@ func (x *Cluster) GetDnsJitter() *durationpb.Duration { return nil } +// Deprecated: Marked as deprecated in envoy/config/cluster/v3/cluster.proto. func (x *Cluster) GetDnsFailureRefreshRate() *Cluster_RefreshRate { if x != nil { return x.DnsFailureRefreshRate @@ -1286,6 +1321,7 @@ func (x *Cluster) GetDnsFailureRefreshRate() *Cluster_RefreshRate { return nil } +// Deprecated: Marked as deprecated in envoy/config/cluster/v3/cluster.proto. func (x *Cluster) GetRespectDnsTtl() bool { if x != nil { return x.RespectDnsTtl @@ -3389,7 +3425,7 @@ var file_envoy_config_cluster_v3_cluster_proto_rawDesc = []byte{ 0x0a, 0x07, 0x65, 0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x78, 0x64, 0x73, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6f, 0x6c, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x07, 0x65, - 0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, 0x22, 0x90, 0x54, 0x0a, 0x07, 0x43, 0x6c, 0x75, 0x73, 0x74, + 0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, 0x22, 0xca, 0x54, 0x0a, 0x07, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x12, 0x6f, 0x0a, 0x18, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x73, 0x18, 0x2b, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x35, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, @@ -3497,657 +3533,661 @@ var file_envoy_config_cluster_v3_cluster_proto_rawDesc = []byte{ 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x1d, 0x74, 0x79, 0x70, 0x65, 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x50, 0x72, - 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x51, 0x0a, + 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x5c, 0x0a, 0x10, 0x64, 0x6e, 0x73, 0x5f, 0x72, 0x65, 0x66, 0x72, 0x65, 0x73, 0x68, 0x5f, 0x72, 0x61, 0x74, 0x65, 0x18, 0x10, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x42, 0x0c, 0xfa, 0x42, 0x09, 0xaa, 0x01, 0x06, 0x2a, 0x04, 0x10, 0xc0, 0x84, 0x3d, - 0x52, 0x0e, 0x64, 0x6e, 0x73, 0x52, 0x65, 0x66, 0x72, 0x65, 0x73, 0x68, 0x52, 0x61, 0x74, 0x65, - 0x12, 0x38, 0x0a, 0x0a, 0x64, 0x6e, 0x73, 0x5f, 0x6a, 0x69, 0x74, 0x74, 0x65, 0x72, 0x18, 0x3a, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, - 0x09, 0x64, 0x6e, 0x73, 0x4a, 0x69, 0x74, 0x74, 0x65, 0x72, 0x12, 0x65, 0x0a, 0x18, 0x64, 0x6e, + 0x6f, 0x6e, 0x42, 0x17, 0xfa, 0x42, 0x09, 0xaa, 0x01, 0x06, 0x2a, 0x04, 0x10, 0xc0, 0x84, 0x3d, + 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x52, 0x0e, 0x64, 0x6e, 0x73, + 0x52, 0x65, 0x66, 0x72, 0x65, 0x73, 0x68, 0x52, 0x61, 0x74, 0x65, 0x12, 0x4d, 0x0a, 0x0a, 0x64, + 0x6e, 0x73, 0x5f, 0x6a, 0x69, 0x74, 0x74, 0x65, 0x72, 0x18, 0x3a, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x13, 0xfa, 0x42, 0x05, 0xaa, + 0x01, 0x02, 0x32, 0x00, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x52, + 0x09, 0x64, 0x6e, 0x73, 0x4a, 0x69, 0x74, 0x74, 0x65, 0x72, 0x12, 0x72, 0x0a, 0x18, 0x64, 0x6e, 0x73, 0x5f, 0x66, 0x61, 0x69, 0x6c, 0x75, 0x72, 0x65, 0x5f, 0x72, 0x65, 0x66, 0x72, 0x65, 0x73, 0x68, 0x5f, 0x72, 0x61, 0x74, 0x65, 0x18, 0x2c, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x52, - 0x65, 0x66, 0x72, 0x65, 0x73, 0x68, 0x52, 0x61, 0x74, 0x65, 0x52, 0x15, 0x64, 0x6e, 0x73, 0x46, - 0x61, 0x69, 0x6c, 0x75, 0x72, 0x65, 0x52, 0x65, 0x66, 0x72, 0x65, 0x73, 0x68, 0x52, 0x61, 0x74, - 0x65, 0x12, 0x26, 0x0a, 0x0f, 0x72, 0x65, 0x73, 0x70, 0x65, 0x63, 0x74, 0x5f, 0x64, 0x6e, 0x73, - 0x5f, 0x74, 0x74, 0x6c, 0x18, 0x27, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0d, 0x72, 0x65, 0x73, 0x70, - 0x65, 0x63, 0x74, 0x44, 0x6e, 0x73, 0x54, 0x74, 0x6c, 0x12, 0x66, 0x0a, 0x11, 0x64, 0x6e, 0x73, - 0x5f, 0x6c, 0x6f, 0x6f, 0x6b, 0x75, 0x70, 0x5f, 0x66, 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x18, 0x11, - 0x20, 0x01, 0x28, 0x0e, 0x32, 0x30, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, - 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x44, 0x6e, 0x73, 0x4c, 0x6f, 0x6f, 0x6b, 0x75, 0x70, - 0x46, 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x82, 0x01, 0x02, 0x10, 0x01, - 0x52, 0x0f, 0x64, 0x6e, 0x73, 0x4c, 0x6f, 0x6f, 0x6b, 0x75, 0x70, 0x46, 0x61, 0x6d, 0x69, 0x6c, - 0x79, 0x12, 0x4f, 0x0a, 0x0d, 0x64, 0x6e, 0x73, 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x6c, 0x76, 0x65, - 0x72, 0x73, 0x18, 0x12, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x1d, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, - 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, - 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, - 0x2e, 0x30, 0x18, 0x01, 0x52, 0x0c, 0x64, 0x6e, 0x73, 0x52, 0x65, 0x73, 0x6f, 0x6c, 0x76, 0x65, - 0x72, 0x73, 0x12, 0x41, 0x0a, 0x17, 0x75, 0x73, 0x65, 0x5f, 0x74, 0x63, 0x70, 0x5f, 0x66, 0x6f, - 0x72, 0x5f, 0x64, 0x6e, 0x73, 0x5f, 0x6c, 0x6f, 0x6f, 0x6b, 0x75, 0x70, 0x73, 0x18, 0x2d, 0x20, - 0x01, 0x28, 0x08, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, - 0x52, 0x13, 0x75, 0x73, 0x65, 0x54, 0x63, 0x70, 0x46, 0x6f, 0x72, 0x44, 0x6e, 0x73, 0x4c, 0x6f, - 0x6f, 0x6b, 0x75, 0x70, 0x73, 0x12, 0x6a, 0x0a, 0x15, 0x64, 0x6e, 0x73, 0x5f, 0x72, 0x65, 0x73, - 0x6f, 0x6c, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x35, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x29, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x44, 0x6e, 0x73, 0x52, - 0x65, 0x73, 0x6f, 0x6c, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x42, - 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x52, 0x13, 0x64, 0x6e, - 0x73, 0x52, 0x65, 0x73, 0x6f, 0x6c, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x12, 0x65, 0x0a, 0x19, 0x74, 0x79, 0x70, 0x65, 0x64, 0x5f, 0x64, 0x6e, 0x73, 0x5f, 0x72, - 0x65, 0x73, 0x6f, 0x6c, 0x76, 0x65, 0x72, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x37, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x79, 0x70, 0x65, - 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x52, 0x16, 0x74, 0x79, 0x70, 0x65, 0x64, 0x44, 0x6e, 0x73, 0x52, 0x65, 0x73, 0x6f, 0x6c, 0x76, - 0x65, 0x72, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x4c, 0x0a, 0x15, 0x77, 0x61, 0x69, 0x74, - 0x5f, 0x66, 0x6f, 0x72, 0x5f, 0x77, 0x61, 0x72, 0x6d, 0x5f, 0x6f, 0x6e, 0x5f, 0x69, 0x6e, 0x69, - 0x74, 0x18, 0x36, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, - 0x6c, 0x75, 0x65, 0x52, 0x11, 0x77, 0x61, 0x69, 0x74, 0x46, 0x6f, 0x72, 0x57, 0x61, 0x72, 0x6d, - 0x4f, 0x6e, 0x49, 0x6e, 0x69, 0x74, 0x12, 0x56, 0x0a, 0x11, 0x6f, 0x75, 0x74, 0x6c, 0x69, 0x65, - 0x72, 0x5f, 0x64, 0x65, 0x74, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x13, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x29, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x4f, 0x75, 0x74, 0x6c, - 0x69, 0x65, 0x72, 0x44, 0x65, 0x74, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x10, 0x6f, 0x75, - 0x74, 0x6c, 0x69, 0x65, 0x72, 0x44, 0x65, 0x74, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4e, - 0x0a, 0x10, 0x63, 0x6c, 0x65, 0x61, 0x6e, 0x75, 0x70, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, - 0x61, 0x6c, 0x18, 0x14, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x42, 0x08, 0xfa, 0x42, 0x05, 0xaa, 0x01, 0x02, 0x2a, 0x00, 0x52, 0x0f, 0x63, - 0x6c, 0x65, 0x61, 0x6e, 0x75, 0x70, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x12, 0x52, - 0x0a, 0x14, 0x75, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x5f, 0x62, 0x69, 0x6e, 0x64, 0x5f, - 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x15, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x65, - 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, - 0x2e, 0x76, 0x33, 0x2e, 0x42, 0x69, 0x6e, 0x64, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x12, - 0x75, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x42, 0x69, 0x6e, 0x64, 0x43, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x12, 0x59, 0x0a, 0x10, 0x6c, 0x62, 0x5f, 0x73, 0x75, 0x62, 0x73, 0x65, 0x74, 0x5f, - 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x16, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x65, - 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, - 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x4c, - 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x0e, 0x6c, - 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x62, 0x0a, - 0x13, 0x72, 0x69, 0x6e, 0x67, 0x5f, 0x68, 0x61, 0x73, 0x68, 0x5f, 0x6c, 0x62, 0x5f, 0x63, 0x6f, - 0x6e, 0x66, 0x69, 0x67, 0x18, 0x17, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x31, 0x2e, 0x65, 0x6e, 0x76, - 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, - 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x52, 0x69, 0x6e, - 0x67, 0x48, 0x61, 0x73, 0x68, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x48, 0x01, 0x52, - 0x10, 0x72, 0x69, 0x6e, 0x67, 0x48, 0x61, 0x73, 0x68, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x12, 0x5b, 0x0a, 0x10, 0x6d, 0x61, 0x67, 0x6c, 0x65, 0x76, 0x5f, 0x6c, 0x62, 0x5f, 0x63, - 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x34, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x65, 0x6e, - 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, - 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x4d, 0x61, - 0x67, 0x6c, 0x65, 0x76, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x48, 0x01, 0x52, 0x0e, - 0x6d, 0x61, 0x67, 0x6c, 0x65, 0x76, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x6b, - 0x0a, 0x16, 0x6f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x61, 0x6c, 0x5f, 0x64, 0x73, 0x74, 0x5f, 0x6c, - 0x62, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x22, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x34, + 0x65, 0x66, 0x72, 0x65, 0x73, 0x68, 0x52, 0x61, 0x74, 0x65, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, + 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x52, 0x15, 0x64, 0x6e, 0x73, 0x46, 0x61, 0x69, 0x6c, + 0x75, 0x72, 0x65, 0x52, 0x65, 0x66, 0x72, 0x65, 0x73, 0x68, 0x52, 0x61, 0x74, 0x65, 0x12, 0x33, + 0x0a, 0x0f, 0x72, 0x65, 0x73, 0x70, 0x65, 0x63, 0x74, 0x5f, 0x64, 0x6e, 0x73, 0x5f, 0x74, 0x74, + 0x6c, 0x18, 0x27, 0x20, 0x01, 0x28, 0x08, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, + 0x2e, 0x30, 0x18, 0x01, 0x52, 0x0d, 0x72, 0x65, 0x73, 0x70, 0x65, 0x63, 0x74, 0x44, 0x6e, 0x73, + 0x54, 0x74, 0x6c, 0x12, 0x66, 0x0a, 0x11, 0x64, 0x6e, 0x73, 0x5f, 0x6c, 0x6f, 0x6f, 0x6b, 0x75, + 0x70, 0x5f, 0x66, 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x18, 0x11, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x30, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, - 0x2e, 0x4f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x61, 0x6c, 0x44, 0x73, 0x74, 0x4c, 0x62, 0x43, 0x6f, - 0x6e, 0x66, 0x69, 0x67, 0x48, 0x01, 0x52, 0x13, 0x6f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x61, 0x6c, - 0x44, 0x73, 0x74, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x6e, 0x0a, 0x17, 0x6c, - 0x65, 0x61, 0x73, 0x74, 0x5f, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x6c, 0x62, 0x5f, - 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x25, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x35, 0x2e, 0x65, - 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, - 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x4c, - 0x65, 0x61, 0x73, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x4c, 0x62, 0x43, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x48, 0x01, 0x52, 0x14, 0x6c, 0x65, 0x61, 0x73, 0x74, 0x52, 0x65, 0x71, 0x75, - 0x65, 0x73, 0x74, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x68, 0x0a, 0x15, 0x72, - 0x6f, 0x75, 0x6e, 0x64, 0x5f, 0x72, 0x6f, 0x62, 0x69, 0x6e, 0x5f, 0x6c, 0x62, 0x5f, 0x63, 0x6f, - 0x6e, 0x66, 0x69, 0x67, 0x18, 0x38, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x33, 0x2e, 0x65, 0x6e, 0x76, - 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, - 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x52, 0x6f, 0x75, - 0x6e, 0x64, 0x52, 0x6f, 0x62, 0x69, 0x6e, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x48, - 0x01, 0x52, 0x12, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x52, 0x6f, 0x62, 0x69, 0x6e, 0x4c, 0x62, 0x43, - 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x59, 0x0a, 0x10, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x5f, - 0x6c, 0x62, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x1b, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x2f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, - 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, - 0x72, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x52, 0x0e, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x12, 0x50, 0x0a, 0x10, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, - 0x63, 0x6b, 0x65, 0x74, 0x18, 0x18, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x65, 0x6e, 0x76, - 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, - 0x33, 0x2e, 0x54, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x53, 0x6f, 0x63, 0x6b, 0x65, - 0x74, 0x52, 0x0f, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x53, 0x6f, 0x63, 0x6b, - 0x65, 0x74, 0x12, 0x3a, 0x0a, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x18, 0x19, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1e, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x65, 0x74, 0x61, - 0x64, 0x61, 0x74, 0x61, 0x52, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x12, 0x75, - 0x0a, 0x12, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x5f, 0x73, 0x65, 0x6c, 0x65, 0x63, - 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x1a, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x39, 0x2e, 0x65, 0x6e, 0x76, - 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, - 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x43, 0x6c, 0x75, - 0x73, 0x74, 0x65, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x53, 0x65, 0x6c, 0x65, - 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, - 0x18, 0x01, 0x52, 0x11, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x53, 0x65, 0x6c, 0x65, - 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x72, 0x0a, 0x1b, 0x75, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, - 0x6d, 0x5f, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x1e, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x32, 0x2e, 0x65, 0x6e, 0x76, - 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, - 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x43, 0x6f, 0x6e, - 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x19, - 0x75, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, - 0x6f, 0x6e, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x55, 0x0a, 0x28, 0x63, 0x6c, 0x6f, - 0x73, 0x65, 0x5f, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x5f, 0x6f, - 0x6e, 0x5f, 0x68, 0x6f, 0x73, 0x74, 0x5f, 0x68, 0x65, 0x61, 0x6c, 0x74, 0x68, 0x5f, 0x66, 0x61, - 0x69, 0x6c, 0x75, 0x72, 0x65, 0x18, 0x1f, 0x20, 0x01, 0x28, 0x08, 0x52, 0x23, 0x63, 0x6c, 0x6f, - 0x73, 0x65, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x4f, 0x6e, 0x48, - 0x6f, 0x73, 0x74, 0x48, 0x65, 0x61, 0x6c, 0x74, 0x68, 0x46, 0x61, 0x69, 0x6c, 0x75, 0x72, 0x65, - 0x12, 0x40, 0x0a, 0x1d, 0x69, 0x67, 0x6e, 0x6f, 0x72, 0x65, 0x5f, 0x68, 0x65, 0x61, 0x6c, 0x74, - 0x68, 0x5f, 0x6f, 0x6e, 0x5f, 0x68, 0x6f, 0x73, 0x74, 0x5f, 0x72, 0x65, 0x6d, 0x6f, 0x76, 0x61, - 0x6c, 0x18, 0x20, 0x20, 0x01, 0x28, 0x08, 0x52, 0x19, 0x69, 0x67, 0x6e, 0x6f, 0x72, 0x65, 0x48, - 0x65, 0x61, 0x6c, 0x74, 0x68, 0x4f, 0x6e, 0x48, 0x6f, 0x73, 0x74, 0x52, 0x65, 0x6d, 0x6f, 0x76, - 0x61, 0x6c, 0x12, 0x39, 0x0a, 0x07, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x73, 0x18, 0x28, 0x20, - 0x03, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x46, 0x69, - 0x6c, 0x74, 0x65, 0x72, 0x52, 0x07, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x73, 0x12, 0x60, 0x0a, - 0x15, 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x62, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x69, 0x6e, 0x67, 0x5f, - 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x18, 0x29, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x65, - 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, - 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x6f, 0x61, 0x64, 0x42, 0x61, 0x6c, 0x61, 0x6e, - 0x63, 0x69, 0x6e, 0x67, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x13, 0x6c, 0x6f, 0x61, 0x64, - 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x69, 0x6e, 0x67, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, - 0x41, 0x0a, 0x0a, 0x6c, 0x72, 0x73, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, 0x18, 0x2a, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x52, 0x09, 0x6c, 0x72, 0x73, 0x53, 0x65, 0x72, 0x76, - 0x65, 0x72, 0x12, 0x3d, 0x0a, 0x1b, 0x6c, 0x72, 0x73, 0x5f, 0x72, 0x65, 0x70, 0x6f, 0x72, 0x74, - 0x5f, 0x65, 0x6e, 0x64, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x5f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, - 0x73, 0x18, 0x39, 0x20, 0x03, 0x28, 0x09, 0x52, 0x18, 0x6c, 0x72, 0x73, 0x52, 0x65, 0x70, 0x6f, - 0x72, 0x74, 0x45, 0x6e, 0x64, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, - 0x73, 0x12, 0x3f, 0x0a, 0x15, 0x74, 0x72, 0x61, 0x63, 0x6b, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x6f, - 0x75, 0x74, 0x5f, 0x62, 0x75, 0x64, 0x67, 0x65, 0x74, 0x73, 0x18, 0x2f, 0x20, 0x01, 0x28, 0x08, - 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x52, 0x13, 0x74, - 0x72, 0x61, 0x63, 0x6b, 0x54, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x42, 0x75, 0x64, 0x67, 0x65, - 0x74, 0x73, 0x12, 0x53, 0x0a, 0x0f, 0x75, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x5f, 0x63, - 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x30, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x65, 0x6e, - 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, - 0x76, 0x33, 0x2e, 0x54, 0x79, 0x70, 0x65, 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, - 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x0e, 0x75, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, - 0x6d, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x5a, 0x0a, 0x13, 0x74, 0x72, 0x61, 0x63, 0x6b, - 0x5f, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x73, 0x18, 0x31, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x54, - 0x72, 0x61, 0x63, 0x6b, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x53, 0x74, 0x61, 0x74, 0x73, - 0x52, 0x11, 0x74, 0x72, 0x61, 0x63, 0x6b, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x53, 0x74, - 0x61, 0x74, 0x73, 0x12, 0x5e, 0x0a, 0x11, 0x70, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, - 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x18, 0x32, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x31, - 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, - 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, - 0x2e, 0x50, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, - 0x79, 0x52, 0x10, 0x70, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x50, 0x6f, 0x6c, - 0x69, 0x63, 0x79, 0x12, 0x58, 0x0a, 0x29, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, - 0x6e, 0x5f, 0x70, 0x6f, 0x6f, 0x6c, 0x5f, 0x70, 0x65, 0x72, 0x5f, 0x64, 0x6f, 0x77, 0x6e, 0x73, - 0x74, 0x72, 0x65, 0x61, 0x6d, 0x5f, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, - 0x18, 0x33, 0x20, 0x01, 0x28, 0x08, 0x52, 0x25, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, - 0x6f, 0x6e, 0x50, 0x6f, 0x6f, 0x6c, 0x50, 0x65, 0x72, 0x44, 0x6f, 0x77, 0x6e, 0x73, 0x74, 0x72, - 0x65, 0x61, 0x6d, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0xe6, 0x01, - 0x0a, 0x14, 0x54, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x53, 0x6f, 0x63, 0x6b, 0x65, - 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x1b, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x04, 0x6e, - 0x61, 0x6d, 0x65, 0x12, 0x2d, 0x0a, 0x05, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x17, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x74, 0x72, 0x75, 0x63, 0x74, 0x52, 0x05, 0x6d, 0x61, 0x74, - 0x63, 0x68, 0x12, 0x50, 0x0a, 0x10, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, - 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x65, - 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, - 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x53, 0x6f, 0x63, - 0x6b, 0x65, 0x74, 0x52, 0x0f, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x53, 0x6f, - 0x63, 0x6b, 0x65, 0x74, 0x3a, 0x30, 0x9a, 0xc5, 0x88, 0x1e, 0x2b, 0x0a, 0x29, 0x65, 0x6e, 0x76, - 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, - 0x72, 0x2e, 0x54, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x53, 0x6f, 0x63, 0x6b, 0x65, - 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x1a, 0x98, 0x01, 0x0a, 0x11, 0x43, 0x75, 0x73, 0x74, 0x6f, - 0x6d, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, 0x12, 0x1b, 0x0a, 0x04, - 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, - 0x02, 0x10, 0x01, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x37, 0x0a, 0x0c, 0x74, 0x79, 0x70, - 0x65, 0x64, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x14, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2e, 0x41, 0x6e, 0x79, 0x52, 0x0b, 0x74, 0x79, 0x70, 0x65, 0x64, 0x43, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x3a, 0x2d, 0x9a, 0xc5, 0x88, 0x1e, 0x28, 0x0a, 0x26, 0x65, 0x6e, 0x76, 0x6f, 0x79, - 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, - 0x43, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x54, 0x79, 0x70, - 0x65, 0x1a, 0xa6, 0x01, 0x0a, 0x10, 0x45, 0x64, 0x73, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, - 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x41, 0x0a, 0x0a, 0x65, 0x64, 0x73, 0x5f, 0x63, 0x6f, - 0x6e, 0x66, 0x69, 0x67, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x65, 0x6e, 0x76, - 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, - 0x33, 0x2e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x52, 0x09, - 0x65, 0x64, 0x73, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x21, 0x0a, 0x0c, 0x73, 0x65, 0x72, - 0x76, 0x69, 0x63, 0x65, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x0b, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x4e, 0x61, 0x6d, 0x65, 0x3a, 0x2c, 0x9a, 0xc5, - 0x88, 0x1e, 0x27, 0x0a, 0x25, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, - 0x32, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x45, 0x64, 0x73, 0x43, 0x6c, 0x75, - 0x73, 0x74, 0x65, 0x72, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x1a, 0xa4, 0x0a, 0x0a, 0x0e, 0x4c, - 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x79, 0x0a, - 0x0f, 0x66, 0x61, 0x6c, 0x6c, 0x62, 0x61, 0x63, 0x6b, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, - 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x46, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, + 0x2e, 0x44, 0x6e, 0x73, 0x4c, 0x6f, 0x6f, 0x6b, 0x75, 0x70, 0x46, 0x61, 0x6d, 0x69, 0x6c, 0x79, + 0x42, 0x08, 0xfa, 0x42, 0x05, 0x82, 0x01, 0x02, 0x10, 0x01, 0x52, 0x0f, 0x64, 0x6e, 0x73, 0x4c, + 0x6f, 0x6f, 0x6b, 0x75, 0x70, 0x46, 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x12, 0x4f, 0x0a, 0x0d, 0x64, + 0x6e, 0x73, 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x6c, 0x76, 0x65, 0x72, 0x73, 0x18, 0x12, 0x20, 0x03, + 0x28, 0x0b, 0x32, 0x1d, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, + 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, + 0x73, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x52, 0x0c, + 0x64, 0x6e, 0x73, 0x52, 0x65, 0x73, 0x6f, 0x6c, 0x76, 0x65, 0x72, 0x73, 0x12, 0x41, 0x0a, 0x17, + 0x75, 0x73, 0x65, 0x5f, 0x74, 0x63, 0x70, 0x5f, 0x66, 0x6f, 0x72, 0x5f, 0x64, 0x6e, 0x73, 0x5f, + 0x6c, 0x6f, 0x6f, 0x6b, 0x75, 0x70, 0x73, 0x18, 0x2d, 0x20, 0x01, 0x28, 0x08, 0x42, 0x0b, 0x92, + 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x52, 0x13, 0x75, 0x73, 0x65, 0x54, + 0x63, 0x70, 0x46, 0x6f, 0x72, 0x44, 0x6e, 0x73, 0x4c, 0x6f, 0x6f, 0x6b, 0x75, 0x70, 0x73, 0x12, + 0x6a, 0x0a, 0x15, 0x64, 0x6e, 0x73, 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x6c, 0x75, 0x74, 0x69, 0x6f, + 0x6e, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x35, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x29, + 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, + 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x44, 0x6e, 0x73, 0x52, 0x65, 0x73, 0x6f, 0x6c, 0x75, 0x74, + 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, + 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x52, 0x13, 0x64, 0x6e, 0x73, 0x52, 0x65, 0x73, 0x6f, 0x6c, + 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x65, 0x0a, 0x19, 0x74, + 0x79, 0x70, 0x65, 0x64, 0x5f, 0x64, 0x6e, 0x73, 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x6c, 0x76, 0x65, + 0x72, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x37, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, + 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, + 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x79, 0x70, 0x65, 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, + 0x73, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x16, 0x74, 0x79, 0x70, 0x65, + 0x64, 0x44, 0x6e, 0x73, 0x52, 0x65, 0x73, 0x6f, 0x6c, 0x76, 0x65, 0x72, 0x43, 0x6f, 0x6e, 0x66, + 0x69, 0x67, 0x12, 0x4c, 0x0a, 0x15, 0x77, 0x61, 0x69, 0x74, 0x5f, 0x66, 0x6f, 0x72, 0x5f, 0x77, + 0x61, 0x72, 0x6d, 0x5f, 0x6f, 0x6e, 0x5f, 0x69, 0x6e, 0x69, 0x74, 0x18, 0x36, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x11, 0x77, + 0x61, 0x69, 0x74, 0x46, 0x6f, 0x72, 0x57, 0x61, 0x72, 0x6d, 0x4f, 0x6e, 0x49, 0x6e, 0x69, 0x74, + 0x12, 0x56, 0x0a, 0x11, 0x6f, 0x75, 0x74, 0x6c, 0x69, 0x65, 0x72, 0x5f, 0x64, 0x65, 0x74, 0x65, + 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x13, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x29, 0x2e, 0x65, 0x6e, + 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, + 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x4f, 0x75, 0x74, 0x6c, 0x69, 0x65, 0x72, 0x44, 0x65, 0x74, + 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x10, 0x6f, 0x75, 0x74, 0x6c, 0x69, 0x65, 0x72, 0x44, + 0x65, 0x74, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4e, 0x0a, 0x10, 0x63, 0x6c, 0x65, 0x61, + 0x6e, 0x75, 0x70, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x18, 0x14, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, + 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x08, 0xfa, + 0x42, 0x05, 0xaa, 0x01, 0x02, 0x2a, 0x00, 0x52, 0x0f, 0x63, 0x6c, 0x65, 0x61, 0x6e, 0x75, 0x70, + 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x12, 0x52, 0x0a, 0x14, 0x75, 0x70, 0x73, 0x74, + 0x72, 0x65, 0x61, 0x6d, 0x5f, 0x62, 0x69, 0x6e, 0x64, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, + 0x18, 0x15, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x42, 0x69, + 0x6e, 0x64, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x12, 0x75, 0x70, 0x73, 0x74, 0x72, 0x65, + 0x61, 0x6d, 0x42, 0x69, 0x6e, 0x64, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x59, 0x0a, 0x10, + 0x6c, 0x62, 0x5f, 0x73, 0x75, 0x62, 0x73, 0x65, 0x74, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, + 0x18, 0x16, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x4c, 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, - 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x4c, 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, - 0x46, 0x61, 0x6c, 0x6c, 0x62, 0x61, 0x63, 0x6b, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x42, 0x08, - 0xfa, 0x42, 0x05, 0x82, 0x01, 0x02, 0x10, 0x01, 0x52, 0x0e, 0x66, 0x61, 0x6c, 0x6c, 0x62, 0x61, - 0x63, 0x6b, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x3e, 0x0a, 0x0e, 0x64, 0x65, 0x66, 0x61, - 0x75, 0x6c, 0x74, 0x5f, 0x73, 0x75, 0x62, 0x73, 0x65, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x17, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x2e, 0x53, 0x74, 0x72, 0x75, 0x63, 0x74, 0x52, 0x0d, 0x64, 0x65, 0x66, 0x61, 0x75, - 0x6c, 0x74, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x12, 0x6b, 0x0a, 0x10, 0x73, 0x75, 0x62, 0x73, - 0x65, 0x74, 0x5f, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x73, 0x18, 0x03, 0x20, 0x03, - 0x28, 0x0b, 0x32, 0x40, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, - 0x73, 0x74, 0x65, 0x72, 0x2e, 0x4c, 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x43, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x2e, 0x4c, 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x53, 0x65, 0x6c, 0x65, - 0x63, 0x74, 0x6f, 0x72, 0x52, 0x0f, 0x73, 0x75, 0x62, 0x73, 0x65, 0x74, 0x53, 0x65, 0x6c, 0x65, - 0x63, 0x74, 0x6f, 0x72, 0x73, 0x12, 0x32, 0x0a, 0x15, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x74, - 0x79, 0x5f, 0x77, 0x65, 0x69, 0x67, 0x68, 0x74, 0x5f, 0x61, 0x77, 0x61, 0x72, 0x65, 0x18, 0x04, - 0x20, 0x01, 0x28, 0x08, 0x52, 0x13, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x74, 0x79, 0x57, 0x65, - 0x69, 0x67, 0x68, 0x74, 0x41, 0x77, 0x61, 0x72, 0x65, 0x12, 0x32, 0x0a, 0x15, 0x73, 0x63, 0x61, - 0x6c, 0x65, 0x5f, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x74, 0x79, 0x5f, 0x77, 0x65, 0x69, 0x67, - 0x68, 0x74, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x52, 0x13, 0x73, 0x63, 0x61, 0x6c, 0x65, 0x4c, - 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x74, 0x79, 0x57, 0x65, 0x69, 0x67, 0x68, 0x74, 0x12, 0x24, 0x0a, - 0x0e, 0x70, 0x61, 0x6e, 0x69, 0x63, 0x5f, 0x6d, 0x6f, 0x64, 0x65, 0x5f, 0x61, 0x6e, 0x79, 0x18, - 0x06, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0c, 0x70, 0x61, 0x6e, 0x69, 0x63, 0x4d, 0x6f, 0x64, 0x65, - 0x41, 0x6e, 0x79, 0x12, 0x1e, 0x0a, 0x0b, 0x6c, 0x69, 0x73, 0x74, 0x5f, 0x61, 0x73, 0x5f, 0x61, - 0x6e, 0x79, 0x18, 0x07, 0x20, 0x01, 0x28, 0x08, 0x52, 0x09, 0x6c, 0x69, 0x73, 0x74, 0x41, 0x73, - 0x41, 0x6e, 0x79, 0x12, 0x92, 0x01, 0x0a, 0x18, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, - 0x5f, 0x66, 0x61, 0x6c, 0x6c, 0x62, 0x61, 0x63, 0x6b, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, - 0x18, 0x08, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x4e, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, + 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x0e, 0x6c, 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, + 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x62, 0x0a, 0x13, 0x72, 0x69, 0x6e, 0x67, 0x5f, + 0x68, 0x61, 0x73, 0x68, 0x5f, 0x6c, 0x62, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x17, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x31, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, + 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x52, 0x69, 0x6e, 0x67, 0x48, 0x61, 0x73, 0x68, 0x4c, + 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x48, 0x01, 0x52, 0x10, 0x72, 0x69, 0x6e, 0x67, 0x48, + 0x61, 0x73, 0x68, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x5b, 0x0a, 0x10, 0x6d, + 0x61, 0x67, 0x6c, 0x65, 0x76, 0x5f, 0x6c, 0x62, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, + 0x34, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, + 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, + 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x4d, 0x61, 0x67, 0x6c, 0x65, 0x76, 0x4c, 0x62, + 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x48, 0x01, 0x52, 0x0e, 0x6d, 0x61, 0x67, 0x6c, 0x65, 0x76, + 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x6b, 0x0a, 0x16, 0x6f, 0x72, 0x69, 0x67, + 0x69, 0x6e, 0x61, 0x6c, 0x5f, 0x64, 0x73, 0x74, 0x5f, 0x6c, 0x62, 0x5f, 0x63, 0x6f, 0x6e, 0x66, + 0x69, 0x67, 0x18, 0x22, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x34, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, + 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, + 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x4f, 0x72, 0x69, 0x67, 0x69, + 0x6e, 0x61, 0x6c, 0x44, 0x73, 0x74, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x48, 0x01, + 0x52, 0x13, 0x6f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x61, 0x6c, 0x44, 0x73, 0x74, 0x4c, 0x62, 0x43, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x6e, 0x0a, 0x17, 0x6c, 0x65, 0x61, 0x73, 0x74, 0x5f, 0x72, + 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x6c, 0x62, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, + 0x18, 0x25, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x35, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, - 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x4c, 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, - 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x4c, 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, - 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x46, 0x61, 0x6c, 0x6c, 0x62, 0x61, 0x63, 0x6b, - 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x82, 0x01, 0x02, 0x10, 0x01, - 0x52, 0x16, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x46, 0x61, 0x6c, 0x6c, 0x62, 0x61, - 0x63, 0x6b, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x1a, 0xda, 0x03, 0x0a, 0x10, 0x4c, 0x62, 0x53, - 0x75, 0x62, 0x73, 0x65, 0x74, 0x53, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x12, 0x12, 0x0a, - 0x04, 0x6b, 0x65, 0x79, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x09, 0x52, 0x04, 0x6b, 0x65, 0x79, - 0x73, 0x12, 0x33, 0x0a, 0x16, 0x73, 0x69, 0x6e, 0x67, 0x6c, 0x65, 0x5f, 0x68, 0x6f, 0x73, 0x74, - 0x5f, 0x70, 0x65, 0x72, 0x5f, 0x73, 0x75, 0x62, 0x73, 0x65, 0x74, 0x18, 0x04, 0x20, 0x01, 0x28, - 0x08, 0x52, 0x13, 0x73, 0x69, 0x6e, 0x67, 0x6c, 0x65, 0x48, 0x6f, 0x73, 0x74, 0x50, 0x65, 0x72, - 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x12, 0x92, 0x01, 0x0a, 0x0f, 0x66, 0x61, 0x6c, 0x6c, 0x62, - 0x61, 0x63, 0x6b, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, - 0x32, 0x5f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, + 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x4c, 0x65, 0x61, 0x73, 0x74, 0x52, 0x65, + 0x71, 0x75, 0x65, 0x73, 0x74, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x48, 0x01, 0x52, + 0x14, 0x6c, 0x65, 0x61, 0x73, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x4c, 0x62, 0x43, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x68, 0x0a, 0x15, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x5f, 0x72, + 0x6f, 0x62, 0x69, 0x6e, 0x5f, 0x6c, 0x62, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x38, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x33, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, + 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x52, 0x6f, 0x75, 0x6e, 0x64, 0x52, 0x6f, 0x62, 0x69, + 0x6e, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x48, 0x01, 0x52, 0x12, 0x72, 0x6f, 0x75, + 0x6e, 0x64, 0x52, 0x6f, 0x62, 0x69, 0x6e, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, + 0x59, 0x0a, 0x10, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x5f, 0x6c, 0x62, 0x5f, 0x63, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x18, 0x1b, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, + 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, + 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, + 0x6f, 0x6e, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x0e, 0x63, 0x6f, 0x6d, 0x6d, + 0x6f, 0x6e, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x50, 0x0a, 0x10, 0x74, 0x72, + 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x18, 0x18, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x72, 0x61, 0x6e, + 0x73, 0x70, 0x6f, 0x72, 0x74, 0x53, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x0f, 0x74, 0x72, 0x61, + 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x53, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x3a, 0x0a, 0x08, + 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x18, 0x19, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1e, + 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, + 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x52, 0x08, + 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x12, 0x75, 0x0a, 0x12, 0x70, 0x72, 0x6f, 0x74, + 0x6f, 0x63, 0x6f, 0x6c, 0x5f, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x1a, + 0x20, 0x01, 0x28, 0x0e, 0x32, 0x39, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, + 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x50, 0x72, + 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x53, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x42, + 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x52, 0x11, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x53, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, + 0x72, 0x0a, 0x1b, 0x75, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x5f, 0x63, 0x6f, 0x6e, 0x6e, + 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x1e, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x32, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x55, + 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, + 0x6e, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x19, 0x75, 0x70, 0x73, 0x74, 0x72, 0x65, + 0x61, 0x6d, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x4f, 0x70, 0x74, 0x69, + 0x6f, 0x6e, 0x73, 0x12, 0x55, 0x0a, 0x28, 0x63, 0x6c, 0x6f, 0x73, 0x65, 0x5f, 0x63, 0x6f, 0x6e, + 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x5f, 0x6f, 0x6e, 0x5f, 0x68, 0x6f, 0x73, 0x74, + 0x5f, 0x68, 0x65, 0x61, 0x6c, 0x74, 0x68, 0x5f, 0x66, 0x61, 0x69, 0x6c, 0x75, 0x72, 0x65, 0x18, + 0x1f, 0x20, 0x01, 0x28, 0x08, 0x52, 0x23, 0x63, 0x6c, 0x6f, 0x73, 0x65, 0x43, 0x6f, 0x6e, 0x6e, + 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x4f, 0x6e, 0x48, 0x6f, 0x73, 0x74, 0x48, 0x65, 0x61, + 0x6c, 0x74, 0x68, 0x46, 0x61, 0x69, 0x6c, 0x75, 0x72, 0x65, 0x12, 0x40, 0x0a, 0x1d, 0x69, 0x67, + 0x6e, 0x6f, 0x72, 0x65, 0x5f, 0x68, 0x65, 0x61, 0x6c, 0x74, 0x68, 0x5f, 0x6f, 0x6e, 0x5f, 0x68, + 0x6f, 0x73, 0x74, 0x5f, 0x72, 0x65, 0x6d, 0x6f, 0x76, 0x61, 0x6c, 0x18, 0x20, 0x20, 0x01, 0x28, + 0x08, 0x52, 0x19, 0x69, 0x67, 0x6e, 0x6f, 0x72, 0x65, 0x48, 0x65, 0x61, 0x6c, 0x74, 0x68, 0x4f, + 0x6e, 0x48, 0x6f, 0x73, 0x74, 0x52, 0x65, 0x6d, 0x6f, 0x76, 0x61, 0x6c, 0x12, 0x39, 0x0a, 0x07, + 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x73, 0x18, 0x28, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x1f, 0x2e, + 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, + 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x52, 0x07, + 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x73, 0x12, 0x60, 0x0a, 0x15, 0x6c, 0x6f, 0x61, 0x64, 0x5f, + 0x62, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x69, 0x6e, 0x67, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, + 0x18, 0x29, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, + 0x2e, 0x4c, 0x6f, 0x61, 0x64, 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x69, 0x6e, 0x67, 0x50, 0x6f, + 0x6c, 0x69, 0x63, 0x79, 0x52, 0x13, 0x6c, 0x6f, 0x61, 0x64, 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, + 0x69, 0x6e, 0x67, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x41, 0x0a, 0x0a, 0x6c, 0x72, 0x73, + 0x5f, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, 0x18, 0x2a, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, + 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, + 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x53, 0x6f, 0x75, 0x72, 0x63, + 0x65, 0x52, 0x09, 0x6c, 0x72, 0x73, 0x53, 0x65, 0x72, 0x76, 0x65, 0x72, 0x12, 0x3d, 0x0a, 0x1b, + 0x6c, 0x72, 0x73, 0x5f, 0x72, 0x65, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x65, 0x6e, 0x64, 0x70, 0x6f, + 0x69, 0x6e, 0x74, 0x5f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x73, 0x18, 0x39, 0x20, 0x03, 0x28, + 0x09, 0x52, 0x18, 0x6c, 0x72, 0x73, 0x52, 0x65, 0x70, 0x6f, 0x72, 0x74, 0x45, 0x6e, 0x64, 0x70, + 0x6f, 0x69, 0x6e, 0x74, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x73, 0x12, 0x3f, 0x0a, 0x15, 0x74, + 0x72, 0x61, 0x63, 0x6b, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x5f, 0x62, 0x75, 0x64, + 0x67, 0x65, 0x74, 0x73, 0x18, 0x2f, 0x20, 0x01, 0x28, 0x08, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, + 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x52, 0x13, 0x74, 0x72, 0x61, 0x63, 0x6b, 0x54, 0x69, + 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x42, 0x75, 0x64, 0x67, 0x65, 0x74, 0x73, 0x12, 0x53, 0x0a, 0x0f, + 0x75, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, + 0x30, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, + 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x79, 0x70, + 0x65, 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, + 0x67, 0x52, 0x0e, 0x75, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x43, 0x6f, 0x6e, 0x66, 0x69, + 0x67, 0x12, 0x5a, 0x0a, 0x13, 0x74, 0x72, 0x61, 0x63, 0x6b, 0x5f, 0x63, 0x6c, 0x75, 0x73, 0x74, + 0x65, 0x72, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x73, 0x18, 0x31, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, + 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, + 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x72, 0x61, 0x63, 0x6b, 0x43, 0x6c, + 0x75, 0x73, 0x74, 0x65, 0x72, 0x53, 0x74, 0x61, 0x74, 0x73, 0x52, 0x11, 0x74, 0x72, 0x61, 0x63, + 0x6b, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x53, 0x74, 0x61, 0x74, 0x73, 0x12, 0x5e, 0x0a, + 0x11, 0x70, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x5f, 0x70, 0x6f, 0x6c, 0x69, + 0x63, 0x79, 0x18, 0x32, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x31, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, + 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, + 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x50, 0x72, 0x65, 0x63, 0x6f, + 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x10, 0x70, 0x72, 0x65, + 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x58, 0x0a, + 0x29, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x70, 0x6f, 0x6f, 0x6c, + 0x5f, 0x70, 0x65, 0x72, 0x5f, 0x64, 0x6f, 0x77, 0x6e, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x5f, + 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x33, 0x20, 0x01, 0x28, 0x08, + 0x52, 0x25, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x6f, 0x6f, 0x6c, + 0x50, 0x65, 0x72, 0x44, 0x6f, 0x77, 0x6e, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x43, 0x6f, 0x6e, + 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0xe6, 0x01, 0x0a, 0x14, 0x54, 0x72, 0x61, 0x6e, + 0x73, 0x70, 0x6f, 0x72, 0x74, 0x53, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, + 0x12, 0x1b, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, + 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x2d, 0x0a, + 0x05, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x17, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, + 0x74, 0x72, 0x75, 0x63, 0x74, 0x52, 0x05, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x50, 0x0a, 0x10, + 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, + 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x72, + 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x53, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x52, 0x0f, 0x74, + 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x53, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x3a, 0x30, + 0x9a, 0xc5, 0x88, 0x1e, 0x2b, 0x0a, 0x29, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, + 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x54, 0x72, 0x61, 0x6e, + 0x73, 0x70, 0x6f, 0x72, 0x74, 0x53, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, + 0x1a, 0x98, 0x01, 0x0a, 0x11, 0x43, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x43, 0x6c, 0x75, 0x73, 0x74, + 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, 0x12, 0x1b, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, + 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x04, 0x6e, + 0x61, 0x6d, 0x65, 0x12, 0x37, 0x0a, 0x0c, 0x74, 0x79, 0x70, 0x65, 0x64, 0x5f, 0x63, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x14, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x41, 0x6e, 0x79, 0x52, + 0x0b, 0x74, 0x79, 0x70, 0x65, 0x64, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x3a, 0x2d, 0x9a, 0xc5, + 0x88, 0x1e, 0x28, 0x0a, 0x26, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, + 0x32, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x43, 0x75, 0x73, 0x74, 0x6f, 0x6d, + 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, 0x1a, 0xa6, 0x01, 0x0a, 0x10, + 0x45, 0x64, 0x73, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, + 0x12, 0x41, 0x0a, 0x0a, 0x65, 0x64, 0x73, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x01, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6f, 0x6e, 0x66, + 0x69, 0x67, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x52, 0x09, 0x65, 0x64, 0x73, 0x43, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x12, 0x21, 0x0a, 0x0c, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x5f, 0x6e, + 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x73, 0x65, 0x72, 0x76, 0x69, + 0x63, 0x65, 0x4e, 0x61, 0x6d, 0x65, 0x3a, 0x2c, 0x9a, 0xc5, 0x88, 0x1e, 0x27, 0x0a, 0x25, 0x65, + 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6c, 0x75, 0x73, + 0x74, 0x65, 0x72, 0x2e, 0x45, 0x64, 0x73, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x43, 0x6f, + 0x6e, 0x66, 0x69, 0x67, 0x1a, 0xa4, 0x0a, 0x0a, 0x0e, 0x4c, 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, + 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x79, 0x0a, 0x0f, 0x66, 0x61, 0x6c, 0x6c, 0x62, + 0x61, 0x63, 0x6b, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, + 0x32, 0x46, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x4c, 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x2e, 0x4c, 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x53, 0x65, 0x6c, 0x65, 0x63, 0x74, - 0x6f, 0x72, 0x2e, 0x4c, 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x53, 0x65, 0x6c, 0x65, 0x63, - 0x74, 0x6f, 0x72, 0x46, 0x61, 0x6c, 0x6c, 0x62, 0x61, 0x63, 0x6b, 0x50, 0x6f, 0x6c, 0x69, 0x63, - 0x79, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x82, 0x01, 0x02, 0x10, 0x01, 0x52, 0x0e, 0x66, 0x61, 0x6c, - 0x6c, 0x62, 0x61, 0x63, 0x6b, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x30, 0x0a, 0x14, 0x66, - 0x61, 0x6c, 0x6c, 0x62, 0x61, 0x63, 0x6b, 0x5f, 0x6b, 0x65, 0x79, 0x73, 0x5f, 0x73, 0x75, 0x62, - 0x73, 0x65, 0x74, 0x18, 0x03, 0x20, 0x03, 0x28, 0x09, 0x52, 0x12, 0x66, 0x61, 0x6c, 0x6c, 0x62, - 0x61, 0x63, 0x6b, 0x4b, 0x65, 0x79, 0x73, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x22, 0x79, 0x0a, - 0x1e, 0x4c, 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x53, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, - 0x72, 0x46, 0x61, 0x6c, 0x6c, 0x62, 0x61, 0x63, 0x6b, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, - 0x0f, 0x0a, 0x0b, 0x4e, 0x4f, 0x54, 0x5f, 0x44, 0x45, 0x46, 0x49, 0x4e, 0x45, 0x44, 0x10, 0x00, - 0x12, 0x0f, 0x0a, 0x0b, 0x4e, 0x4f, 0x5f, 0x46, 0x41, 0x4c, 0x4c, 0x42, 0x41, 0x43, 0x4b, 0x10, - 0x01, 0x12, 0x10, 0x0a, 0x0c, 0x41, 0x4e, 0x59, 0x5f, 0x45, 0x4e, 0x44, 0x50, 0x4f, 0x49, 0x4e, - 0x54, 0x10, 0x02, 0x12, 0x12, 0x0a, 0x0e, 0x44, 0x45, 0x46, 0x41, 0x55, 0x4c, 0x54, 0x5f, 0x53, - 0x55, 0x42, 0x53, 0x45, 0x54, 0x10, 0x03, 0x12, 0x0f, 0x0a, 0x0b, 0x4b, 0x45, 0x59, 0x53, 0x5f, - 0x53, 0x55, 0x42, 0x53, 0x45, 0x54, 0x10, 0x04, 0x3a, 0x3b, 0x9a, 0xc5, 0x88, 0x1e, 0x36, 0x0a, - 0x34, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6c, - 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x4c, 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x43, 0x6f, - 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x4c, 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x53, 0x65, 0x6c, - 0x65, 0x63, 0x74, 0x6f, 0x72, 0x22, 0x4f, 0x0a, 0x16, 0x4c, 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, - 0x74, 0x46, 0x61, 0x6c, 0x6c, 0x62, 0x61, 0x63, 0x6b, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, - 0x0f, 0x0a, 0x0b, 0x4e, 0x4f, 0x5f, 0x46, 0x41, 0x4c, 0x4c, 0x42, 0x41, 0x43, 0x4b, 0x10, 0x00, - 0x12, 0x10, 0x0a, 0x0c, 0x41, 0x4e, 0x59, 0x5f, 0x45, 0x4e, 0x44, 0x50, 0x4f, 0x49, 0x4e, 0x54, - 0x10, 0x01, 0x12, 0x12, 0x0a, 0x0e, 0x44, 0x45, 0x46, 0x41, 0x55, 0x4c, 0x54, 0x5f, 0x53, 0x55, - 0x42, 0x53, 0x45, 0x54, 0x10, 0x02, 0x22, 0x4d, 0x0a, 0x1e, 0x4c, 0x62, 0x53, 0x75, 0x62, 0x73, - 0x65, 0x74, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x46, 0x61, 0x6c, 0x6c, 0x62, 0x61, - 0x63, 0x6b, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x18, 0x0a, 0x14, 0x4d, 0x45, 0x54, 0x41, - 0x44, 0x41, 0x54, 0x41, 0x5f, 0x4e, 0x4f, 0x5f, 0x46, 0x41, 0x4c, 0x4c, 0x42, 0x41, 0x43, 0x4b, - 0x10, 0x00, 0x12, 0x11, 0x0a, 0x0d, 0x46, 0x41, 0x4c, 0x4c, 0x42, 0x41, 0x43, 0x4b, 0x5f, 0x4c, - 0x49, 0x53, 0x54, 0x10, 0x01, 0x3a, 0x2a, 0x9a, 0xc5, 0x88, 0x1e, 0x25, 0x0a, 0x23, 0x65, 0x6e, - 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, + 0x67, 0x2e, 0x4c, 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x46, 0x61, 0x6c, 0x6c, 0x62, 0x61, + 0x63, 0x6b, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x82, 0x01, 0x02, + 0x10, 0x01, 0x52, 0x0e, 0x66, 0x61, 0x6c, 0x6c, 0x62, 0x61, 0x63, 0x6b, 0x50, 0x6f, 0x6c, 0x69, + 0x63, 0x79, 0x12, 0x3e, 0x0a, 0x0e, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, 0x73, 0x75, + 0x62, 0x73, 0x65, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x17, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x74, 0x72, + 0x75, 0x63, 0x74, 0x52, 0x0d, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x53, 0x75, 0x62, 0x73, + 0x65, 0x74, 0x12, 0x6b, 0x0a, 0x10, 0x73, 0x75, 0x62, 0x73, 0x65, 0x74, 0x5f, 0x73, 0x65, 0x6c, + 0x65, 0x63, 0x74, 0x6f, 0x72, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x40, 0x2e, 0x65, + 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, + 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x4c, + 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x4c, 0x62, + 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x53, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x52, 0x0f, + 0x73, 0x75, 0x62, 0x73, 0x65, 0x74, 0x53, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x73, 0x12, + 0x32, 0x0a, 0x15, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x74, 0x79, 0x5f, 0x77, 0x65, 0x69, 0x67, + 0x68, 0x74, 0x5f, 0x61, 0x77, 0x61, 0x72, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x08, 0x52, 0x13, + 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x74, 0x79, 0x57, 0x65, 0x69, 0x67, 0x68, 0x74, 0x41, 0x77, + 0x61, 0x72, 0x65, 0x12, 0x32, 0x0a, 0x15, 0x73, 0x63, 0x61, 0x6c, 0x65, 0x5f, 0x6c, 0x6f, 0x63, + 0x61, 0x6c, 0x69, 0x74, 0x79, 0x5f, 0x77, 0x65, 0x69, 0x67, 0x68, 0x74, 0x18, 0x05, 0x20, 0x01, + 0x28, 0x08, 0x52, 0x13, 0x73, 0x63, 0x61, 0x6c, 0x65, 0x4c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x74, + 0x79, 0x57, 0x65, 0x69, 0x67, 0x68, 0x74, 0x12, 0x24, 0x0a, 0x0e, 0x70, 0x61, 0x6e, 0x69, 0x63, + 0x5f, 0x6d, 0x6f, 0x64, 0x65, 0x5f, 0x61, 0x6e, 0x79, 0x18, 0x06, 0x20, 0x01, 0x28, 0x08, 0x52, + 0x0c, 0x70, 0x61, 0x6e, 0x69, 0x63, 0x4d, 0x6f, 0x64, 0x65, 0x41, 0x6e, 0x79, 0x12, 0x1e, 0x0a, + 0x0b, 0x6c, 0x69, 0x73, 0x74, 0x5f, 0x61, 0x73, 0x5f, 0x61, 0x6e, 0x79, 0x18, 0x07, 0x20, 0x01, + 0x28, 0x08, 0x52, 0x09, 0x6c, 0x69, 0x73, 0x74, 0x41, 0x73, 0x41, 0x6e, 0x79, 0x12, 0x92, 0x01, + 0x0a, 0x18, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x5f, 0x66, 0x61, 0x6c, 0x6c, 0x62, + 0x61, 0x63, 0x6b, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0e, + 0x32, 0x4e, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, + 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x4c, 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x1a, 0xe3, 0x01, 0x0a, 0x0f, 0x53, 0x6c, 0x6f, 0x77, 0x53, 0x74, 0x61, 0x72, 0x74, 0x43, - 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x45, 0x0a, 0x11, 0x73, 0x6c, 0x6f, 0x77, 0x5f, 0x73, 0x74, - 0x61, 0x72, 0x74, 0x5f, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0f, 0x73, 0x6c, 0x6f, - 0x77, 0x53, 0x74, 0x61, 0x72, 0x74, 0x57, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x12, 0x43, 0x0a, 0x0a, - 0x61, 0x67, 0x67, 0x72, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x23, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, - 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x75, 0x6e, 0x74, 0x69, 0x6d, 0x65, 0x44, - 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x52, 0x0a, 0x61, 0x67, 0x67, 0x72, 0x65, 0x73, 0x73, 0x69, 0x6f, - 0x6e, 0x12, 0x44, 0x0a, 0x12, 0x6d, 0x69, 0x6e, 0x5f, 0x77, 0x65, 0x69, 0x67, 0x68, 0x74, 0x5f, - 0x70, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x16, 0x2e, - 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x65, - 0x72, 0x63, 0x65, 0x6e, 0x74, 0x52, 0x10, 0x6d, 0x69, 0x6e, 0x57, 0x65, 0x69, 0x67, 0x68, 0x74, - 0x50, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74, 0x1a, 0x72, 0x0a, 0x12, 0x52, 0x6f, 0x75, 0x6e, 0x64, - 0x52, 0x6f, 0x62, 0x69, 0x6e, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x5c, 0x0a, + 0x67, 0x2e, 0x4c, 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, + 0x74, 0x61, 0x46, 0x61, 0x6c, 0x6c, 0x62, 0x61, 0x63, 0x6b, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, + 0x42, 0x08, 0xfa, 0x42, 0x05, 0x82, 0x01, 0x02, 0x10, 0x01, 0x52, 0x16, 0x6d, 0x65, 0x74, 0x61, + 0x64, 0x61, 0x74, 0x61, 0x46, 0x61, 0x6c, 0x6c, 0x62, 0x61, 0x63, 0x6b, 0x50, 0x6f, 0x6c, 0x69, + 0x63, 0x79, 0x1a, 0xda, 0x03, 0x0a, 0x10, 0x4c, 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x53, + 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x12, 0x12, 0x0a, 0x04, 0x6b, 0x65, 0x79, 0x73, 0x18, + 0x01, 0x20, 0x03, 0x28, 0x09, 0x52, 0x04, 0x6b, 0x65, 0x79, 0x73, 0x12, 0x33, 0x0a, 0x16, 0x73, + 0x69, 0x6e, 0x67, 0x6c, 0x65, 0x5f, 0x68, 0x6f, 0x73, 0x74, 0x5f, 0x70, 0x65, 0x72, 0x5f, 0x73, + 0x75, 0x62, 0x73, 0x65, 0x74, 0x18, 0x04, 0x20, 0x01, 0x28, 0x08, 0x52, 0x13, 0x73, 0x69, 0x6e, + 0x67, 0x6c, 0x65, 0x48, 0x6f, 0x73, 0x74, 0x50, 0x65, 0x72, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, + 0x12, 0x92, 0x01, 0x0a, 0x0f, 0x66, 0x61, 0x6c, 0x6c, 0x62, 0x61, 0x63, 0x6b, 0x5f, 0x70, 0x6f, + 0x6c, 0x69, 0x63, 0x79, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x5f, 0x2e, 0x65, 0x6e, 0x76, + 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, + 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x4c, 0x62, 0x53, + 0x75, 0x62, 0x73, 0x65, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x4c, 0x62, 0x53, 0x75, + 0x62, 0x73, 0x65, 0x74, 0x53, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x2e, 0x4c, 0x62, 0x53, + 0x75, 0x62, 0x73, 0x65, 0x74, 0x53, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x46, 0x61, 0x6c, + 0x6c, 0x62, 0x61, 0x63, 0x6b, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x42, 0x08, 0xfa, 0x42, 0x05, + 0x82, 0x01, 0x02, 0x10, 0x01, 0x52, 0x0e, 0x66, 0x61, 0x6c, 0x6c, 0x62, 0x61, 0x63, 0x6b, 0x50, + 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x30, 0x0a, 0x14, 0x66, 0x61, 0x6c, 0x6c, 0x62, 0x61, 0x63, + 0x6b, 0x5f, 0x6b, 0x65, 0x79, 0x73, 0x5f, 0x73, 0x75, 0x62, 0x73, 0x65, 0x74, 0x18, 0x03, 0x20, + 0x03, 0x28, 0x09, 0x52, 0x12, 0x66, 0x61, 0x6c, 0x6c, 0x62, 0x61, 0x63, 0x6b, 0x4b, 0x65, 0x79, + 0x73, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x22, 0x79, 0x0a, 0x1e, 0x4c, 0x62, 0x53, 0x75, 0x62, + 0x73, 0x65, 0x74, 0x53, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x46, 0x61, 0x6c, 0x6c, 0x62, + 0x61, 0x63, 0x6b, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x0f, 0x0a, 0x0b, 0x4e, 0x4f, 0x54, + 0x5f, 0x44, 0x45, 0x46, 0x49, 0x4e, 0x45, 0x44, 0x10, 0x00, 0x12, 0x0f, 0x0a, 0x0b, 0x4e, 0x4f, + 0x5f, 0x46, 0x41, 0x4c, 0x4c, 0x42, 0x41, 0x43, 0x4b, 0x10, 0x01, 0x12, 0x10, 0x0a, 0x0c, 0x41, + 0x4e, 0x59, 0x5f, 0x45, 0x4e, 0x44, 0x50, 0x4f, 0x49, 0x4e, 0x54, 0x10, 0x02, 0x12, 0x12, 0x0a, + 0x0e, 0x44, 0x45, 0x46, 0x41, 0x55, 0x4c, 0x54, 0x5f, 0x53, 0x55, 0x42, 0x53, 0x45, 0x54, 0x10, + 0x03, 0x12, 0x0f, 0x0a, 0x0b, 0x4b, 0x45, 0x59, 0x53, 0x5f, 0x53, 0x55, 0x42, 0x53, 0x45, 0x54, + 0x10, 0x04, 0x3a, 0x3b, 0x9a, 0xc5, 0x88, 0x1e, 0x36, 0x0a, 0x34, 0x65, 0x6e, 0x76, 0x6f, 0x79, + 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, + 0x4c, 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x4c, + 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x53, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x22, + 0x4f, 0x0a, 0x16, 0x4c, 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x46, 0x61, 0x6c, 0x6c, 0x62, + 0x61, 0x63, 0x6b, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x0f, 0x0a, 0x0b, 0x4e, 0x4f, 0x5f, + 0x46, 0x41, 0x4c, 0x4c, 0x42, 0x41, 0x43, 0x4b, 0x10, 0x00, 0x12, 0x10, 0x0a, 0x0c, 0x41, 0x4e, + 0x59, 0x5f, 0x45, 0x4e, 0x44, 0x50, 0x4f, 0x49, 0x4e, 0x54, 0x10, 0x01, 0x12, 0x12, 0x0a, 0x0e, + 0x44, 0x45, 0x46, 0x41, 0x55, 0x4c, 0x54, 0x5f, 0x53, 0x55, 0x42, 0x53, 0x45, 0x54, 0x10, 0x02, + 0x22, 0x4d, 0x0a, 0x1e, 0x4c, 0x62, 0x53, 0x75, 0x62, 0x73, 0x65, 0x74, 0x4d, 0x65, 0x74, 0x61, + 0x64, 0x61, 0x74, 0x61, 0x46, 0x61, 0x6c, 0x6c, 0x62, 0x61, 0x63, 0x6b, 0x50, 0x6f, 0x6c, 0x69, + 0x63, 0x79, 0x12, 0x18, 0x0a, 0x14, 0x4d, 0x45, 0x54, 0x41, 0x44, 0x41, 0x54, 0x41, 0x5f, 0x4e, + 0x4f, 0x5f, 0x46, 0x41, 0x4c, 0x4c, 0x42, 0x41, 0x43, 0x4b, 0x10, 0x00, 0x12, 0x11, 0x0a, 0x0d, + 0x46, 0x41, 0x4c, 0x4c, 0x42, 0x41, 0x43, 0x4b, 0x5f, 0x4c, 0x49, 0x53, 0x54, 0x10, 0x01, 0x3a, + 0x2a, 0x9a, 0xc5, 0x88, 0x1e, 0x25, 0x0a, 0x23, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, + 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x4c, 0x62, 0x53, + 0x75, 0x62, 0x73, 0x65, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x1a, 0xe3, 0x01, 0x0a, 0x0f, + 0x53, 0x6c, 0x6f, 0x77, 0x53, 0x74, 0x61, 0x72, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, + 0x45, 0x0a, 0x11, 0x73, 0x6c, 0x6f, 0x77, 0x5f, 0x73, 0x74, 0x61, 0x72, 0x74, 0x5f, 0x77, 0x69, + 0x6e, 0x64, 0x6f, 0x77, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0f, 0x73, 0x6c, 0x6f, 0x77, 0x53, 0x74, 0x61, 0x72, 0x74, + 0x57, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x12, 0x43, 0x0a, 0x0a, 0x61, 0x67, 0x67, 0x72, 0x65, 0x73, + 0x73, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x23, 0x2e, 0x65, 0x6e, 0x76, + 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, + 0x33, 0x2e, 0x52, 0x75, 0x6e, 0x74, 0x69, 0x6d, 0x65, 0x44, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x52, + 0x0a, 0x61, 0x67, 0x67, 0x72, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x44, 0x0a, 0x12, 0x6d, + 0x69, 0x6e, 0x5f, 0x77, 0x65, 0x69, 0x67, 0x68, 0x74, 0x5f, 0x70, 0x65, 0x72, 0x63, 0x65, 0x6e, + 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x16, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, + 0x74, 0x79, 0x70, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74, 0x52, + 0x10, 0x6d, 0x69, 0x6e, 0x57, 0x65, 0x69, 0x67, 0x68, 0x74, 0x50, 0x65, 0x72, 0x63, 0x65, 0x6e, + 0x74, 0x1a, 0x72, 0x0a, 0x12, 0x52, 0x6f, 0x75, 0x6e, 0x64, 0x52, 0x6f, 0x62, 0x69, 0x6e, 0x4c, + 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x5c, 0x0a, 0x11, 0x73, 0x6c, 0x6f, 0x77, 0x5f, + 0x73, 0x74, 0x61, 0x72, 0x74, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x01, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x30, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, + 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, + 0x73, 0x74, 0x65, 0x72, 0x2e, 0x53, 0x6c, 0x6f, 0x77, 0x53, 0x74, 0x61, 0x72, 0x74, 0x43, 0x6f, + 0x6e, 0x66, 0x69, 0x67, 0x52, 0x0f, 0x73, 0x6c, 0x6f, 0x77, 0x53, 0x74, 0x61, 0x72, 0x74, 0x43, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x1a, 0xc5, 0x02, 0x0a, 0x14, 0x4c, 0x65, 0x61, 0x73, 0x74, 0x52, + 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x48, + 0x0a, 0x0c, 0x63, 0x68, 0x6f, 0x69, 0x63, 0x65, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x01, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, + 0x75, 0x65, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x2a, 0x02, 0x28, 0x02, 0x52, 0x0b, 0x63, 0x68, 0x6f, + 0x69, 0x63, 0x65, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x12, 0x53, 0x0a, 0x13, 0x61, 0x63, 0x74, 0x69, + 0x76, 0x65, 0x5f, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x62, 0x69, 0x61, 0x73, 0x18, + 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x23, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, + 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x75, 0x6e, + 0x74, 0x69, 0x6d, 0x65, 0x44, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x52, 0x11, 0x61, 0x63, 0x74, 0x69, + 0x76, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x42, 0x69, 0x61, 0x73, 0x12, 0x5c, 0x0a, 0x11, 0x73, 0x6c, 0x6f, 0x77, 0x5f, 0x73, 0x74, 0x61, 0x72, 0x74, 0x5f, 0x63, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x30, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, + 0x69, 0x67, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x30, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x53, 0x6c, 0x6f, 0x77, 0x53, 0x74, 0x61, 0x72, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x0f, 0x73, 0x6c, 0x6f, 0x77, - 0x53, 0x74, 0x61, 0x72, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x1a, 0xc5, 0x02, 0x0a, 0x14, - 0x4c, 0x65, 0x61, 0x73, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x4c, 0x62, 0x43, 0x6f, - 0x6e, 0x66, 0x69, 0x67, 0x12, 0x48, 0x0a, 0x0c, 0x63, 0x68, 0x6f, 0x69, 0x63, 0x65, 0x5f, 0x63, - 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, - 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x2a, 0x02, 0x28, - 0x02, 0x52, 0x0b, 0x63, 0x68, 0x6f, 0x69, 0x63, 0x65, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x12, 0x53, - 0x0a, 0x13, 0x61, 0x63, 0x74, 0x69, 0x76, 0x65, 0x5f, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, - 0x5f, 0x62, 0x69, 0x61, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x23, 0x2e, 0x65, 0x6e, - 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, - 0x76, 0x33, 0x2e, 0x52, 0x75, 0x6e, 0x74, 0x69, 0x6d, 0x65, 0x44, 0x6f, 0x75, 0x62, 0x6c, 0x65, - 0x52, 0x11, 0x61, 0x63, 0x74, 0x69, 0x76, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x42, - 0x69, 0x61, 0x73, 0x12, 0x5c, 0x0a, 0x11, 0x73, 0x6c, 0x6f, 0x77, 0x5f, 0x73, 0x74, 0x61, 0x72, - 0x74, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x30, - 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, - 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, - 0x2e, 0x53, 0x6c, 0x6f, 0x77, 0x53, 0x74, 0x61, 0x72, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x52, 0x0f, 0x73, 0x6c, 0x6f, 0x77, 0x53, 0x74, 0x61, 0x72, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x3a, 0x30, 0x9a, 0xc5, 0x88, 0x1e, 0x2b, 0x0a, 0x29, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, - 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x4c, - 0x65, 0x61, 0x73, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x4c, 0x62, 0x43, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x1a, 0x91, 0x03, 0x0a, 0x10, 0x52, 0x69, 0x6e, 0x67, 0x48, 0x61, 0x73, 0x68, - 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x54, 0x0a, 0x11, 0x6d, 0x69, 0x6e, 0x69, - 0x6d, 0x75, 0x6d, 0x5f, 0x72, 0x69, 0x6e, 0x67, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x36, 0x34, 0x56, 0x61, 0x6c, 0x75, - 0x65, 0x42, 0x0a, 0xfa, 0x42, 0x07, 0x32, 0x05, 0x18, 0x80, 0x80, 0x80, 0x04, 0x52, 0x0f, 0x6d, - 0x69, 0x6e, 0x69, 0x6d, 0x75, 0x6d, 0x52, 0x69, 0x6e, 0x67, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x6d, - 0x0a, 0x0d, 0x68, 0x61, 0x73, 0x68, 0x5f, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x18, - 0x03, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x3e, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, - 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, - 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x52, 0x69, 0x6e, 0x67, 0x48, 0x61, 0x73, 0x68, - 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x48, 0x61, 0x73, 0x68, 0x46, 0x75, 0x6e, - 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x82, 0x01, 0x02, 0x10, 0x01, 0x52, - 0x0c, 0x68, 0x61, 0x73, 0x68, 0x46, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x54, 0x0a, - 0x11, 0x6d, 0x61, 0x78, 0x69, 0x6d, 0x75, 0x6d, 0x5f, 0x72, 0x69, 0x6e, 0x67, 0x5f, 0x73, 0x69, - 0x7a, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x36, - 0x34, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x0a, 0xfa, 0x42, 0x07, 0x32, 0x05, 0x18, 0x80, 0x80, - 0x80, 0x04, 0x52, 0x0f, 0x6d, 0x61, 0x78, 0x69, 0x6d, 0x75, 0x6d, 0x52, 0x69, 0x6e, 0x67, 0x53, - 0x69, 0x7a, 0x65, 0x22, 0x2e, 0x0a, 0x0c, 0x48, 0x61, 0x73, 0x68, 0x46, 0x75, 0x6e, 0x63, 0x74, - 0x69, 0x6f, 0x6e, 0x12, 0x0b, 0x0a, 0x07, 0x58, 0x58, 0x5f, 0x48, 0x41, 0x53, 0x48, 0x10, 0x00, - 0x12, 0x11, 0x0a, 0x0d, 0x4d, 0x55, 0x52, 0x4d, 0x55, 0x52, 0x5f, 0x48, 0x41, 0x53, 0x48, 0x5f, - 0x32, 0x10, 0x01, 0x3a, 0x2c, 0x9a, 0xc5, 0x88, 0x1e, 0x27, 0x0a, 0x25, 0x65, 0x6e, 0x76, 0x6f, - 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, - 0x2e, 0x52, 0x69, 0x6e, 0x67, 0x48, 0x61, 0x73, 0x68, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x4a, 0x04, 0x08, 0x02, 0x10, 0x03, 0x1a, 0x59, 0x0a, 0x0e, 0x4d, 0x61, 0x67, 0x6c, 0x65, - 0x76, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x47, 0x0a, 0x0a, 0x74, 0x61, 0x62, - 0x6c, 0x65, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, + 0x53, 0x74, 0x61, 0x72, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x3a, 0x30, 0x9a, 0xc5, 0x88, + 0x1e, 0x2b, 0x0a, 0x29, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, + 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x4c, 0x65, 0x61, 0x73, 0x74, 0x52, 0x65, + 0x71, 0x75, 0x65, 0x73, 0x74, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x1a, 0x91, 0x03, + 0x0a, 0x10, 0x52, 0x69, 0x6e, 0x67, 0x48, 0x61, 0x73, 0x68, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, + 0x69, 0x67, 0x12, 0x54, 0x0a, 0x11, 0x6d, 0x69, 0x6e, 0x69, 0x6d, 0x75, 0x6d, 0x5f, 0x72, 0x69, + 0x6e, 0x67, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x36, 0x34, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x0a, 0xfa, 0x42, 0x07, - 0x32, 0x05, 0x18, 0xcb, 0x96, 0xb1, 0x02, 0x52, 0x09, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x53, 0x69, - 0x7a, 0x65, 0x1a, 0xbf, 0x02, 0x0a, 0x13, 0x4f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x61, 0x6c, 0x44, - 0x73, 0x74, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x26, 0x0a, 0x0f, 0x75, 0x73, - 0x65, 0x5f, 0x68, 0x74, 0x74, 0x70, 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x08, 0x52, 0x0d, 0x75, 0x73, 0x65, 0x48, 0x74, 0x74, 0x70, 0x48, 0x65, 0x61, 0x64, - 0x65, 0x72, 0x12, 0x28, 0x0a, 0x10, 0x68, 0x74, 0x74, 0x70, 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, - 0x72, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0e, 0x68, 0x74, - 0x74, 0x70, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x5d, 0x0a, 0x16, - 0x75, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x5f, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x6f, 0x76, - 0x65, 0x72, 0x72, 0x69, 0x64, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, - 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x09, 0xfa, 0x42, 0x06, 0x2a, - 0x04, 0x18, 0xff, 0xff, 0x03, 0x52, 0x14, 0x75, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x50, - 0x6f, 0x72, 0x74, 0x4f, 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, 0x65, 0x12, 0x46, 0x0a, 0x0c, 0x6d, - 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x04, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x23, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x6d, - 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x65, 0x74, 0x61, 0x64, - 0x61, 0x74, 0x61, 0x4b, 0x65, 0x79, 0x52, 0x0b, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, - 0x4b, 0x65, 0x79, 0x3a, 0x2f, 0x9a, 0xc5, 0x88, 0x1e, 0x2a, 0x0a, 0x28, 0x65, 0x6e, 0x76, 0x6f, - 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, - 0x2e, 0x4f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x61, 0x6c, 0x44, 0x73, 0x74, 0x4c, 0x62, 0x43, 0x6f, - 0x6e, 0x66, 0x69, 0x67, 0x1a, 0xd5, 0x0b, 0x0a, 0x0e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, - 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x4e, 0x0a, 0x17, 0x68, 0x65, 0x61, 0x6c, 0x74, - 0x68, 0x79, 0x5f, 0x70, 0x61, 0x6e, 0x69, 0x63, 0x5f, 0x74, 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, - 0x6c, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x16, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, - 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74, - 0x52, 0x15, 0x68, 0x65, 0x61, 0x6c, 0x74, 0x68, 0x79, 0x50, 0x61, 0x6e, 0x69, 0x63, 0x54, 0x68, - 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x12, 0x74, 0x0a, 0x14, 0x7a, 0x6f, 0x6e, 0x65, 0x5f, - 0x61, 0x77, 0x61, 0x72, 0x65, 0x5f, 0x6c, 0x62, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x41, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, - 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, - 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x62, - 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x5a, 0x6f, 0x6e, 0x65, 0x41, 0x77, 0x61, 0x72, 0x65, - 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x48, 0x00, 0x52, 0x11, 0x7a, 0x6f, 0x6e, 0x65, - 0x41, 0x77, 0x61, 0x72, 0x65, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x89, 0x01, - 0x0a, 0x1b, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x74, 0x79, 0x5f, 0x77, 0x65, 0x69, 0x67, 0x68, - 0x74, 0x65, 0x64, 0x5f, 0x6c, 0x62, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x03, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x48, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, - 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x62, 0x43, 0x6f, - 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x4c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x74, 0x79, 0x57, 0x65, 0x69, - 0x67, 0x68, 0x74, 0x65, 0x64, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x48, 0x00, 0x52, - 0x18, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x74, 0x79, 0x57, 0x65, 0x69, 0x67, 0x68, 0x74, 0x65, - 0x64, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x49, 0x0a, 0x13, 0x75, 0x70, 0x64, - 0x61, 0x74, 0x65, 0x5f, 0x6d, 0x65, 0x72, 0x67, 0x65, 0x5f, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77, - 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x52, 0x11, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x4d, 0x65, 0x72, 0x67, 0x65, 0x57, 0x69, - 0x6e, 0x64, 0x6f, 0x77, 0x12, 0x43, 0x0a, 0x1f, 0x69, 0x67, 0x6e, 0x6f, 0x72, 0x65, 0x5f, 0x6e, - 0x65, 0x77, 0x5f, 0x68, 0x6f, 0x73, 0x74, 0x73, 0x5f, 0x75, 0x6e, 0x74, 0x69, 0x6c, 0x5f, 0x66, - 0x69, 0x72, 0x73, 0x74, 0x5f, 0x68, 0x63, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x52, 0x1a, 0x69, - 0x67, 0x6e, 0x6f, 0x72, 0x65, 0x4e, 0x65, 0x77, 0x48, 0x6f, 0x73, 0x74, 0x73, 0x55, 0x6e, 0x74, - 0x69, 0x6c, 0x46, 0x69, 0x72, 0x73, 0x74, 0x48, 0x63, 0x12, 0x4d, 0x0a, 0x24, 0x63, 0x6c, 0x6f, - 0x73, 0x65, 0x5f, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x5f, 0x6f, - 0x6e, 0x5f, 0x68, 0x6f, 0x73, 0x74, 0x5f, 0x73, 0x65, 0x74, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x67, - 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x08, 0x52, 0x1f, 0x63, 0x6c, 0x6f, 0x73, 0x65, 0x43, 0x6f, - 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x4f, 0x6e, 0x48, 0x6f, 0x73, 0x74, 0x53, - 0x65, 0x74, 0x43, 0x68, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x8a, 0x01, 0x0a, 0x1c, 0x63, 0x6f, 0x6e, - 0x73, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x74, 0x5f, 0x68, 0x61, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x5f, - 0x6c, 0x62, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x49, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, + 0x32, 0x05, 0x18, 0x80, 0x80, 0x80, 0x04, 0x52, 0x0f, 0x6d, 0x69, 0x6e, 0x69, 0x6d, 0x75, 0x6d, + 0x52, 0x69, 0x6e, 0x67, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x6d, 0x0a, 0x0d, 0x68, 0x61, 0x73, 0x68, + 0x5f, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0e, 0x32, + 0x3e, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, + 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, + 0x72, 0x2e, 0x52, 0x69, 0x6e, 0x67, 0x48, 0x61, 0x73, 0x68, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, + 0x69, 0x67, 0x2e, 0x48, 0x61, 0x73, 0x68, 0x46, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x42, + 0x08, 0xfa, 0x42, 0x05, 0x82, 0x01, 0x02, 0x10, 0x01, 0x52, 0x0c, 0x68, 0x61, 0x73, 0x68, 0x46, + 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x54, 0x0a, 0x11, 0x6d, 0x61, 0x78, 0x69, 0x6d, + 0x75, 0x6d, 0x5f, 0x72, 0x69, 0x6e, 0x67, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x04, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, + 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x36, 0x34, 0x56, 0x61, 0x6c, 0x75, 0x65, + 0x42, 0x0a, 0xfa, 0x42, 0x07, 0x32, 0x05, 0x18, 0x80, 0x80, 0x80, 0x04, 0x52, 0x0f, 0x6d, 0x61, + 0x78, 0x69, 0x6d, 0x75, 0x6d, 0x52, 0x69, 0x6e, 0x67, 0x53, 0x69, 0x7a, 0x65, 0x22, 0x2e, 0x0a, + 0x0c, 0x48, 0x61, 0x73, 0x68, 0x46, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x0b, 0x0a, + 0x07, 0x58, 0x58, 0x5f, 0x48, 0x41, 0x53, 0x48, 0x10, 0x00, 0x12, 0x11, 0x0a, 0x0d, 0x4d, 0x55, + 0x52, 0x4d, 0x55, 0x52, 0x5f, 0x48, 0x41, 0x53, 0x48, 0x5f, 0x32, 0x10, 0x01, 0x3a, 0x2c, 0x9a, + 0xc5, 0x88, 0x1e, 0x27, 0x0a, 0x25, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, + 0x76, 0x32, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x52, 0x69, 0x6e, 0x67, 0x48, + 0x61, 0x73, 0x68, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x4a, 0x04, 0x08, 0x02, 0x10, + 0x03, 0x1a, 0x59, 0x0a, 0x0e, 0x4d, 0x61, 0x67, 0x6c, 0x65, 0x76, 0x4c, 0x62, 0x43, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x12, 0x47, 0x0a, 0x0a, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x5f, 0x73, 0x69, 0x7a, + 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x36, 0x34, + 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x0a, 0xfa, 0x42, 0x07, 0x32, 0x05, 0x18, 0xcb, 0x96, 0xb1, + 0x02, 0x52, 0x09, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x53, 0x69, 0x7a, 0x65, 0x1a, 0xbf, 0x02, 0x0a, + 0x13, 0x4f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x61, 0x6c, 0x44, 0x73, 0x74, 0x4c, 0x62, 0x43, 0x6f, + 0x6e, 0x66, 0x69, 0x67, 0x12, 0x26, 0x0a, 0x0f, 0x75, 0x73, 0x65, 0x5f, 0x68, 0x74, 0x74, 0x70, + 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0d, 0x75, + 0x73, 0x65, 0x48, 0x74, 0x74, 0x70, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x12, 0x28, 0x0a, 0x10, + 0x68, 0x74, 0x74, 0x70, 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x5f, 0x6e, 0x61, 0x6d, 0x65, + 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0e, 0x68, 0x74, 0x74, 0x70, 0x48, 0x65, 0x61, 0x64, + 0x65, 0x72, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x5d, 0x0a, 0x16, 0x75, 0x70, 0x73, 0x74, 0x72, 0x65, + 0x61, 0x6d, 0x5f, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x6f, 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, 0x65, + 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, + 0x61, 0x6c, 0x75, 0x65, 0x42, 0x09, 0xfa, 0x42, 0x06, 0x2a, 0x04, 0x18, 0xff, 0xff, 0x03, 0x52, + 0x14, 0x75, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x50, 0x6f, 0x72, 0x74, 0x4f, 0x76, 0x65, + 0x72, 0x72, 0x69, 0x64, 0x65, 0x12, 0x46, 0x0a, 0x0c, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, + 0x61, 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x23, 0x2e, 0x65, 0x6e, + 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, + 0x61, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x4b, 0x65, 0x79, + 0x52, 0x0b, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x4b, 0x65, 0x79, 0x3a, 0x2f, 0x9a, + 0xc5, 0x88, 0x1e, 0x2a, 0x0a, 0x28, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, + 0x76, 0x32, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x4f, 0x72, 0x69, 0x67, 0x69, + 0x6e, 0x61, 0x6c, 0x44, 0x73, 0x74, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x1a, 0xd5, + 0x0b, 0x0a, 0x0e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, + 0x67, 0x12, 0x4e, 0x0a, 0x17, 0x68, 0x65, 0x61, 0x6c, 0x74, 0x68, 0x79, 0x5f, 0x70, 0x61, 0x6e, + 0x69, 0x63, 0x5f, 0x74, 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x18, 0x01, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x16, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, + 0x76, 0x33, 0x2e, 0x50, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74, 0x52, 0x15, 0x68, 0x65, 0x61, 0x6c, + 0x74, 0x68, 0x79, 0x50, 0x61, 0x6e, 0x69, 0x63, 0x54, 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, + 0x64, 0x12, 0x74, 0x0a, 0x14, 0x7a, 0x6f, 0x6e, 0x65, 0x5f, 0x61, 0x77, 0x61, 0x72, 0x65, 0x5f, + 0x6c, 0x62, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x41, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x2e, 0x43, 0x6f, 0x6e, 0x73, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x74, 0x48, 0x61, 0x73, 0x68, 0x69, - 0x6e, 0x67, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x19, 0x63, 0x6f, 0x6e, 0x73, - 0x69, 0x73, 0x74, 0x65, 0x6e, 0x74, 0x48, 0x61, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x4c, 0x62, 0x43, - 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x57, 0x0a, 0x14, 0x6f, 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, - 0x65, 0x5f, 0x68, 0x6f, 0x73, 0x74, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x18, 0x08, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x48, 0x65, 0x61, 0x6c, 0x74, - 0x68, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x53, 0x65, 0x74, 0x52, 0x12, 0x6f, 0x76, 0x65, 0x72, - 0x72, 0x69, 0x64, 0x65, 0x48, 0x6f, 0x73, 0x74, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x1a, 0x8d, - 0x02, 0x0a, 0x11, 0x5a, 0x6f, 0x6e, 0x65, 0x41, 0x77, 0x61, 0x72, 0x65, 0x4c, 0x62, 0x43, 0x6f, - 0x6e, 0x66, 0x69, 0x67, 0x12, 0x3f, 0x0a, 0x0f, 0x72, 0x6f, 0x75, 0x74, 0x69, 0x6e, 0x67, 0x5f, - 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x16, 0x2e, - 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x65, - 0x72, 0x63, 0x65, 0x6e, 0x74, 0x52, 0x0e, 0x72, 0x6f, 0x75, 0x74, 0x69, 0x6e, 0x67, 0x45, 0x6e, - 0x61, 0x62, 0x6c, 0x65, 0x64, 0x12, 0x46, 0x0a, 0x10, 0x6d, 0x69, 0x6e, 0x5f, 0x63, 0x6c, 0x75, - 0x73, 0x74, 0x65, 0x72, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x36, 0x34, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x0e, 0x6d, - 0x69, 0x6e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x31, 0x0a, - 0x15, 0x66, 0x61, 0x69, 0x6c, 0x5f, 0x74, 0x72, 0x61, 0x66, 0x66, 0x69, 0x63, 0x5f, 0x6f, 0x6e, - 0x5f, 0x70, 0x61, 0x6e, 0x69, 0x63, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x52, 0x12, 0x66, 0x61, - 0x69, 0x6c, 0x54, 0x72, 0x61, 0x66, 0x66, 0x69, 0x63, 0x4f, 0x6e, 0x50, 0x61, 0x6e, 0x69, 0x63, - 0x3a, 0x3c, 0x9a, 0xc5, 0x88, 0x1e, 0x37, 0x0a, 0x35, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, - 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x43, 0x6f, - 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x5a, 0x6f, 0x6e, - 0x65, 0x41, 0x77, 0x61, 0x72, 0x65, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x1a, 0x5f, - 0x0a, 0x18, 0x4c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x74, 0x79, 0x57, 0x65, 0x69, 0x67, 0x68, 0x74, - 0x65, 0x64, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x3a, 0x43, 0x9a, 0xc5, 0x88, 0x1e, - 0x3e, 0x0a, 0x3c, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, + 0x2e, 0x5a, 0x6f, 0x6e, 0x65, 0x41, 0x77, 0x61, 0x72, 0x65, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, + 0x69, 0x67, 0x48, 0x00, 0x52, 0x11, 0x7a, 0x6f, 0x6e, 0x65, 0x41, 0x77, 0x61, 0x72, 0x65, 0x4c, + 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x89, 0x01, 0x0a, 0x1b, 0x6c, 0x6f, 0x63, 0x61, + 0x6c, 0x69, 0x74, 0x79, 0x5f, 0x77, 0x65, 0x69, 0x67, 0x68, 0x74, 0x65, 0x64, 0x5f, 0x6c, 0x62, + 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x48, 0x2e, + 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, + 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, + 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x4c, + 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x74, 0x79, 0x57, 0x65, 0x69, 0x67, 0x68, 0x74, 0x65, 0x64, 0x4c, + 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x48, 0x00, 0x52, 0x18, 0x6c, 0x6f, 0x63, 0x61, 0x6c, + 0x69, 0x74, 0x79, 0x57, 0x65, 0x69, 0x67, 0x68, 0x74, 0x65, 0x64, 0x4c, 0x62, 0x43, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x12, 0x49, 0x0a, 0x13, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x5f, 0x6d, 0x65, + 0x72, 0x67, 0x65, 0x5f, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, + 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x11, 0x75, 0x70, 0x64, + 0x61, 0x74, 0x65, 0x4d, 0x65, 0x72, 0x67, 0x65, 0x57, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x12, 0x43, + 0x0a, 0x1f, 0x69, 0x67, 0x6e, 0x6f, 0x72, 0x65, 0x5f, 0x6e, 0x65, 0x77, 0x5f, 0x68, 0x6f, 0x73, + 0x74, 0x73, 0x5f, 0x75, 0x6e, 0x74, 0x69, 0x6c, 0x5f, 0x66, 0x69, 0x72, 0x73, 0x74, 0x5f, 0x68, + 0x63, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x52, 0x1a, 0x69, 0x67, 0x6e, 0x6f, 0x72, 0x65, 0x4e, + 0x65, 0x77, 0x48, 0x6f, 0x73, 0x74, 0x73, 0x55, 0x6e, 0x74, 0x69, 0x6c, 0x46, 0x69, 0x72, 0x73, + 0x74, 0x48, 0x63, 0x12, 0x4d, 0x0a, 0x24, 0x63, 0x6c, 0x6f, 0x73, 0x65, 0x5f, 0x63, 0x6f, 0x6e, + 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x5f, 0x6f, 0x6e, 0x5f, 0x68, 0x6f, 0x73, 0x74, + 0x5f, 0x73, 0x65, 0x74, 0x5f, 0x63, 0x68, 0x61, 0x6e, 0x67, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, + 0x08, 0x52, 0x1f, 0x63, 0x6c, 0x6f, 0x73, 0x65, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, + 0x6f, 0x6e, 0x73, 0x4f, 0x6e, 0x48, 0x6f, 0x73, 0x74, 0x53, 0x65, 0x74, 0x43, 0x68, 0x61, 0x6e, + 0x67, 0x65, 0x12, 0x8a, 0x01, 0x0a, 0x1c, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x73, 0x74, 0x65, 0x6e, + 0x74, 0x5f, 0x68, 0x61, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x5f, 0x6c, 0x62, 0x5f, 0x63, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x49, 0x2e, 0x65, 0x6e, 0x76, 0x6f, + 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, + 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, + 0x6f, 0x6e, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x43, 0x6f, 0x6e, 0x73, 0x69, + 0x73, 0x74, 0x65, 0x6e, 0x74, 0x48, 0x61, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x4c, 0x62, 0x43, 0x6f, + 0x6e, 0x66, 0x69, 0x67, 0x52, 0x19, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x74, + 0x48, 0x61, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, + 0x57, 0x0a, 0x14, 0x6f, 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, 0x65, 0x5f, 0x68, 0x6f, 0x73, 0x74, + 0x5f, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x25, 0x2e, + 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, + 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x48, 0x65, 0x61, 0x6c, 0x74, 0x68, 0x53, 0x74, 0x61, 0x74, 0x75, + 0x73, 0x53, 0x65, 0x74, 0x52, 0x12, 0x6f, 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, 0x65, 0x48, 0x6f, + 0x73, 0x74, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x1a, 0x8d, 0x02, 0x0a, 0x11, 0x5a, 0x6f, 0x6e, + 0x65, 0x41, 0x77, 0x61, 0x72, 0x65, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x3f, + 0x0a, 0x0f, 0x72, 0x6f, 0x75, 0x74, 0x69, 0x6e, 0x67, 0x5f, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, + 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x16, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, + 0x74, 0x79, 0x70, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74, 0x52, + 0x0e, 0x72, 0x6f, 0x75, 0x74, 0x69, 0x6e, 0x67, 0x45, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x12, + 0x46, 0x0a, 0x10, 0x6d, 0x69, 0x6e, 0x5f, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x5f, 0x73, + 0x69, 0x7a, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, + 0x36, 0x34, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x0e, 0x6d, 0x69, 0x6e, 0x43, 0x6c, 0x75, 0x73, + 0x74, 0x65, 0x72, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x31, 0x0a, 0x15, 0x66, 0x61, 0x69, 0x6c, 0x5f, + 0x74, 0x72, 0x61, 0x66, 0x66, 0x69, 0x63, 0x5f, 0x6f, 0x6e, 0x5f, 0x70, 0x61, 0x6e, 0x69, 0x63, + 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x52, 0x12, 0x66, 0x61, 0x69, 0x6c, 0x54, 0x72, 0x61, 0x66, + 0x66, 0x69, 0x63, 0x4f, 0x6e, 0x50, 0x61, 0x6e, 0x69, 0x63, 0x3a, 0x3c, 0x9a, 0xc5, 0x88, 0x1e, + 0x37, 0x0a, 0x35, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x62, - 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x4c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x74, 0x79, 0x57, - 0x65, 0x69, 0x67, 0x68, 0x74, 0x65, 0x64, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x1a, - 0xf1, 0x01, 0x0a, 0x19, 0x43, 0x6f, 0x6e, 0x73, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x74, 0x48, 0x61, - 0x73, 0x68, 0x69, 0x6e, 0x67, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x37, 0x0a, - 0x18, 0x75, 0x73, 0x65, 0x5f, 0x68, 0x6f, 0x73, 0x74, 0x6e, 0x61, 0x6d, 0x65, 0x5f, 0x66, 0x6f, - 0x72, 0x5f, 0x68, 0x61, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x52, - 0x15, 0x75, 0x73, 0x65, 0x48, 0x6f, 0x73, 0x74, 0x6e, 0x61, 0x6d, 0x65, 0x46, 0x6f, 0x72, 0x48, - 0x61, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x12, 0x55, 0x0a, 0x13, 0x68, 0x61, 0x73, 0x68, 0x5f, 0x62, - 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x5f, 0x66, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x18, 0x02, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, - 0x65, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x2a, 0x02, 0x28, 0x64, 0x52, 0x11, 0x68, 0x61, 0x73, 0x68, - 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x46, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x3a, 0x44, 0x9a, - 0xc5, 0x88, 0x1e, 0x3f, 0x0a, 0x3d, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, + 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x5a, 0x6f, 0x6e, 0x65, 0x41, 0x77, 0x61, 0x72, 0x65, + 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x1a, 0x5f, 0x0a, 0x18, 0x4c, 0x6f, 0x63, 0x61, + 0x6c, 0x69, 0x74, 0x79, 0x57, 0x65, 0x69, 0x67, 0x68, 0x74, 0x65, 0x64, 0x4c, 0x62, 0x43, 0x6f, + 0x6e, 0x66, 0x69, 0x67, 0x3a, 0x43, 0x9a, 0xc5, 0x88, 0x1e, 0x3e, 0x0a, 0x3c, 0x65, 0x6e, 0x76, + 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, + 0x72, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, + 0x2e, 0x4c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x74, 0x79, 0x57, 0x65, 0x69, 0x67, 0x68, 0x74, 0x65, + 0x64, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x1a, 0xf1, 0x01, 0x0a, 0x19, 0x43, 0x6f, + 0x6e, 0x73, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x74, 0x48, 0x61, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x4c, + 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x37, 0x0a, 0x18, 0x75, 0x73, 0x65, 0x5f, 0x68, + 0x6f, 0x73, 0x74, 0x6e, 0x61, 0x6d, 0x65, 0x5f, 0x66, 0x6f, 0x72, 0x5f, 0x68, 0x61, 0x73, 0x68, + 0x69, 0x6e, 0x67, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x52, 0x15, 0x75, 0x73, 0x65, 0x48, 0x6f, + 0x73, 0x74, 0x6e, 0x61, 0x6d, 0x65, 0x46, 0x6f, 0x72, 0x48, 0x61, 0x73, 0x68, 0x69, 0x6e, 0x67, + 0x12, 0x55, 0x0a, 0x13, 0x68, 0x61, 0x73, 0x68, 0x5f, 0x62, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, + 0x5f, 0x66, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, + 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x07, 0xfa, 0x42, 0x04, + 0x2a, 0x02, 0x28, 0x64, 0x52, 0x11, 0x68, 0x61, 0x73, 0x68, 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, + 0x65, 0x46, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x3a, 0x44, 0x9a, 0xc5, 0x88, 0x1e, 0x3f, 0x0a, 0x3d, + 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6c, 0x75, + 0x73, 0x74, 0x65, 0x72, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x62, 0x43, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x2e, 0x43, 0x6f, 0x6e, 0x73, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x74, 0x48, 0x61, + 0x73, 0x68, 0x69, 0x6e, 0x67, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x3a, 0x2a, 0x9a, + 0xc5, 0x88, 0x1e, 0x25, 0x0a, 0x23, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, - 0x6e, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x43, 0x6f, 0x6e, 0x73, 0x69, 0x73, - 0x74, 0x65, 0x6e, 0x74, 0x48, 0x61, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x4c, 0x62, 0x43, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x3a, 0x2a, 0x9a, 0xc5, 0x88, 0x1e, 0x25, 0x0a, 0x23, 0x65, 0x6e, 0x76, 0x6f, - 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, - 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x42, - 0x1b, 0x0a, 0x19, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x74, 0x79, 0x5f, 0x63, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x5f, 0x73, 0x70, 0x65, 0x63, 0x69, 0x66, 0x69, 0x65, 0x72, 0x1a, 0xd2, 0x01, 0x0a, - 0x0b, 0x52, 0x65, 0x66, 0x72, 0x65, 0x73, 0x68, 0x52, 0x61, 0x74, 0x65, 0x12, 0x4e, 0x0a, 0x0d, - 0x62, 0x61, 0x73, 0x65, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x0e, - 0xfa, 0x42, 0x0b, 0xaa, 0x01, 0x08, 0x08, 0x01, 0x2a, 0x04, 0x10, 0xc0, 0x84, 0x3d, 0x52, 0x0c, - 0x62, 0x61, 0x73, 0x65, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x12, 0x4a, 0x0a, 0x0c, - 0x6d, 0x61, 0x78, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x0c, 0xfa, - 0x42, 0x09, 0xaa, 0x01, 0x06, 0x2a, 0x04, 0x10, 0xc0, 0x84, 0x3d, 0x52, 0x0b, 0x6d, 0x61, 0x78, - 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x3a, 0x27, 0x9a, 0xc5, 0x88, 0x1e, 0x22, 0x0a, - 0x20, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6c, - 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x52, 0x65, 0x66, 0x72, 0x65, 0x73, 0x68, 0x52, 0x61, 0x74, - 0x65, 0x1a, 0x83, 0x02, 0x0a, 0x10, 0x50, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, - 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x78, 0x0a, 0x1d, 0x70, 0x65, 0x72, 0x5f, 0x75, 0x70, - 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x5f, 0x70, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, - 0x74, 0x5f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, + 0x6e, 0x4c, 0x62, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x42, 0x1b, 0x0a, 0x19, 0x6c, 0x6f, 0x63, + 0x61, 0x6c, 0x69, 0x74, 0x79, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x5f, 0x73, 0x70, 0x65, + 0x63, 0x69, 0x66, 0x69, 0x65, 0x72, 0x1a, 0xd2, 0x01, 0x0a, 0x0b, 0x52, 0x65, 0x66, 0x72, 0x65, + 0x73, 0x68, 0x52, 0x61, 0x74, 0x65, 0x12, 0x4e, 0x0a, 0x0d, 0x62, 0x61, 0x73, 0x65, 0x5f, 0x69, + 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, - 0x44, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x17, 0xfa, 0x42, 0x14, - 0x12, 0x12, 0x19, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x08, 0x40, 0x29, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xf0, 0x3f, 0x52, 0x1a, 0x70, 0x65, 0x72, 0x55, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, - 0x6d, 0x50, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x52, 0x61, 0x74, 0x69, 0x6f, - 0x12, 0x75, 0x0a, 0x1b, 0x70, 0x72, 0x65, 0x64, 0x69, 0x63, 0x74, 0x69, 0x76, 0x65, 0x5f, 0x70, - 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x5f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x18, + 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x0e, 0xfa, 0x42, 0x0b, 0xaa, 0x01, 0x08, + 0x08, 0x01, 0x2a, 0x04, 0x10, 0xc0, 0x84, 0x3d, 0x52, 0x0c, 0x62, 0x61, 0x73, 0x65, 0x49, 0x6e, + 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x12, 0x4a, 0x0a, 0x0c, 0x6d, 0x61, 0x78, 0x5f, 0x69, 0x6e, + 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, + 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x0c, 0xfa, 0x42, 0x09, 0xaa, 0x01, 0x06, 0x2a, + 0x04, 0x10, 0xc0, 0x84, 0x3d, 0x52, 0x0b, 0x6d, 0x61, 0x78, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, + 0x61, 0x6c, 0x3a, 0x27, 0x9a, 0xc5, 0x88, 0x1e, 0x22, 0x0a, 0x20, 0x65, 0x6e, 0x76, 0x6f, 0x79, + 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, + 0x52, 0x65, 0x66, 0x72, 0x65, 0x73, 0x68, 0x52, 0x61, 0x74, 0x65, 0x1a, 0x83, 0x02, 0x0a, 0x10, + 0x50, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, + 0x12, 0x78, 0x0a, 0x1d, 0x70, 0x65, 0x72, 0x5f, 0x75, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, + 0x5f, 0x70, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x5f, 0x72, 0x61, 0x74, 0x69, + 0x6f, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x6f, 0x75, 0x62, 0x6c, 0x65, + 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x17, 0xfa, 0x42, 0x14, 0x12, 0x12, 0x19, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x08, 0x40, 0x29, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0x3f, 0x52, 0x1a, + 0x70, 0x65, 0x72, 0x55, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x50, 0x72, 0x65, 0x63, 0x6f, + 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x52, 0x61, 0x74, 0x69, 0x6f, 0x12, 0x75, 0x0a, 0x1b, 0x70, 0x72, + 0x65, 0x64, 0x69, 0x63, 0x74, 0x69, 0x76, 0x65, 0x5f, 0x70, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x6e, + 0x65, 0x63, 0x74, 0x5f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x44, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x17, 0xfa, + 0x42, 0x14, 0x12, 0x12, 0x19, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x08, 0x40, 0x29, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xf0, 0x3f, 0x52, 0x19, 0x70, 0x72, 0x65, 0x64, 0x69, 0x63, 0x74, 0x69, + 0x76, 0x65, 0x50, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x52, 0x61, 0x74, 0x69, + 0x6f, 0x1a, 0x66, 0x0a, 0x22, 0x54, 0x79, 0x70, 0x65, 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, + 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, + 0x6e, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, + 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x2a, 0x0a, 0x05, 0x76, 0x61, 0x6c, + 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x14, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x41, 0x6e, 0x79, 0x52, 0x05, + 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x57, 0x0a, 0x0d, 0x44, 0x69, 0x73, + 0x63, 0x6f, 0x76, 0x65, 0x72, 0x79, 0x54, 0x79, 0x70, 0x65, 0x12, 0x0a, 0x0a, 0x06, 0x53, 0x54, + 0x41, 0x54, 0x49, 0x43, 0x10, 0x00, 0x12, 0x0e, 0x0a, 0x0a, 0x53, 0x54, 0x52, 0x49, 0x43, 0x54, + 0x5f, 0x44, 0x4e, 0x53, 0x10, 0x01, 0x12, 0x0f, 0x0a, 0x0b, 0x4c, 0x4f, 0x47, 0x49, 0x43, 0x41, + 0x4c, 0x5f, 0x44, 0x4e, 0x53, 0x10, 0x02, 0x12, 0x07, 0x0a, 0x03, 0x45, 0x44, 0x53, 0x10, 0x03, + 0x12, 0x10, 0x0a, 0x0c, 0x4f, 0x52, 0x49, 0x47, 0x49, 0x4e, 0x41, 0x4c, 0x5f, 0x44, 0x53, 0x54, + 0x10, 0x04, 0x22, 0xa4, 0x01, 0x0a, 0x08, 0x4c, 0x62, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, + 0x0f, 0x0a, 0x0b, 0x52, 0x4f, 0x55, 0x4e, 0x44, 0x5f, 0x52, 0x4f, 0x42, 0x49, 0x4e, 0x10, 0x00, + 0x12, 0x11, 0x0a, 0x0d, 0x4c, 0x45, 0x41, 0x53, 0x54, 0x5f, 0x52, 0x45, 0x51, 0x55, 0x45, 0x53, + 0x54, 0x10, 0x01, 0x12, 0x0d, 0x0a, 0x09, 0x52, 0x49, 0x4e, 0x47, 0x5f, 0x48, 0x41, 0x53, 0x48, + 0x10, 0x02, 0x12, 0x0a, 0x0a, 0x06, 0x52, 0x41, 0x4e, 0x44, 0x4f, 0x4d, 0x10, 0x03, 0x12, 0x0a, + 0x0a, 0x06, 0x4d, 0x41, 0x47, 0x4c, 0x45, 0x56, 0x10, 0x05, 0x12, 0x14, 0x0a, 0x10, 0x43, 0x4c, + 0x55, 0x53, 0x54, 0x45, 0x52, 0x5f, 0x50, 0x52, 0x4f, 0x56, 0x49, 0x44, 0x45, 0x44, 0x10, 0x06, + 0x12, 0x20, 0x0a, 0x1c, 0x4c, 0x4f, 0x41, 0x44, 0x5f, 0x42, 0x41, 0x4c, 0x41, 0x4e, 0x43, 0x49, + 0x4e, 0x47, 0x5f, 0x50, 0x4f, 0x4c, 0x49, 0x43, 0x59, 0x5f, 0x43, 0x4f, 0x4e, 0x46, 0x49, 0x47, + 0x10, 0x07, 0x22, 0x04, 0x08, 0x04, 0x10, 0x04, 0x2a, 0x0f, 0x4f, 0x52, 0x49, 0x47, 0x49, 0x4e, + 0x41, 0x4c, 0x5f, 0x44, 0x53, 0x54, 0x5f, 0x4c, 0x42, 0x22, 0x50, 0x0a, 0x0f, 0x44, 0x6e, 0x73, + 0x4c, 0x6f, 0x6f, 0x6b, 0x75, 0x70, 0x46, 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x12, 0x08, 0x0a, 0x04, + 0x41, 0x55, 0x54, 0x4f, 0x10, 0x00, 0x12, 0x0b, 0x0a, 0x07, 0x56, 0x34, 0x5f, 0x4f, 0x4e, 0x4c, + 0x59, 0x10, 0x01, 0x12, 0x0b, 0x0a, 0x07, 0x56, 0x36, 0x5f, 0x4f, 0x4e, 0x4c, 0x59, 0x10, 0x02, + 0x12, 0x10, 0x0a, 0x0c, 0x56, 0x34, 0x5f, 0x50, 0x52, 0x45, 0x46, 0x45, 0x52, 0x52, 0x45, 0x44, + 0x10, 0x03, 0x12, 0x07, 0x0a, 0x03, 0x41, 0x4c, 0x4c, 0x10, 0x04, 0x22, 0x54, 0x0a, 0x18, 0x43, + 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x53, 0x65, + 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1b, 0x0a, 0x17, 0x55, 0x53, 0x45, 0x5f, 0x43, + 0x4f, 0x4e, 0x46, 0x49, 0x47, 0x55, 0x52, 0x45, 0x44, 0x5f, 0x50, 0x52, 0x4f, 0x54, 0x4f, 0x43, + 0x4f, 0x4c, 0x10, 0x00, 0x12, 0x1b, 0x0a, 0x17, 0x55, 0x53, 0x45, 0x5f, 0x44, 0x4f, 0x57, 0x4e, + 0x53, 0x54, 0x52, 0x45, 0x41, 0x4d, 0x5f, 0x50, 0x52, 0x4f, 0x54, 0x4f, 0x43, 0x4f, 0x4c, 0x10, + 0x01, 0x3a, 0x1b, 0x9a, 0xc5, 0x88, 0x1e, 0x16, 0x0a, 0x14, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, + 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x42, 0x18, + 0x0a, 0x16, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x5f, 0x64, 0x69, 0x73, 0x63, 0x6f, 0x76, + 0x65, 0x72, 0x79, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x42, 0x0b, 0x0a, 0x09, 0x6c, 0x62, 0x5f, 0x63, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x4a, 0x04, 0x08, 0x0c, 0x10, 0x0d, 0x4a, 0x04, 0x08, 0x0f, 0x10, + 0x10, 0x4a, 0x04, 0x08, 0x07, 0x10, 0x08, 0x4a, 0x04, 0x08, 0x0b, 0x10, 0x0c, 0x4a, 0x04, 0x08, + 0x23, 0x10, 0x24, 0x52, 0x05, 0x68, 0x6f, 0x73, 0x74, 0x73, 0x52, 0x0b, 0x74, 0x6c, 0x73, 0x5f, + 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x52, 0x1a, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, + 0x6f, 0x6e, 0x5f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x5f, 0x6f, 0x70, 0x74, 0x69, + 0x6f, 0x6e, 0x73, 0x22, 0xda, 0x02, 0x0a, 0x13, 0x4c, 0x6f, 0x61, 0x64, 0x42, 0x61, 0x6c, 0x61, + 0x6e, 0x63, 0x69, 0x6e, 0x67, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x4f, 0x0a, 0x08, 0x70, + 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x33, 0x2e, + 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, + 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x6f, 0x61, 0x64, 0x42, 0x61, 0x6c, 0x61, + 0x6e, 0x63, 0x69, 0x6e, 0x67, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x50, 0x6f, 0x6c, 0x69, + 0x63, 0x79, 0x52, 0x08, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x1a, 0xc8, 0x01, 0x0a, + 0x06, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x60, 0x0a, 0x16, 0x74, 0x79, 0x70, 0x65, 0x64, + 0x5f, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, + 0x67, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, + 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x54, + 0x79, 0x70, 0x65, 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x52, 0x14, 0x74, 0x79, 0x70, 0x65, 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, + 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x3a, 0x2e, 0x9a, 0xc5, 0x88, 0x1e, 0x29, + 0x0a, 0x27, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x4c, + 0x6f, 0x61, 0x64, 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x69, 0x6e, 0x67, 0x50, 0x6f, 0x6c, 0x69, + 0x63, 0x79, 0x2e, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x4a, 0x04, 0x08, 0x02, 0x10, 0x03, 0x4a, + 0x04, 0x08, 0x01, 0x10, 0x02, 0x4a, 0x04, 0x08, 0x03, 0x10, 0x04, 0x52, 0x06, 0x63, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x52, 0x0c, 0x74, 0x79, 0x70, 0x65, 0x64, + 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x3a, 0x27, 0x9a, 0xc5, 0x88, 0x1e, 0x22, 0x0a, 0x20, + 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x4c, 0x6f, 0x61, + 0x64, 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x69, 0x6e, 0x67, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, + 0x22, 0xbb, 0x05, 0x0a, 0x19, 0x55, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x43, 0x6f, 0x6e, + 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x47, + 0x0a, 0x0d, 0x74, 0x63, 0x70, 0x5f, 0x6b, 0x65, 0x65, 0x70, 0x61, 0x6c, 0x69, 0x76, 0x65, 0x18, + 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, + 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x63, 0x70, + 0x4b, 0x65, 0x65, 0x70, 0x61, 0x6c, 0x69, 0x76, 0x65, 0x52, 0x0c, 0x74, 0x63, 0x70, 0x4b, 0x65, + 0x65, 0x70, 0x61, 0x6c, 0x69, 0x76, 0x65, 0x12, 0x64, 0x0a, 0x30, 0x73, 0x65, 0x74, 0x5f, 0x6c, + 0x6f, 0x63, 0x61, 0x6c, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x66, 0x61, 0x63, 0x65, 0x5f, 0x6e, + 0x61, 0x6d, 0x65, 0x5f, 0x6f, 0x6e, 0x5f, 0x75, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x5f, + 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, + 0x08, 0x52, 0x2a, 0x73, 0x65, 0x74, 0x4c, 0x6f, 0x63, 0x61, 0x6c, 0x49, 0x6e, 0x74, 0x65, 0x72, + 0x66, 0x61, 0x63, 0x65, 0x4e, 0x61, 0x6d, 0x65, 0x4f, 0x6e, 0x55, 0x70, 0x73, 0x74, 0x72, 0x65, + 0x61, 0x6d, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x7a, 0x0a, + 0x15, 0x68, 0x61, 0x70, 0x70, 0x79, 0x5f, 0x65, 0x79, 0x65, 0x62, 0x61, 0x6c, 0x6c, 0x73, 0x5f, + 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x46, 0x2e, 0x65, + 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, + 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x43, + 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, + 0x2e, 0x48, 0x61, 0x70, 0x70, 0x79, 0x45, 0x79, 0x65, 0x62, 0x61, 0x6c, 0x6c, 0x73, 0x43, 0x6f, + 0x6e, 0x66, 0x69, 0x67, 0x52, 0x13, 0x68, 0x61, 0x70, 0x70, 0x79, 0x45, 0x79, 0x65, 0x62, 0x61, + 0x6c, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x1a, 0x89, 0x02, 0x0a, 0x13, 0x48, 0x61, + 0x70, 0x70, 0x79, 0x45, 0x79, 0x65, 0x62, 0x61, 0x6c, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x66, 0x69, + 0x67, 0x12, 0x8d, 0x01, 0x0a, 0x1c, 0x66, 0x69, 0x72, 0x73, 0x74, 0x5f, 0x61, 0x64, 0x64, 0x72, + 0x65, 0x73, 0x73, 0x5f, 0x66, 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x5f, 0x76, 0x65, 0x72, 0x73, 0x69, + 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x4c, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, + 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, + 0x76, 0x33, 0x2e, 0x55, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x43, 0x6f, 0x6e, 0x6e, 0x65, + 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x46, 0x69, 0x72, + 0x73, 0x74, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x46, 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x56, + 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x19, 0x66, 0x69, 0x72, 0x73, 0x74, 0x41, 0x64, 0x64, + 0x72, 0x65, 0x73, 0x73, 0x46, 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, + 0x6e, 0x12, 0x62, 0x0a, 0x1a, 0x66, 0x69, 0x72, 0x73, 0x74, 0x5f, 0x61, 0x64, 0x64, 0x72, 0x65, + 0x73, 0x73, 0x5f, 0x66, 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x56, 0x61, - 0x6c, 0x75, 0x65, 0x42, 0x17, 0xfa, 0x42, 0x14, 0x12, 0x12, 0x19, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x08, 0x40, 0x29, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0x3f, 0x52, 0x19, 0x70, 0x72, - 0x65, 0x64, 0x69, 0x63, 0x74, 0x69, 0x76, 0x65, 0x50, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x6e, 0x65, - 0x63, 0x74, 0x52, 0x61, 0x74, 0x69, 0x6f, 0x1a, 0x66, 0x0a, 0x22, 0x54, 0x79, 0x70, 0x65, 0x64, - 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, - 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, - 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, - 0x2a, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x14, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, - 0x2e, 0x41, 0x6e, 0x79, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, - 0x57, 0x0a, 0x0d, 0x44, 0x69, 0x73, 0x63, 0x6f, 0x76, 0x65, 0x72, 0x79, 0x54, 0x79, 0x70, 0x65, - 0x12, 0x0a, 0x0a, 0x06, 0x53, 0x54, 0x41, 0x54, 0x49, 0x43, 0x10, 0x00, 0x12, 0x0e, 0x0a, 0x0a, - 0x53, 0x54, 0x52, 0x49, 0x43, 0x54, 0x5f, 0x44, 0x4e, 0x53, 0x10, 0x01, 0x12, 0x0f, 0x0a, 0x0b, - 0x4c, 0x4f, 0x47, 0x49, 0x43, 0x41, 0x4c, 0x5f, 0x44, 0x4e, 0x53, 0x10, 0x02, 0x12, 0x07, 0x0a, - 0x03, 0x45, 0x44, 0x53, 0x10, 0x03, 0x12, 0x10, 0x0a, 0x0c, 0x4f, 0x52, 0x49, 0x47, 0x49, 0x4e, - 0x41, 0x4c, 0x5f, 0x44, 0x53, 0x54, 0x10, 0x04, 0x22, 0xa4, 0x01, 0x0a, 0x08, 0x4c, 0x62, 0x50, - 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x0f, 0x0a, 0x0b, 0x52, 0x4f, 0x55, 0x4e, 0x44, 0x5f, 0x52, - 0x4f, 0x42, 0x49, 0x4e, 0x10, 0x00, 0x12, 0x11, 0x0a, 0x0d, 0x4c, 0x45, 0x41, 0x53, 0x54, 0x5f, - 0x52, 0x45, 0x51, 0x55, 0x45, 0x53, 0x54, 0x10, 0x01, 0x12, 0x0d, 0x0a, 0x09, 0x52, 0x49, 0x4e, - 0x47, 0x5f, 0x48, 0x41, 0x53, 0x48, 0x10, 0x02, 0x12, 0x0a, 0x0a, 0x06, 0x52, 0x41, 0x4e, 0x44, - 0x4f, 0x4d, 0x10, 0x03, 0x12, 0x0a, 0x0a, 0x06, 0x4d, 0x41, 0x47, 0x4c, 0x45, 0x56, 0x10, 0x05, - 0x12, 0x14, 0x0a, 0x10, 0x43, 0x4c, 0x55, 0x53, 0x54, 0x45, 0x52, 0x5f, 0x50, 0x52, 0x4f, 0x56, - 0x49, 0x44, 0x45, 0x44, 0x10, 0x06, 0x12, 0x20, 0x0a, 0x1c, 0x4c, 0x4f, 0x41, 0x44, 0x5f, 0x42, - 0x41, 0x4c, 0x41, 0x4e, 0x43, 0x49, 0x4e, 0x47, 0x5f, 0x50, 0x4f, 0x4c, 0x49, 0x43, 0x59, 0x5f, - 0x43, 0x4f, 0x4e, 0x46, 0x49, 0x47, 0x10, 0x07, 0x22, 0x04, 0x08, 0x04, 0x10, 0x04, 0x2a, 0x0f, - 0x4f, 0x52, 0x49, 0x47, 0x49, 0x4e, 0x41, 0x4c, 0x5f, 0x44, 0x53, 0x54, 0x5f, 0x4c, 0x42, 0x22, - 0x50, 0x0a, 0x0f, 0x44, 0x6e, 0x73, 0x4c, 0x6f, 0x6f, 0x6b, 0x75, 0x70, 0x46, 0x61, 0x6d, 0x69, - 0x6c, 0x79, 0x12, 0x08, 0x0a, 0x04, 0x41, 0x55, 0x54, 0x4f, 0x10, 0x00, 0x12, 0x0b, 0x0a, 0x07, - 0x56, 0x34, 0x5f, 0x4f, 0x4e, 0x4c, 0x59, 0x10, 0x01, 0x12, 0x0b, 0x0a, 0x07, 0x56, 0x36, 0x5f, - 0x4f, 0x4e, 0x4c, 0x59, 0x10, 0x02, 0x12, 0x10, 0x0a, 0x0c, 0x56, 0x34, 0x5f, 0x50, 0x52, 0x45, - 0x46, 0x45, 0x52, 0x52, 0x45, 0x44, 0x10, 0x03, 0x12, 0x07, 0x0a, 0x03, 0x41, 0x4c, 0x4c, 0x10, - 0x04, 0x22, 0x54, 0x0a, 0x18, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x50, 0x72, 0x6f, 0x74, - 0x6f, 0x63, 0x6f, 0x6c, 0x53, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1b, 0x0a, - 0x17, 0x55, 0x53, 0x45, 0x5f, 0x43, 0x4f, 0x4e, 0x46, 0x49, 0x47, 0x55, 0x52, 0x45, 0x44, 0x5f, - 0x50, 0x52, 0x4f, 0x54, 0x4f, 0x43, 0x4f, 0x4c, 0x10, 0x00, 0x12, 0x1b, 0x0a, 0x17, 0x55, 0x53, - 0x45, 0x5f, 0x44, 0x4f, 0x57, 0x4e, 0x53, 0x54, 0x52, 0x45, 0x41, 0x4d, 0x5f, 0x50, 0x52, 0x4f, - 0x54, 0x4f, 0x43, 0x4f, 0x4c, 0x10, 0x01, 0x3a, 0x1b, 0x9a, 0xc5, 0x88, 0x1e, 0x16, 0x0a, 0x14, - 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x43, 0x6c, 0x75, - 0x73, 0x74, 0x65, 0x72, 0x42, 0x18, 0x0a, 0x16, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x5f, - 0x64, 0x69, 0x73, 0x63, 0x6f, 0x76, 0x65, 0x72, 0x79, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x42, 0x0b, - 0x0a, 0x09, 0x6c, 0x62, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x4a, 0x04, 0x08, 0x0c, 0x10, - 0x0d, 0x4a, 0x04, 0x08, 0x0f, 0x10, 0x10, 0x4a, 0x04, 0x08, 0x07, 0x10, 0x08, 0x4a, 0x04, 0x08, - 0x0b, 0x10, 0x0c, 0x4a, 0x04, 0x08, 0x23, 0x10, 0x24, 0x52, 0x05, 0x68, 0x6f, 0x73, 0x74, 0x73, - 0x52, 0x0b, 0x74, 0x6c, 0x73, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x52, 0x1a, 0x65, - 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x5f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, - 0x6c, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x22, 0xda, 0x02, 0x0a, 0x13, 0x4c, 0x6f, - 0x61, 0x64, 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x69, 0x6e, 0x67, 0x50, 0x6f, 0x6c, 0x69, 0x63, - 0x79, 0x12, 0x4f, 0x0a, 0x08, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x18, 0x01, 0x20, - 0x03, 0x28, 0x0b, 0x32, 0x33, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x6f, - 0x61, 0x64, 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x69, 0x6e, 0x67, 0x50, 0x6f, 0x6c, 0x69, 0x63, - 0x79, 0x2e, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x08, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x69, - 0x65, 0x73, 0x1a, 0xc8, 0x01, 0x0a, 0x06, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x60, 0x0a, - 0x16, 0x74, 0x79, 0x70, 0x65, 0x64, 0x5f, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, - 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, - 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, - 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x79, 0x70, 0x65, 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, - 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x14, 0x74, 0x79, 0x70, 0x65, 0x64, - 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x3a, - 0x2e, 0x9a, 0xc5, 0x88, 0x1e, 0x29, 0x0a, 0x27, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, - 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x4c, 0x6f, 0x61, 0x64, 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x69, - 0x6e, 0x67, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x4a, - 0x04, 0x08, 0x02, 0x10, 0x03, 0x4a, 0x04, 0x08, 0x01, 0x10, 0x02, 0x4a, 0x04, 0x08, 0x03, 0x10, - 0x04, 0x52, 0x06, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x52, - 0x0c, 0x74, 0x79, 0x70, 0x65, 0x64, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x3a, 0x27, 0x9a, - 0xc5, 0x88, 0x1e, 0x22, 0x0a, 0x20, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, - 0x76, 0x32, 0x2e, 0x4c, 0x6f, 0x61, 0x64, 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x69, 0x6e, 0x67, - 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x22, 0xbb, 0x05, 0x0a, 0x19, 0x55, 0x70, 0x73, 0x74, 0x72, - 0x65, 0x61, 0x6d, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x4f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x47, 0x0a, 0x0d, 0x74, 0x63, 0x70, 0x5f, 0x6b, 0x65, 0x65, 0x70, - 0x61, 0x6c, 0x69, 0x76, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x65, 0x6e, - 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, - 0x76, 0x33, 0x2e, 0x54, 0x63, 0x70, 0x4b, 0x65, 0x65, 0x70, 0x61, 0x6c, 0x69, 0x76, 0x65, 0x52, - 0x0c, 0x74, 0x63, 0x70, 0x4b, 0x65, 0x65, 0x70, 0x61, 0x6c, 0x69, 0x76, 0x65, 0x12, 0x64, 0x0a, - 0x30, 0x73, 0x65, 0x74, 0x5f, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, - 0x66, 0x61, 0x63, 0x65, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x5f, 0x6f, 0x6e, 0x5f, 0x75, 0x70, 0x73, - 0x74, 0x72, 0x65, 0x61, 0x6d, 0x5f, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, - 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x2a, 0x73, 0x65, 0x74, 0x4c, 0x6f, 0x63, 0x61, - 0x6c, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x66, 0x61, 0x63, 0x65, 0x4e, 0x61, 0x6d, 0x65, 0x4f, 0x6e, - 0x55, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, - 0x6f, 0x6e, 0x73, 0x12, 0x7a, 0x0a, 0x15, 0x68, 0x61, 0x70, 0x70, 0x79, 0x5f, 0x65, 0x79, 0x65, - 0x62, 0x61, 0x6c, 0x6c, 0x73, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x03, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x46, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x73, - 0x74, 0x72, 0x65, 0x61, 0x6d, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x4f, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x48, 0x61, 0x70, 0x70, 0x79, 0x45, 0x79, 0x65, 0x62, - 0x61, 0x6c, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x13, 0x68, 0x61, 0x70, 0x70, - 0x79, 0x45, 0x79, 0x65, 0x62, 0x61, 0x6c, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x1a, - 0x89, 0x02, 0x0a, 0x13, 0x48, 0x61, 0x70, 0x70, 0x79, 0x45, 0x79, 0x65, 0x62, 0x61, 0x6c, 0x6c, - 0x73, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x8d, 0x01, 0x0a, 0x1c, 0x66, 0x69, 0x72, 0x73, - 0x74, 0x5f, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x5f, 0x66, 0x61, 0x6d, 0x69, 0x6c, 0x79, - 0x5f, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x4c, - 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, - 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x55, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, - 0x6d, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x4f, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x73, 0x2e, 0x46, 0x69, 0x72, 0x73, 0x74, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x46, - 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x19, 0x66, 0x69, + 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, + 0x6c, 0x75, 0x65, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x2a, 0x02, 0x28, 0x01, 0x52, 0x17, 0x66, 0x69, 0x72, 0x73, 0x74, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x46, 0x61, 0x6d, 0x69, 0x6c, 0x79, - 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x62, 0x0a, 0x1a, 0x66, 0x69, 0x72, 0x73, 0x74, - 0x5f, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x5f, 0x66, 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x5f, - 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, - 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x2a, 0x02, - 0x28, 0x01, 0x52, 0x17, 0x66, 0x69, 0x72, 0x73, 0x74, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, - 0x46, 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x22, 0x38, 0x0a, 0x19, 0x46, - 0x69, 0x72, 0x73, 0x74, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x46, 0x61, 0x6d, 0x69, 0x6c, - 0x79, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x0b, 0x0a, 0x07, 0x44, 0x45, 0x46, 0x41, - 0x55, 0x4c, 0x54, 0x10, 0x00, 0x12, 0x06, 0x0a, 0x02, 0x56, 0x34, 0x10, 0x01, 0x12, 0x06, 0x0a, - 0x02, 0x56, 0x36, 0x10, 0x02, 0x3a, 0x2d, 0x9a, 0xc5, 0x88, 0x1e, 0x28, 0x0a, 0x26, 0x65, 0x6e, - 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x55, 0x70, 0x73, 0x74, 0x72, - 0x65, 0x61, 0x6d, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x4f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0x22, 0xa0, 0x01, 0x0a, 0x11, 0x54, 0x72, 0x61, 0x63, 0x6b, 0x43, 0x6c, - 0x75, 0x73, 0x74, 0x65, 0x72, 0x53, 0x74, 0x61, 0x74, 0x73, 0x12, 0x27, 0x0a, 0x0f, 0x74, 0x69, - 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x5f, 0x62, 0x75, 0x64, 0x67, 0x65, 0x74, 0x73, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x08, 0x52, 0x0e, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x42, 0x75, 0x64, 0x67, - 0x65, 0x74, 0x73, 0x12, 0x34, 0x0a, 0x16, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x72, - 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x73, 0x18, 0x02, 0x20, - 0x01, 0x28, 0x08, 0x52, 0x14, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x52, 0x65, 0x73, 0x70, - 0x6f, 0x6e, 0x73, 0x65, 0x53, 0x69, 0x7a, 0x65, 0x73, 0x12, 0x2c, 0x0a, 0x12, 0x70, 0x65, 0x72, - 0x5f, 0x65, 0x6e, 0x64, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x73, 0x18, - 0x03, 0x20, 0x01, 0x28, 0x08, 0x52, 0x10, 0x70, 0x65, 0x72, 0x45, 0x6e, 0x64, 0x70, 0x6f, 0x69, - 0x6e, 0x74, 0x53, 0x74, 0x61, 0x74, 0x73, 0x42, 0x89, 0x01, 0xba, 0x80, 0xc8, 0xd1, 0x06, 0x02, - 0x10, 0x02, 0x0a, 0x25, 0x69, 0x6f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, - 0x79, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, - 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x42, 0x0c, 0x43, 0x6c, 0x75, 0x73, 0x74, - 0x65, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x48, 0x67, 0x69, 0x74, 0x68, 0x75, - 0x62, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, - 0x2f, 0x67, 0x6f, 0x2d, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x2d, 0x70, 0x6c, 0x61, 0x6e, - 0x65, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2f, 0x63, - 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x2f, 0x76, 0x33, 0x3b, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, - 0x72, 0x76, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x22, 0x38, 0x0a, 0x19, 0x46, 0x69, 0x72, 0x73, 0x74, 0x41, 0x64, + 0x64, 0x72, 0x65, 0x73, 0x73, 0x46, 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x56, 0x65, 0x72, 0x73, 0x69, + 0x6f, 0x6e, 0x12, 0x0b, 0x0a, 0x07, 0x44, 0x45, 0x46, 0x41, 0x55, 0x4c, 0x54, 0x10, 0x00, 0x12, + 0x06, 0x0a, 0x02, 0x56, 0x34, 0x10, 0x01, 0x12, 0x06, 0x0a, 0x02, 0x56, 0x36, 0x10, 0x02, 0x3a, + 0x2d, 0x9a, 0xc5, 0x88, 0x1e, 0x28, 0x0a, 0x26, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, + 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x55, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x43, 0x6f, 0x6e, + 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x22, 0xa0, + 0x01, 0x0a, 0x11, 0x54, 0x72, 0x61, 0x63, 0x6b, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x53, + 0x74, 0x61, 0x74, 0x73, 0x12, 0x27, 0x0a, 0x0f, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x5f, + 0x62, 0x75, 0x64, 0x67, 0x65, 0x74, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0e, 0x74, + 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x42, 0x75, 0x64, 0x67, 0x65, 0x74, 0x73, 0x12, 0x34, 0x0a, + 0x16, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, + 0x65, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x14, 0x72, + 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x53, 0x69, + 0x7a, 0x65, 0x73, 0x12, 0x2c, 0x0a, 0x12, 0x70, 0x65, 0x72, 0x5f, 0x65, 0x6e, 0x64, 0x70, 0x6f, + 0x69, 0x6e, 0x74, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x52, + 0x10, 0x70, 0x65, 0x72, 0x45, 0x6e, 0x64, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x53, 0x74, 0x61, 0x74, + 0x73, 0x42, 0x89, 0x01, 0xba, 0x80, 0xc8, 0xd1, 0x06, 0x02, 0x10, 0x02, 0x0a, 0x25, 0x69, 0x6f, + 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2e, 0x65, 0x6e, 0x76, 0x6f, + 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, + 0x2e, 0x76, 0x33, 0x42, 0x0c, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x50, 0x72, 0x6f, 0x74, + 0x6f, 0x50, 0x01, 0x5a, 0x48, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, + 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2f, 0x67, 0x6f, 0x2d, 0x63, 0x6f, + 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x2d, 0x70, 0x6c, 0x61, 0x6e, 0x65, 0x2f, 0x65, 0x6e, 0x76, 0x6f, + 0x79, 0x2f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2f, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, + 0x2f, 0x76, 0x33, 0x3b, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x76, 0x33, 0x62, 0x06, 0x70, + 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/cluster/v3/cluster.pb.validate.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/cluster/v3/cluster.pb.validate.go index e651f5bd99a6a..986fe7e6ebbda 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/cluster/v3/cluster.pb.validate.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/cluster/v3/cluster.pb.validate.go @@ -647,32 +647,33 @@ func (m *Cluster) validate(all bool) error { } } - if all { - switch v := interface{}(m.GetDnsJitter()).(type) { - case interface{ ValidateAll() error }: - if err := v.ValidateAll(); err != nil { - errors = append(errors, ClusterValidationError{ - field: "DnsJitter", - reason: "embedded message failed validation", - cause: err, - }) - } - case interface{ Validate() error }: - if err := v.Validate(); err != nil { - errors = append(errors, ClusterValidationError{ - field: "DnsJitter", - reason: "embedded message failed validation", - cause: err, - }) - } - } - } else if v, ok := interface{}(m.GetDnsJitter()).(interface{ Validate() error }); ok { - if err := v.Validate(); err != nil { - return ClusterValidationError{ + if d := m.GetDnsJitter(); d != nil { + dur, err := d.AsDuration(), d.CheckValid() + if err != nil { + err = ClusterValidationError{ field: "DnsJitter", - reason: "embedded message failed validation", + reason: "value is not a valid duration", cause: err, } + if !all { + return err + } + errors = append(errors, err) + } else { + + gte := time.Duration(0*time.Second + 0*time.Nanosecond) + + if dur < gte { + err := ClusterValidationError{ + field: "DnsJitter", + reason: "value must be greater than or equal to 0s", + } + if !all { + return err + } + errors = append(errors, err) + } + } } diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/cluster/v3/filter.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/cluster/v3/filter.pb.go index 42ddbe2bb3576..5284af1a9ce15 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/cluster/v3/filter.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/cluster/v3/filter.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/cluster/v3/filter.proto package clusterv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/cluster/v3/outlier_detection.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/cluster/v3/outlier_detection.pb.go index 531cbd0efcd3e..8f80b42dad36d 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/cluster/v3/outlier_detection.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/cluster/v3/outlier_detection.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/cluster/v3/outlier_detection.proto package clusterv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/common/matcher/v3/matcher.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/common/matcher/v3/matcher.pb.go index 659879f9d7e11..7e7c34b98e0e1 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/common/matcher/v3/matcher.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/common/matcher/v3/matcher.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/common/matcher/v3/matcher.proto package matcherv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/address.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/address.pb.go index a0852aa600ff6..1b1c048896b89 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/address.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/address.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/core/v3/address.proto package corev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/backoff.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/backoff.pb.go index 68841ad157430..fa20148af8300 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/backoff.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/backoff.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/core/v3/backoff.proto package corev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/base.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/base.pb.go index 862e09a833724..136b839915200 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/base.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/base.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/core/v3/base.proto package corev3 @@ -269,7 +269,7 @@ func (x KeyValueAppend_KeyValueAppendAction) Number() protoreflect.EnumNumber { // Deprecated: Use KeyValueAppend_KeyValueAppendAction.Descriptor instead. func (KeyValueAppend_KeyValueAppendAction) EnumDescriptor() ([]byte, []int) { - return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{10, 0} + return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{11, 0} } // Describes the supported actions types for header append action. @@ -335,7 +335,7 @@ func (x HeaderValueOption_HeaderAppendAction) Number() protoreflect.EnumNumber { // Deprecated: Use HeaderValueOption_HeaderAppendAction.Descriptor instead. func (HeaderValueOption_HeaderAppendAction) EnumDescriptor() ([]byte, []int) { - return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{14, 0} + return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{15, 0} } // Identifies location of where either Envoy runs or where upstream hosts run. @@ -1106,14 +1106,24 @@ func (x *RuntimeFeatureFlag) GetRuntimeKey() string { return "" } +// Please use :ref:`KeyValuePair ` instead. +// [#not-implemented-hide:] type KeyValue struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache unknownFields protoimpl.UnknownFields // The key of the key/value pair. + // + // Deprecated: Marked as deprecated in envoy/config/core/v3/base.proto. Key string `protobuf:"bytes,1,opt,name=key,proto3" json:"key,omitempty"` // The value of the key/value pair. + // + // The “bytes“ type is used. This means if JSON or YAML is used to to represent the + // configuration, the value must be base64 encoded. This is unfriendly for users in most + // use scenarios of this message. + // + // Deprecated: Marked as deprecated in envoy/config/core/v3/base.proto. Value []byte `protobuf:"bytes,2,opt,name=value,proto3" json:"value,omitempty"` } @@ -1149,6 +1159,7 @@ func (*KeyValue) Descriptor() ([]byte, []int) { return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{9} } +// Deprecated: Marked as deprecated in envoy/config/core/v3/base.proto. func (x *KeyValue) GetKey() string { if x != nil { return x.Key @@ -1156,6 +1167,7 @@ func (x *KeyValue) GetKey() string { return "" } +// Deprecated: Marked as deprecated in envoy/config/core/v3/base.proto. func (x *KeyValue) GetValue() []byte { if x != nil { return x.Value @@ -1163,6 +1175,63 @@ func (x *KeyValue) GetValue() []byte { return nil } +type KeyValuePair struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // The key of the key/value pair. + Key string `protobuf:"bytes,1,opt,name=key,proto3" json:"key,omitempty"` + // The value of the key/value pair. + Value *structpb.Value `protobuf:"bytes,2,opt,name=value,proto3" json:"value,omitempty"` +} + +func (x *KeyValuePair) Reset() { + *x = KeyValuePair{} + if protoimpl.UnsafeEnabled { + mi := &file_envoy_config_core_v3_base_proto_msgTypes[10] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *KeyValuePair) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*KeyValuePair) ProtoMessage() {} + +func (x *KeyValuePair) ProtoReflect() protoreflect.Message { + mi := &file_envoy_config_core_v3_base_proto_msgTypes[10] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use KeyValuePair.ProtoReflect.Descriptor instead. +func (*KeyValuePair) Descriptor() ([]byte, []int) { + return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{10} +} + +func (x *KeyValuePair) GetKey() string { + if x != nil { + return x.Key + } + return "" +} + +func (x *KeyValuePair) GetValue() *structpb.Value { + if x != nil { + return x.Value + } + return nil +} + // Key/value pair plus option to control append behavior. This is used to specify // key/value pairs that should be appended to a set of existing key/value pairs. type KeyValueAppend struct { @@ -1170,7 +1239,14 @@ type KeyValueAppend struct { sizeCache protoimpl.SizeCache unknownFields protoimpl.UnknownFields - // Key/value pair entry that this option to append or overwrite. + // The single key/value pair record to be appended or overridden. This field must be set. + Record *KeyValuePair `protobuf:"bytes,3,opt,name=record,proto3" json:"record,omitempty"` + // Key/value pair entry that this option to append or overwrite. This field is deprecated + // and please use :ref:`record ` + // as replacement. + // [#not-implemented-hide:] + // + // Deprecated: Marked as deprecated in envoy/config/core/v3/base.proto. Entry *KeyValue `protobuf:"bytes,1,opt,name=entry,proto3" json:"entry,omitempty"` // Describes the action taken to append/overwrite the given value for an existing // key or to only add this key if it's absent. @@ -1180,7 +1256,7 @@ type KeyValueAppend struct { func (x *KeyValueAppend) Reset() { *x = KeyValueAppend{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[10] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[11] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -1193,7 +1269,7 @@ func (x *KeyValueAppend) String() string { func (*KeyValueAppend) ProtoMessage() {} func (x *KeyValueAppend) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[10] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[11] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1206,9 +1282,17 @@ func (x *KeyValueAppend) ProtoReflect() protoreflect.Message { // Deprecated: Use KeyValueAppend.ProtoReflect.Descriptor instead. func (*KeyValueAppend) Descriptor() ([]byte, []int) { - return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{10} + return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{11} } +func (x *KeyValueAppend) GetRecord() *KeyValuePair { + if x != nil { + return x.Record + } + return nil +} + +// Deprecated: Marked as deprecated in envoy/config/core/v3/base.proto. func (x *KeyValueAppend) GetEntry() *KeyValue { if x != nil { return x.Entry @@ -1229,16 +1313,18 @@ type KeyValueMutation struct { sizeCache protoimpl.SizeCache unknownFields protoimpl.UnknownFields - // Key/value pair to append or overwrite. Only one of “append“ or “remove“ can be set. + // Key/value pair to append or overwrite. Only one of “append“ or “remove“ can be set or + // the configuration will be rejected. Append *KeyValueAppend `protobuf:"bytes,1,opt,name=append,proto3" json:"append,omitempty"` - // Key to remove. Only one of “append“ or “remove“ can be set. + // Key to remove. Only one of “append“ or “remove“ can be set or the configuration will be + // rejected. Remove string `protobuf:"bytes,2,opt,name=remove,proto3" json:"remove,omitempty"` } func (x *KeyValueMutation) Reset() { *x = KeyValueMutation{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[11] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[12] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -1251,7 +1337,7 @@ func (x *KeyValueMutation) String() string { func (*KeyValueMutation) ProtoMessage() {} func (x *KeyValueMutation) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[11] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[12] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1264,7 +1350,7 @@ func (x *KeyValueMutation) ProtoReflect() protoreflect.Message { // Deprecated: Use KeyValueMutation.ProtoReflect.Descriptor instead. func (*KeyValueMutation) Descriptor() ([]byte, []int) { - return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{11} + return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{12} } func (x *KeyValueMutation) GetAppend() *KeyValueAppend { @@ -1296,7 +1382,7 @@ type QueryParameter struct { func (x *QueryParameter) Reset() { *x = QueryParameter{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[12] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[13] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -1309,7 +1395,7 @@ func (x *QueryParameter) String() string { func (*QueryParameter) ProtoMessage() {} func (x *QueryParameter) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[12] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[13] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1322,7 +1408,7 @@ func (x *QueryParameter) ProtoReflect() protoreflect.Message { // Deprecated: Use QueryParameter.ProtoReflect.Descriptor instead. func (*QueryParameter) Descriptor() ([]byte, []int) { - return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{12} + return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{13} } func (x *QueryParameter) GetKey() string { @@ -1363,7 +1449,7 @@ type HeaderValue struct { func (x *HeaderValue) Reset() { *x = HeaderValue{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[13] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[14] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -1376,7 +1462,7 @@ func (x *HeaderValue) String() string { func (*HeaderValue) ProtoMessage() {} func (x *HeaderValue) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[13] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[14] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1389,7 +1475,7 @@ func (x *HeaderValue) ProtoReflect() protoreflect.Message { // Deprecated: Use HeaderValue.ProtoReflect.Descriptor instead. func (*HeaderValue) Descriptor() ([]byte, []int) { - return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{13} + return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{14} } func (x *HeaderValue) GetKey() string { @@ -1447,7 +1533,7 @@ type HeaderValueOption struct { func (x *HeaderValueOption) Reset() { *x = HeaderValueOption{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[14] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[15] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -1460,7 +1546,7 @@ func (x *HeaderValueOption) String() string { func (*HeaderValueOption) ProtoMessage() {} func (x *HeaderValueOption) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[14] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[15] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1473,7 +1559,7 @@ func (x *HeaderValueOption) ProtoReflect() protoreflect.Message { // Deprecated: Use HeaderValueOption.ProtoReflect.Descriptor instead. func (*HeaderValueOption) Descriptor() ([]byte, []int) { - return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{14} + return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{15} } func (x *HeaderValueOption) GetHeader() *HeaderValue { @@ -1511,13 +1597,14 @@ type HeaderMap struct { sizeCache protoimpl.SizeCache unknownFields protoimpl.UnknownFields + // A list of header names and their values. Headers []*HeaderValue `protobuf:"bytes,1,rep,name=headers,proto3" json:"headers,omitempty"` } func (x *HeaderMap) Reset() { *x = HeaderMap{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[15] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[16] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -1530,7 +1617,7 @@ func (x *HeaderMap) String() string { func (*HeaderMap) ProtoMessage() {} func (x *HeaderMap) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[15] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[16] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1543,7 +1630,7 @@ func (x *HeaderMap) ProtoReflect() protoreflect.Message { // Deprecated: Use HeaderMap.ProtoReflect.Descriptor instead. func (*HeaderMap) Descriptor() ([]byte, []int) { - return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{15} + return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{16} } func (x *HeaderMap) GetHeaders() []*HeaderValue { @@ -1567,7 +1654,7 @@ type WatchedDirectory struct { func (x *WatchedDirectory) Reset() { *x = WatchedDirectory{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[16] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[17] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -1580,7 +1667,7 @@ func (x *WatchedDirectory) String() string { func (*WatchedDirectory) ProtoMessage() {} func (x *WatchedDirectory) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[16] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[17] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1593,7 +1680,7 @@ func (x *WatchedDirectory) ProtoReflect() protoreflect.Message { // Deprecated: Use WatchedDirectory.ProtoReflect.Descriptor instead. func (*WatchedDirectory) Descriptor() ([]byte, []int) { - return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{16} + return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{17} } func (x *WatchedDirectory) GetPath() string { @@ -1640,7 +1727,7 @@ type DataSource struct { func (x *DataSource) Reset() { *x = DataSource{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[17] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[18] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -1653,7 +1740,7 @@ func (x *DataSource) String() string { func (*DataSource) ProtoMessage() {} func (x *DataSource) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[17] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[18] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1666,7 +1753,7 @@ func (x *DataSource) ProtoReflect() protoreflect.Message { // Deprecated: Use DataSource.ProtoReflect.Descriptor instead. func (*DataSource) Descriptor() ([]byte, []int) { - return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{17} + return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{18} } func (m *DataSource) GetSpecifier() isDataSource_Specifier { @@ -1770,7 +1857,7 @@ type RetryPolicy struct { func (x *RetryPolicy) Reset() { *x = RetryPolicy{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[18] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[19] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -1783,7 +1870,7 @@ func (x *RetryPolicy) String() string { func (*RetryPolicy) ProtoMessage() {} func (x *RetryPolicy) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[18] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[19] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1796,7 +1883,7 @@ func (x *RetryPolicy) ProtoReflect() protoreflect.Message { // Deprecated: Use RetryPolicy.ProtoReflect.Descriptor instead. func (*RetryPolicy) Descriptor() ([]byte, []int) { - return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{18} + return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{19} } func (x *RetryPolicy) GetRetryBackOff() *BackoffStrategy { @@ -1858,7 +1945,7 @@ type RemoteDataSource struct { func (x *RemoteDataSource) Reset() { *x = RemoteDataSource{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[19] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[20] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -1871,7 +1958,7 @@ func (x *RemoteDataSource) String() string { func (*RemoteDataSource) ProtoMessage() {} func (x *RemoteDataSource) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[19] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[20] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1884,7 +1971,7 @@ func (x *RemoteDataSource) ProtoReflect() protoreflect.Message { // Deprecated: Use RemoteDataSource.ProtoReflect.Descriptor instead. func (*RemoteDataSource) Descriptor() ([]byte, []int) { - return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{19} + return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{20} } func (x *RemoteDataSource) GetHttpUri() *HttpUri { @@ -1924,7 +2011,7 @@ type AsyncDataSource struct { func (x *AsyncDataSource) Reset() { *x = AsyncDataSource{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[20] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[21] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -1937,7 +2024,7 @@ func (x *AsyncDataSource) String() string { func (*AsyncDataSource) ProtoMessage() {} func (x *AsyncDataSource) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[20] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[21] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1950,7 +2037,7 @@ func (x *AsyncDataSource) ProtoReflect() protoreflect.Message { // Deprecated: Use AsyncDataSource.ProtoReflect.Descriptor instead. func (*AsyncDataSource) Descriptor() ([]byte, []int) { - return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{20} + return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{21} } func (m *AsyncDataSource) GetSpecifier() isAsyncDataSource_Specifier { @@ -2016,7 +2103,7 @@ type TransportSocket struct { func (x *TransportSocket) Reset() { *x = TransportSocket{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[21] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[22] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -2029,7 +2116,7 @@ func (x *TransportSocket) String() string { func (*TransportSocket) ProtoMessage() {} func (x *TransportSocket) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[21] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[22] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -2042,7 +2129,7 @@ func (x *TransportSocket) ProtoReflect() protoreflect.Message { // Deprecated: Use TransportSocket.ProtoReflect.Descriptor instead. func (*TransportSocket) Descriptor() ([]byte, []int) { - return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{21} + return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{22} } func (x *TransportSocket) GetName() string { @@ -2100,7 +2187,7 @@ type RuntimeFractionalPercent struct { func (x *RuntimeFractionalPercent) Reset() { *x = RuntimeFractionalPercent{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[22] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[23] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -2113,7 +2200,7 @@ func (x *RuntimeFractionalPercent) String() string { func (*RuntimeFractionalPercent) ProtoMessage() {} func (x *RuntimeFractionalPercent) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[22] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[23] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -2126,7 +2213,7 @@ func (x *RuntimeFractionalPercent) ProtoReflect() protoreflect.Message { // Deprecated: Use RuntimeFractionalPercent.ProtoReflect.Descriptor instead. func (*RuntimeFractionalPercent) Descriptor() ([]byte, []int) { - return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{22} + return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{23} } func (x *RuntimeFractionalPercent) GetDefaultValue() *v3.FractionalPercent { @@ -2158,7 +2245,7 @@ type ControlPlane struct { func (x *ControlPlane) Reset() { *x = ControlPlane{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[23] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[24] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -2171,7 +2258,7 @@ func (x *ControlPlane) String() string { func (*ControlPlane) ProtoMessage() {} func (x *ControlPlane) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[23] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[24] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -2184,7 +2271,7 @@ func (x *ControlPlane) ProtoReflect() protoreflect.Message { // Deprecated: Use ControlPlane.ProtoReflect.Descriptor instead. func (*ControlPlane) Descriptor() ([]byte, []int) { - return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{23} + return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{24} } func (x *ControlPlane) GetIdentifier() string { @@ -2210,7 +2297,7 @@ type RetryPolicy_RetryPriority struct { func (x *RetryPolicy_RetryPriority) Reset() { *x = RetryPolicy_RetryPriority{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[27] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[28] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -2223,7 +2310,7 @@ func (x *RetryPolicy_RetryPriority) String() string { func (*RetryPolicy_RetryPriority) ProtoMessage() {} func (x *RetryPolicy_RetryPriority) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[27] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[28] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -2236,7 +2323,7 @@ func (x *RetryPolicy_RetryPriority) ProtoReflect() protoreflect.Message { // Deprecated: Use RetryPolicy_RetryPriority.ProtoReflect.Descriptor instead. func (*RetryPolicy_RetryPriority) Descriptor() ([]byte, []int) { - return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{18, 0} + return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{19, 0} } func (x *RetryPolicy_RetryPriority) GetName() string { @@ -2286,7 +2373,7 @@ type RetryPolicy_RetryHostPredicate struct { func (x *RetryPolicy_RetryHostPredicate) Reset() { *x = RetryPolicy_RetryHostPredicate{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[28] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[29] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -2299,7 +2386,7 @@ func (x *RetryPolicy_RetryHostPredicate) String() string { func (*RetryPolicy_RetryHostPredicate) ProtoMessage() {} func (x *RetryPolicy_RetryHostPredicate) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_core_v3_base_proto_msgTypes[28] + mi := &file_envoy_config_core_v3_base_proto_msgTypes[29] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -2312,7 +2399,7 @@ func (x *RetryPolicy_RetryHostPredicate) ProtoReflect() protoreflect.Message { // Deprecated: Use RetryPolicy_RetryHostPredicate.ProtoReflect.Descriptor instead. func (*RetryPolicy_RetryHostPredicate) Descriptor() ([]byte, []int) { - return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{18, 1} + return file_envoy_config_core_v3_base_proto_rawDescGZIP(), []int{19, 1} } func (x *RetryPolicy_RetryHostPredicate) GetName() string { @@ -2532,242 +2619,254 @@ var file_envoy_config_core_v3_base_proto_rawDesc = []byte{ 0x72, 0x75, 0x6e, 0x74, 0x69, 0x6d, 0x65, 0x4b, 0x65, 0x79, 0x3a, 0x2b, 0x9a, 0xc5, 0x88, 0x1e, 0x26, 0x0a, 0x24, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x52, 0x75, 0x6e, 0x74, 0x69, 0x6d, 0x65, 0x46, 0x65, 0x61, 0x74, - 0x75, 0x72, 0x65, 0x46, 0x6c, 0x61, 0x67, 0x22, 0x3f, 0x0a, 0x08, 0x4b, 0x65, 0x79, 0x56, 0x61, - 0x6c, 0x75, 0x65, 0x12, 0x1d, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, - 0x42, 0x0b, 0xfa, 0x42, 0x08, 0x72, 0x06, 0x10, 0x01, 0x28, 0x80, 0x80, 0x01, 0x52, 0x03, 0x6b, - 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x0c, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x22, 0xae, 0x02, 0x0a, 0x0e, 0x4b, 0x65, 0x79, - 0x56, 0x61, 0x6c, 0x75, 0x65, 0x41, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x12, 0x3e, 0x0a, 0x05, 0x65, - 0x6e, 0x74, 0x72, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1e, 0x2e, 0x65, 0x6e, 0x76, - 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, - 0x33, 0x2e, 0x4b, 0x65, 0x79, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x8a, - 0x01, 0x02, 0x10, 0x01, 0x52, 0x05, 0x65, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x5b, 0x0a, 0x06, 0x61, - 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x39, 0x2e, 0x65, 0x6e, - 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, - 0x76, 0x33, 0x2e, 0x4b, 0x65, 0x79, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x41, 0x70, 0x70, 0x65, 0x6e, - 0x64, 0x2e, 0x4b, 0x65, 0x79, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x41, 0x70, 0x70, 0x65, 0x6e, 0x64, - 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x82, 0x01, 0x02, 0x10, 0x01, - 0x52, 0x06, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x7f, 0x0a, 0x14, 0x4b, 0x65, 0x79, 0x56, - 0x61, 0x6c, 0x75, 0x65, 0x41, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, - 0x12, 0x1b, 0x0a, 0x17, 0x41, 0x50, 0x50, 0x45, 0x4e, 0x44, 0x5f, 0x49, 0x46, 0x5f, 0x45, 0x58, - 0x49, 0x53, 0x54, 0x53, 0x5f, 0x4f, 0x52, 0x5f, 0x41, 0x44, 0x44, 0x10, 0x00, 0x12, 0x11, 0x0a, - 0x0d, 0x41, 0x44, 0x44, 0x5f, 0x49, 0x46, 0x5f, 0x41, 0x42, 0x53, 0x45, 0x4e, 0x54, 0x10, 0x01, - 0x12, 0x1e, 0x0a, 0x1a, 0x4f, 0x56, 0x45, 0x52, 0x57, 0x52, 0x49, 0x54, 0x45, 0x5f, 0x49, 0x46, - 0x5f, 0x45, 0x58, 0x49, 0x53, 0x54, 0x53, 0x5f, 0x4f, 0x52, 0x5f, 0x41, 0x44, 0x44, 0x10, 0x02, - 0x12, 0x17, 0x0a, 0x13, 0x4f, 0x56, 0x45, 0x52, 0x57, 0x52, 0x49, 0x54, 0x45, 0x5f, 0x49, 0x46, - 0x5f, 0x45, 0x58, 0x49, 0x53, 0x54, 0x53, 0x10, 0x03, 0x22, 0x73, 0x0a, 0x10, 0x4b, 0x65, 0x79, - 0x56, 0x61, 0x6c, 0x75, 0x65, 0x4d, 0x75, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x3c, 0x0a, - 0x06, 0x61, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, - 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, - 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x4b, 0x65, 0x79, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x41, 0x70, 0x70, - 0x65, 0x6e, 0x64, 0x52, 0x06, 0x61, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x12, 0x21, 0x0a, 0x06, 0x72, - 0x65, 0x6d, 0x6f, 0x76, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x09, 0xfa, 0x42, 0x06, - 0x72, 0x04, 0x28, 0x80, 0x80, 0x01, 0x52, 0x06, 0x72, 0x65, 0x6d, 0x6f, 0x76, 0x65, 0x22, 0x41, - 0x0a, 0x0e, 0x51, 0x75, 0x65, 0x72, 0x79, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, - 0x12, 0x19, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, - 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, - 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, - 0x65, 0x22, 0xcd, 0x01, 0x0a, 0x0b, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, - 0x65, 0x12, 0x23, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x11, - 0xfa, 0x42, 0x0e, 0x72, 0x0c, 0x10, 0x01, 0x28, 0x80, 0x80, 0x01, 0xc8, 0x01, 0x00, 0xc0, 0x01, - 0x01, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x37, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x21, 0xfa, 0x42, 0x0c, 0x72, 0x0a, 0x28, 0x80, 0x80, 0x01, - 0xc8, 0x01, 0x00, 0xc0, 0x01, 0x02, 0xf2, 0x98, 0xfe, 0x8f, 0x05, 0x0c, 0x12, 0x0a, 0x76, 0x61, - 0x6c, 0x75, 0x65, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x12, - 0x3a, 0x0a, 0x09, 0x72, 0x61, 0x77, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x03, 0x20, 0x01, - 0x28, 0x0c, 0x42, 0x1d, 0xfa, 0x42, 0x08, 0x7a, 0x06, 0x10, 0x00, 0x18, 0x80, 0x80, 0x01, 0xf2, - 0x98, 0xfe, 0x8f, 0x05, 0x0c, 0x12, 0x0a, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x5f, 0x74, 0x79, 0x70, - 0x65, 0x52, 0x08, 0x72, 0x61, 0x77, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x24, 0x9a, 0xc5, 0x88, - 0x1e, 0x1f, 0x0a, 0x1d, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, - 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, - 0x65, 0x22, 0xd9, 0x03, 0x0a, 0x11, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, - 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x43, 0x0a, 0x06, 0x68, 0x65, 0x61, 0x64, 0x65, - 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, - 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x48, - 0x65, 0x61, 0x64, 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x8a, - 0x01, 0x02, 0x10, 0x01, 0x52, 0x06, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x12, 0x3f, 0x0a, 0x06, - 0x61, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, - 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, - 0x33, 0x2e, 0x30, 0x18, 0x01, 0x52, 0x06, 0x61, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x12, 0x69, 0x0a, - 0x0d, 0x61, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x5f, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, - 0x20, 0x01, 0x28, 0x0e, 0x32, 0x3a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x48, 0x65, 0x61, 0x64, - 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x48, 0x65, - 0x61, 0x64, 0x65, 0x72, 0x41, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, - 0x42, 0x08, 0xfa, 0x42, 0x05, 0x82, 0x01, 0x02, 0x10, 0x01, 0x52, 0x0c, 0x61, 0x70, 0x70, 0x65, - 0x6e, 0x64, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x28, 0x0a, 0x10, 0x6b, 0x65, 0x65, 0x70, - 0x5f, 0x65, 0x6d, 0x70, 0x74, 0x79, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x04, 0x20, 0x01, - 0x28, 0x08, 0x52, 0x0e, 0x6b, 0x65, 0x65, 0x70, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x56, 0x61, 0x6c, - 0x75, 0x65, 0x22, 0x7d, 0x0a, 0x12, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x41, 0x70, 0x70, 0x65, - 0x6e, 0x64, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1b, 0x0a, 0x17, 0x41, 0x50, 0x50, 0x45, - 0x4e, 0x44, 0x5f, 0x49, 0x46, 0x5f, 0x45, 0x58, 0x49, 0x53, 0x54, 0x53, 0x5f, 0x4f, 0x52, 0x5f, - 0x41, 0x44, 0x44, 0x10, 0x00, 0x12, 0x11, 0x0a, 0x0d, 0x41, 0x44, 0x44, 0x5f, 0x49, 0x46, 0x5f, - 0x41, 0x42, 0x53, 0x45, 0x4e, 0x54, 0x10, 0x01, 0x12, 0x1e, 0x0a, 0x1a, 0x4f, 0x56, 0x45, 0x52, - 0x57, 0x52, 0x49, 0x54, 0x45, 0x5f, 0x49, 0x46, 0x5f, 0x45, 0x58, 0x49, 0x53, 0x54, 0x53, 0x5f, - 0x4f, 0x52, 0x5f, 0x41, 0x44, 0x44, 0x10, 0x02, 0x12, 0x17, 0x0a, 0x13, 0x4f, 0x56, 0x45, 0x52, - 0x57, 0x52, 0x49, 0x54, 0x45, 0x5f, 0x49, 0x46, 0x5f, 0x45, 0x58, 0x49, 0x53, 0x54, 0x53, 0x10, - 0x03, 0x3a, 0x2a, 0x9a, 0xc5, 0x88, 0x1e, 0x25, 0x0a, 0x23, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, - 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x48, 0x65, 0x61, 0x64, - 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x6c, 0x0a, - 0x09, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x4d, 0x61, 0x70, 0x12, 0x3b, 0x0a, 0x07, 0x68, 0x65, - 0x61, 0x64, 0x65, 0x72, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x65, 0x6e, + 0x75, 0x72, 0x65, 0x46, 0x6c, 0x61, 0x67, 0x22, 0x57, 0x0a, 0x08, 0x4b, 0x65, 0x79, 0x56, 0x61, + 0x6c, 0x75, 0x65, 0x12, 0x28, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, + 0x42, 0x16, 0xfa, 0x42, 0x08, 0x72, 0x06, 0x10, 0x01, 0x28, 0x80, 0x80, 0x01, 0x92, 0xc7, 0x86, + 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x21, 0x0a, + 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0c, 0x42, 0x0b, 0x92, 0xc7, + 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, + 0x22, 0x5b, 0x0a, 0x0c, 0x4b, 0x65, 0x79, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x50, 0x61, 0x69, 0x72, + 0x12, 0x1d, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x0b, 0xfa, + 0x42, 0x08, 0x72, 0x06, 0x10, 0x01, 0x28, 0x80, 0x80, 0x01, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, + 0x2c, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x16, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, + 0x2e, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x22, 0xf5, 0x02, + 0x0a, 0x0e, 0x4b, 0x65, 0x79, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x41, 0x70, 0x70, 0x65, 0x6e, 0x64, + 0x12, 0x3a, 0x0a, 0x06, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x22, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, + 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x4b, 0x65, 0x79, 0x56, 0x61, 0x6c, 0x75, 0x65, + 0x50, 0x61, 0x69, 0x72, 0x52, 0x06, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x12, 0x49, 0x0a, 0x05, + 0x65, 0x6e, 0x74, 0x72, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1e, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, - 0x76, 0x33, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x07, - 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x3a, 0x22, 0x9a, 0xc5, 0x88, 0x1e, 0x1d, 0x0a, 0x1b, + 0x76, 0x33, 0x2e, 0x4b, 0x65, 0x79, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x13, 0xfa, 0x42, 0x05, + 0x8a, 0x01, 0x02, 0x08, 0x01, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, + 0x52, 0x05, 0x65, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x5b, 0x0a, 0x06, 0x61, 0x63, 0x74, 0x69, 0x6f, + 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x39, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, + 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x4b, + 0x65, 0x79, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x41, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x2e, 0x4b, 0x65, + 0x79, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x41, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x41, 0x63, 0x74, 0x69, + 0x6f, 0x6e, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x82, 0x01, 0x02, 0x10, 0x01, 0x52, 0x06, 0x61, 0x63, + 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x7f, 0x0a, 0x14, 0x4b, 0x65, 0x79, 0x56, 0x61, 0x6c, 0x75, 0x65, + 0x41, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1b, 0x0a, 0x17, + 0x41, 0x50, 0x50, 0x45, 0x4e, 0x44, 0x5f, 0x49, 0x46, 0x5f, 0x45, 0x58, 0x49, 0x53, 0x54, 0x53, + 0x5f, 0x4f, 0x52, 0x5f, 0x41, 0x44, 0x44, 0x10, 0x00, 0x12, 0x11, 0x0a, 0x0d, 0x41, 0x44, 0x44, + 0x5f, 0x49, 0x46, 0x5f, 0x41, 0x42, 0x53, 0x45, 0x4e, 0x54, 0x10, 0x01, 0x12, 0x1e, 0x0a, 0x1a, + 0x4f, 0x56, 0x45, 0x52, 0x57, 0x52, 0x49, 0x54, 0x45, 0x5f, 0x49, 0x46, 0x5f, 0x45, 0x58, 0x49, + 0x53, 0x54, 0x53, 0x5f, 0x4f, 0x52, 0x5f, 0x41, 0x44, 0x44, 0x10, 0x02, 0x12, 0x17, 0x0a, 0x13, + 0x4f, 0x56, 0x45, 0x52, 0x57, 0x52, 0x49, 0x54, 0x45, 0x5f, 0x49, 0x46, 0x5f, 0x45, 0x58, 0x49, + 0x53, 0x54, 0x53, 0x10, 0x03, 0x22, 0x73, 0x0a, 0x10, 0x4b, 0x65, 0x79, 0x56, 0x61, 0x6c, 0x75, + 0x65, 0x4d, 0x75, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x3c, 0x0a, 0x06, 0x61, 0x70, 0x70, + 0x65, 0x6e, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x65, 0x6e, 0x76, 0x6f, + 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, + 0x2e, 0x4b, 0x65, 0x79, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x41, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x52, + 0x06, 0x61, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x12, 0x21, 0x0a, 0x06, 0x72, 0x65, 0x6d, 0x6f, 0x76, + 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x09, 0xfa, 0x42, 0x06, 0x72, 0x04, 0x28, 0x80, + 0x80, 0x01, 0x52, 0x06, 0x72, 0x65, 0x6d, 0x6f, 0x76, 0x65, 0x22, 0x41, 0x0a, 0x0e, 0x51, 0x75, + 0x65, 0x72, 0x79, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x12, 0x19, 0x0a, 0x03, + 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, + 0x10, 0x01, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, + 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x22, 0xcd, 0x01, + 0x0a, 0x0b, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x23, 0x0a, + 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x11, 0xfa, 0x42, 0x0e, 0x72, + 0x0c, 0x10, 0x01, 0x28, 0x80, 0x80, 0x01, 0xc8, 0x01, 0x00, 0xc0, 0x01, 0x01, 0x52, 0x03, 0x6b, + 0x65, 0x79, 0x12, 0x37, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, + 0x09, 0x42, 0x21, 0xfa, 0x42, 0x0c, 0x72, 0x0a, 0x28, 0x80, 0x80, 0x01, 0xc8, 0x01, 0x00, 0xc0, + 0x01, 0x02, 0xf2, 0x98, 0xfe, 0x8f, 0x05, 0x0c, 0x12, 0x0a, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x5f, + 0x74, 0x79, 0x70, 0x65, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x3a, 0x0a, 0x09, 0x72, + 0x61, 0x77, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0c, 0x42, 0x1d, + 0xfa, 0x42, 0x08, 0x7a, 0x06, 0x10, 0x00, 0x18, 0x80, 0x80, 0x01, 0xf2, 0x98, 0xfe, 0x8f, 0x05, + 0x0c, 0x12, 0x0a, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x52, 0x08, 0x72, + 0x61, 0x77, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x24, 0x9a, 0xc5, 0x88, 0x1e, 0x1f, 0x0a, 0x1d, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, - 0x65, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x4d, 0x61, 0x70, 0x22, 0x2f, 0x0a, 0x10, 0x57, - 0x61, 0x74, 0x63, 0x68, 0x65, 0x64, 0x44, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x79, 0x12, - 0x1b, 0x0a, 0x04, 0x70, 0x61, 0x74, 0x68, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, - 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x04, 0x70, 0x61, 0x74, 0x68, 0x22, 0xc9, 0x02, 0x0a, - 0x0a, 0x44, 0x61, 0x74, 0x61, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x12, 0x25, 0x0a, 0x08, 0x66, - 0x69, 0x6c, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, - 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x48, 0x00, 0x52, 0x08, 0x66, 0x69, 0x6c, 0x65, 0x6e, 0x61, - 0x6d, 0x65, 0x12, 0x23, 0x0a, 0x0c, 0x69, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x5f, 0x62, 0x79, 0x74, - 0x65, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0c, 0x48, 0x00, 0x52, 0x0b, 0x69, 0x6e, 0x6c, 0x69, - 0x6e, 0x65, 0x42, 0x79, 0x74, 0x65, 0x73, 0x12, 0x25, 0x0a, 0x0d, 0x69, 0x6e, 0x6c, 0x69, 0x6e, - 0x65, 0x5f, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x48, 0x00, - 0x52, 0x0c, 0x69, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x12, 0x3c, - 0x0a, 0x14, 0x65, 0x6e, 0x76, 0x69, 0x72, 0x6f, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x5f, 0x76, 0x61, - 0x72, 0x69, 0x61, 0x62, 0x6c, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, - 0x04, 0x72, 0x02, 0x10, 0x01, 0x48, 0x00, 0x52, 0x13, 0x65, 0x6e, 0x76, 0x69, 0x72, 0x6f, 0x6e, - 0x6d, 0x65, 0x6e, 0x74, 0x56, 0x61, 0x72, 0x69, 0x61, 0x62, 0x6c, 0x65, 0x12, 0x53, 0x0a, 0x11, - 0x77, 0x61, 0x74, 0x63, 0x68, 0x65, 0x64, 0x5f, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6f, 0x72, - 0x79, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x26, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, - 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x57, - 0x61, 0x74, 0x63, 0x68, 0x65, 0x64, 0x44, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x79, 0x52, - 0x10, 0x77, 0x61, 0x74, 0x63, 0x68, 0x65, 0x64, 0x44, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6f, 0x72, - 0x79, 0x3a, 0x23, 0x9a, 0xc5, 0x88, 0x1e, 0x1e, 0x0a, 0x1c, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, - 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x44, 0x61, 0x74, 0x61, - 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x42, 0x10, 0x0a, 0x09, 0x73, 0x70, 0x65, 0x63, 0x69, 0x66, - 0x69, 0x65, 0x72, 0x12, 0x03, 0xf8, 0x42, 0x01, 0x22, 0xee, 0x05, 0x0a, 0x0b, 0x52, 0x65, 0x74, - 0x72, 0x79, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x4b, 0x0a, 0x0e, 0x72, 0x65, 0x74, 0x72, - 0x79, 0x5f, 0x62, 0x61, 0x63, 0x6b, 0x5f, 0x6f, 0x66, 0x66, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x25, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, - 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x42, 0x61, 0x63, 0x6b, 0x6f, 0x66, 0x66, 0x53, - 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x52, 0x0c, 0x72, 0x65, 0x74, 0x72, 0x79, 0x42, 0x61, - 0x63, 0x6b, 0x4f, 0x66, 0x66, 0x12, 0x52, 0x0a, 0x0b, 0x6e, 0x75, 0x6d, 0x5f, 0x72, 0x65, 0x74, - 0x72, 0x69, 0x65, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, - 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x13, 0xf2, 0x98, 0xfe, 0x8f, 0x05, 0x0d, - 0x0a, 0x0b, 0x6d, 0x61, 0x78, 0x5f, 0x72, 0x65, 0x74, 0x72, 0x69, 0x65, 0x73, 0x52, 0x0a, 0x6e, - 0x75, 0x6d, 0x52, 0x65, 0x74, 0x72, 0x69, 0x65, 0x73, 0x12, 0x19, 0x0a, 0x08, 0x72, 0x65, 0x74, - 0x72, 0x79, 0x5f, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x72, 0x65, 0x74, - 0x72, 0x79, 0x4f, 0x6e, 0x12, 0x56, 0x0a, 0x0e, 0x72, 0x65, 0x74, 0x72, 0x79, 0x5f, 0x70, 0x72, - 0x69, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x65, + 0x65, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x22, 0xd9, 0x03, + 0x0a, 0x11, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x4f, 0x70, 0x74, + 0x69, 0x6f, 0x6e, 0x12, 0x43, 0x0a, 0x06, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x18, 0x01, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, + 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, + 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x8a, 0x01, 0x02, 0x10, 0x01, + 0x52, 0x06, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x12, 0x3f, 0x0a, 0x06, 0x61, 0x70, 0x70, 0x65, + 0x6e, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, + 0x61, 0x6c, 0x75, 0x65, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, + 0x01, 0x52, 0x06, 0x61, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x12, 0x69, 0x0a, 0x0d, 0x61, 0x70, 0x70, + 0x65, 0x6e, 0x64, 0x5f, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0e, + 0x32, 0x3a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, + 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x56, 0x61, + 0x6c, 0x75, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, + 0x41, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x08, 0xfa, 0x42, + 0x05, 0x82, 0x01, 0x02, 0x10, 0x01, 0x52, 0x0c, 0x61, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x41, 0x63, + 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x28, 0x0a, 0x10, 0x6b, 0x65, 0x65, 0x70, 0x5f, 0x65, 0x6d, 0x70, + 0x74, 0x79, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0e, + 0x6b, 0x65, 0x65, 0x70, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x22, 0x7d, + 0x0a, 0x12, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x41, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x41, 0x63, + 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1b, 0x0a, 0x17, 0x41, 0x50, 0x50, 0x45, 0x4e, 0x44, 0x5f, 0x49, + 0x46, 0x5f, 0x45, 0x58, 0x49, 0x53, 0x54, 0x53, 0x5f, 0x4f, 0x52, 0x5f, 0x41, 0x44, 0x44, 0x10, + 0x00, 0x12, 0x11, 0x0a, 0x0d, 0x41, 0x44, 0x44, 0x5f, 0x49, 0x46, 0x5f, 0x41, 0x42, 0x53, 0x45, + 0x4e, 0x54, 0x10, 0x01, 0x12, 0x1e, 0x0a, 0x1a, 0x4f, 0x56, 0x45, 0x52, 0x57, 0x52, 0x49, 0x54, + 0x45, 0x5f, 0x49, 0x46, 0x5f, 0x45, 0x58, 0x49, 0x53, 0x54, 0x53, 0x5f, 0x4f, 0x52, 0x5f, 0x41, + 0x44, 0x44, 0x10, 0x02, 0x12, 0x17, 0x0a, 0x13, 0x4f, 0x56, 0x45, 0x52, 0x57, 0x52, 0x49, 0x54, + 0x45, 0x5f, 0x49, 0x46, 0x5f, 0x45, 0x58, 0x49, 0x53, 0x54, 0x53, 0x10, 0x03, 0x3a, 0x2a, 0x9a, + 0xc5, 0x88, 0x1e, 0x25, 0x0a, 0x23, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, + 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x56, 0x61, + 0x6c, 0x75, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x6c, 0x0a, 0x09, 0x48, 0x65, 0x61, + 0x64, 0x65, 0x72, 0x4d, 0x61, 0x70, 0x12, 0x3b, 0x0a, 0x07, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, + 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, + 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x48, + 0x65, 0x61, 0x64, 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x07, 0x68, 0x65, 0x61, 0x64, + 0x65, 0x72, 0x73, 0x3a, 0x22, 0x9a, 0xc5, 0x88, 0x1e, 0x1d, 0x0a, 0x1b, 0x65, 0x6e, 0x76, 0x6f, + 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x48, 0x65, + 0x61, 0x64, 0x65, 0x72, 0x4d, 0x61, 0x70, 0x22, 0x2f, 0x0a, 0x10, 0x57, 0x61, 0x74, 0x63, 0x68, + 0x65, 0x64, 0x44, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x79, 0x12, 0x1b, 0x0a, 0x04, 0x70, + 0x61, 0x74, 0x68, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, + 0x10, 0x01, 0x52, 0x04, 0x70, 0x61, 0x74, 0x68, 0x22, 0xc9, 0x02, 0x0a, 0x0a, 0x44, 0x61, 0x74, + 0x61, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x12, 0x25, 0x0a, 0x08, 0x66, 0x69, 0x6c, 0x65, 0x6e, + 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, + 0x10, 0x01, 0x48, 0x00, 0x52, 0x08, 0x66, 0x69, 0x6c, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x23, + 0x0a, 0x0c, 0x69, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x5f, 0x62, 0x79, 0x74, 0x65, 0x73, 0x18, 0x02, + 0x20, 0x01, 0x28, 0x0c, 0x48, 0x00, 0x52, 0x0b, 0x69, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x42, 0x79, + 0x74, 0x65, 0x73, 0x12, 0x25, 0x0a, 0x0d, 0x69, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x5f, 0x73, 0x74, + 0x72, 0x69, 0x6e, 0x67, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x48, 0x00, 0x52, 0x0c, 0x69, 0x6e, + 0x6c, 0x69, 0x6e, 0x65, 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x12, 0x3c, 0x0a, 0x14, 0x65, 0x6e, + 0x76, 0x69, 0x72, 0x6f, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x5f, 0x76, 0x61, 0x72, 0x69, 0x61, 0x62, + 0x6c, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, + 0x01, 0x48, 0x00, 0x52, 0x13, 0x65, 0x6e, 0x76, 0x69, 0x72, 0x6f, 0x6e, 0x6d, 0x65, 0x6e, 0x74, + 0x56, 0x61, 0x72, 0x69, 0x61, 0x62, 0x6c, 0x65, 0x12, 0x53, 0x0a, 0x11, 0x77, 0x61, 0x74, 0x63, + 0x68, 0x65, 0x64, 0x5f, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x79, 0x18, 0x05, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x26, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, + 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x57, 0x61, 0x74, 0x63, 0x68, + 0x65, 0x64, 0x44, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x79, 0x52, 0x10, 0x77, 0x61, 0x74, + 0x63, 0x68, 0x65, 0x64, 0x44, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x79, 0x3a, 0x23, 0x9a, + 0xc5, 0x88, 0x1e, 0x1e, 0x0a, 0x1c, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, + 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x44, 0x61, 0x74, 0x61, 0x53, 0x6f, 0x75, 0x72, + 0x63, 0x65, 0x42, 0x10, 0x0a, 0x09, 0x73, 0x70, 0x65, 0x63, 0x69, 0x66, 0x69, 0x65, 0x72, 0x12, + 0x03, 0xf8, 0x42, 0x01, 0x22, 0xee, 0x05, 0x0a, 0x0b, 0x52, 0x65, 0x74, 0x72, 0x79, 0x50, 0x6f, + 0x6c, 0x69, 0x63, 0x79, 0x12, 0x4b, 0x0a, 0x0e, 0x72, 0x65, 0x74, 0x72, 0x79, 0x5f, 0x62, 0x61, + 0x63, 0x6b, 0x5f, 0x6f, 0x66, 0x66, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, - 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x65, 0x74, 0x72, 0x79, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, - 0x52, 0x65, 0x74, 0x72, 0x79, 0x50, 0x72, 0x69, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x52, 0x0d, 0x72, - 0x65, 0x74, 0x72, 0x79, 0x50, 0x72, 0x69, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x12, 0x66, 0x0a, 0x14, - 0x72, 0x65, 0x74, 0x72, 0x79, 0x5f, 0x68, 0x6f, 0x73, 0x74, 0x5f, 0x70, 0x72, 0x65, 0x64, 0x69, - 0x63, 0x61, 0x74, 0x65, 0x18, 0x05, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x34, 0x2e, 0x65, 0x6e, 0x76, - 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, - 0x33, 0x2e, 0x52, 0x65, 0x74, 0x72, 0x79, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x52, 0x65, + 0x2e, 0x76, 0x33, 0x2e, 0x42, 0x61, 0x63, 0x6b, 0x6f, 0x66, 0x66, 0x53, 0x74, 0x72, 0x61, 0x74, + 0x65, 0x67, 0x79, 0x52, 0x0c, 0x72, 0x65, 0x74, 0x72, 0x79, 0x42, 0x61, 0x63, 0x6b, 0x4f, 0x66, + 0x66, 0x12, 0x52, 0x0a, 0x0b, 0x6e, 0x75, 0x6d, 0x5f, 0x72, 0x65, 0x74, 0x72, 0x69, 0x65, 0x73, + 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, + 0x61, 0x6c, 0x75, 0x65, 0x42, 0x13, 0xf2, 0x98, 0xfe, 0x8f, 0x05, 0x0d, 0x0a, 0x0b, 0x6d, 0x61, + 0x78, 0x5f, 0x72, 0x65, 0x74, 0x72, 0x69, 0x65, 0x73, 0x52, 0x0a, 0x6e, 0x75, 0x6d, 0x52, 0x65, + 0x74, 0x72, 0x69, 0x65, 0x73, 0x12, 0x19, 0x0a, 0x08, 0x72, 0x65, 0x74, 0x72, 0x79, 0x5f, 0x6f, + 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x72, 0x65, 0x74, 0x72, 0x79, 0x4f, 0x6e, + 0x12, 0x56, 0x0a, 0x0e, 0x72, 0x65, 0x74, 0x72, 0x79, 0x5f, 0x70, 0x72, 0x69, 0x6f, 0x72, 0x69, + 0x74, 0x79, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, + 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, + 0x52, 0x65, 0x74, 0x72, 0x79, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x52, 0x65, 0x74, 0x72, + 0x79, 0x50, 0x72, 0x69, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x52, 0x0d, 0x72, 0x65, 0x74, 0x72, 0x79, + 0x50, 0x72, 0x69, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x12, 0x66, 0x0a, 0x14, 0x72, 0x65, 0x74, 0x72, + 0x79, 0x5f, 0x68, 0x6f, 0x73, 0x74, 0x5f, 0x70, 0x72, 0x65, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, + 0x18, 0x05, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x34, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x65, + 0x74, 0x72, 0x79, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x52, 0x65, 0x74, 0x72, 0x79, 0x48, + 0x6f, 0x73, 0x74, 0x50, 0x72, 0x65, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x52, 0x12, 0x72, 0x65, 0x74, 0x72, 0x79, 0x48, 0x6f, 0x73, 0x74, 0x50, 0x72, 0x65, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, - 0x52, 0x12, 0x72, 0x65, 0x74, 0x72, 0x79, 0x48, 0x6f, 0x73, 0x74, 0x50, 0x72, 0x65, 0x64, 0x69, - 0x63, 0x61, 0x74, 0x65, 0x12, 0x48, 0x0a, 0x21, 0x68, 0x6f, 0x73, 0x74, 0x5f, 0x73, 0x65, 0x6c, - 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x74, 0x72, 0x79, 0x5f, 0x6d, 0x61, 0x78, - 0x5f, 0x61, 0x74, 0x74, 0x65, 0x6d, 0x70, 0x74, 0x73, 0x18, 0x06, 0x20, 0x01, 0x28, 0x03, 0x52, - 0x1d, 0x68, 0x6f, 0x73, 0x74, 0x53, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, - 0x74, 0x72, 0x79, 0x4d, 0x61, 0x78, 0x41, 0x74, 0x74, 0x65, 0x6d, 0x70, 0x74, 0x73, 0x1a, 0x76, - 0x0a, 0x0d, 0x52, 0x65, 0x74, 0x72, 0x79, 0x50, 0x72, 0x69, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x12, - 0x1b, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, - 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x39, 0x0a, 0x0c, - 0x74, 0x79, 0x70, 0x65, 0x64, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x14, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x41, 0x6e, 0x79, 0x48, 0x00, 0x52, 0x0b, 0x74, 0x79, 0x70, 0x65, - 0x64, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x42, 0x0d, 0x0a, 0x0b, 0x63, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x1a, 0x7b, 0x0a, 0x12, 0x52, 0x65, 0x74, 0x72, 0x79, 0x48, - 0x6f, 0x73, 0x74, 0x50, 0x72, 0x65, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x12, 0x1b, 0x0a, 0x04, - 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, - 0x02, 0x10, 0x01, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x39, 0x0a, 0x0c, 0x74, 0x79, 0x70, - 0x65, 0x64, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x14, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2e, 0x41, 0x6e, 0x79, 0x48, 0x00, 0x52, 0x0b, 0x74, 0x79, 0x70, 0x65, 0x64, 0x43, 0x6f, - 0x6e, 0x66, 0x69, 0x67, 0x42, 0x0d, 0x0a, 0x0b, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x5f, 0x74, - 0x79, 0x70, 0x65, 0x3a, 0x24, 0x9a, 0xc5, 0x88, 0x1e, 0x1f, 0x0a, 0x1d, 0x65, 0x6e, 0x76, 0x6f, - 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x52, 0x65, - 0x74, 0x72, 0x79, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x22, 0xe8, 0x01, 0x0a, 0x10, 0x52, 0x65, - 0x6d, 0x6f, 0x74, 0x65, 0x44, 0x61, 0x74, 0x61, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x12, 0x42, - 0x0a, 0x08, 0x68, 0x74, 0x74, 0x70, 0x5f, 0x75, 0x72, 0x69, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x1d, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, - 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x55, 0x72, 0x69, 0x42, - 0x08, 0xfa, 0x42, 0x05, 0x8a, 0x01, 0x02, 0x10, 0x01, 0x52, 0x07, 0x68, 0x74, 0x74, 0x70, 0x55, - 0x72, 0x69, 0x12, 0x1f, 0x0a, 0x06, 0x73, 0x68, 0x61, 0x32, 0x35, 0x36, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x06, 0x73, 0x68, 0x61, - 0x32, 0x35, 0x36, 0x12, 0x44, 0x0a, 0x0c, 0x72, 0x65, 0x74, 0x72, 0x79, 0x5f, 0x70, 0x6f, 0x6c, - 0x69, 0x63, 0x79, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x65, 0x6e, 0x76, 0x6f, - 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, - 0x2e, 0x52, 0x65, 0x74, 0x72, 0x79, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x0b, 0x72, 0x65, - 0x74, 0x72, 0x79, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x3a, 0x29, 0x9a, 0xc5, 0x88, 0x1e, 0x24, - 0x0a, 0x22, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, - 0x6f, 0x72, 0x65, 0x2e, 0x52, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x44, 0x61, 0x74, 0x61, 0x53, 0x6f, - 0x75, 0x72, 0x63, 0x65, 0x22, 0xc9, 0x01, 0x0a, 0x0f, 0x41, 0x73, 0x79, 0x6e, 0x63, 0x44, 0x61, - 0x74, 0x61, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x12, 0x38, 0x0a, 0x05, 0x6c, 0x6f, 0x63, 0x61, - 0x6c, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, - 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x44, - 0x61, 0x74, 0x61, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x48, 0x00, 0x52, 0x05, 0x6c, 0x6f, 0x63, - 0x61, 0x6c, 0x12, 0x40, 0x0a, 0x06, 0x72, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x26, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x65, 0x6d, 0x6f, 0x74, 0x65, - 0x44, 0x61, 0x74, 0x61, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x48, 0x00, 0x52, 0x06, 0x72, 0x65, - 0x6d, 0x6f, 0x74, 0x65, 0x3a, 0x28, 0x9a, 0xc5, 0x88, 0x1e, 0x23, 0x0a, 0x21, 0x65, 0x6e, 0x76, - 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x41, - 0x73, 0x79, 0x6e, 0x63, 0x44, 0x61, 0x74, 0x61, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x42, 0x10, - 0x0a, 0x09, 0x73, 0x70, 0x65, 0x63, 0x69, 0x66, 0x69, 0x65, 0x72, 0x12, 0x03, 0xf8, 0x42, 0x01, - 0x22, 0xb0, 0x01, 0x0a, 0x0f, 0x54, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x53, 0x6f, - 0x63, 0x6b, 0x65, 0x74, 0x12, 0x1b, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, - 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x04, 0x6e, 0x61, 0x6d, - 0x65, 0x12, 0x39, 0x0a, 0x0c, 0x74, 0x79, 0x70, 0x65, 0x64, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x14, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x41, 0x6e, 0x79, 0x48, 0x00, 0x52, - 0x0b, 0x74, 0x79, 0x70, 0x65, 0x64, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x3a, 0x28, 0x9a, 0xc5, - 0x88, 0x1e, 0x23, 0x0a, 0x21, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, - 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x54, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, - 0x53, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x42, 0x0d, 0x0a, 0x0b, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x5f, 0x74, 0x79, 0x70, 0x65, 0x4a, 0x04, 0x08, 0x02, 0x10, 0x03, 0x52, 0x06, 0x63, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x22, 0xbf, 0x01, 0x0a, 0x18, 0x52, 0x75, 0x6e, 0x74, 0x69, 0x6d, 0x65, 0x46, - 0x72, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x50, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74, - 0x12, 0x4f, 0x0a, 0x0d, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x75, - 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, - 0x74, 0x79, 0x70, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x46, 0x72, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, - 0x61, 0x6c, 0x50, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x8a, 0x01, - 0x02, 0x10, 0x01, 0x52, 0x0c, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x56, 0x61, 0x6c, 0x75, - 0x65, 0x12, 0x1f, 0x0a, 0x0b, 0x72, 0x75, 0x6e, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x6b, 0x65, 0x79, - 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0a, 0x72, 0x75, 0x6e, 0x74, 0x69, 0x6d, 0x65, 0x4b, - 0x65, 0x79, 0x3a, 0x31, 0x9a, 0xc5, 0x88, 0x1e, 0x2c, 0x0a, 0x2a, 0x65, 0x6e, 0x76, 0x6f, 0x79, - 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x52, 0x75, 0x6e, - 0x74, 0x69, 0x6d, 0x65, 0x46, 0x72, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x50, 0x65, - 0x72, 0x63, 0x65, 0x6e, 0x74, 0x22, 0x55, 0x0a, 0x0c, 0x43, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, - 0x50, 0x6c, 0x61, 0x6e, 0x65, 0x12, 0x1e, 0x0a, 0x0a, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66, - 0x69, 0x65, 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0a, 0x69, 0x64, 0x65, 0x6e, 0x74, - 0x69, 0x66, 0x69, 0x65, 0x72, 0x3a, 0x25, 0x9a, 0xc5, 0x88, 0x1e, 0x20, 0x0a, 0x1e, 0x65, 0x6e, + 0x12, 0x48, 0x0a, 0x21, 0x68, 0x6f, 0x73, 0x74, 0x5f, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x69, + 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x74, 0x72, 0x79, 0x5f, 0x6d, 0x61, 0x78, 0x5f, 0x61, 0x74, 0x74, + 0x65, 0x6d, 0x70, 0x74, 0x73, 0x18, 0x06, 0x20, 0x01, 0x28, 0x03, 0x52, 0x1d, 0x68, 0x6f, 0x73, + 0x74, 0x53, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x74, 0x72, 0x79, 0x4d, + 0x61, 0x78, 0x41, 0x74, 0x74, 0x65, 0x6d, 0x70, 0x74, 0x73, 0x1a, 0x76, 0x0a, 0x0d, 0x52, 0x65, + 0x74, 0x72, 0x79, 0x50, 0x72, 0x69, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x12, 0x1b, 0x0a, 0x04, 0x6e, + 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, + 0x10, 0x01, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x39, 0x0a, 0x0c, 0x74, 0x79, 0x70, 0x65, + 0x64, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x14, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, + 0x2e, 0x41, 0x6e, 0x79, 0x48, 0x00, 0x52, 0x0b, 0x74, 0x79, 0x70, 0x65, 0x64, 0x43, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x42, 0x0d, 0x0a, 0x0b, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x5f, 0x74, 0x79, + 0x70, 0x65, 0x1a, 0x7b, 0x0a, 0x12, 0x52, 0x65, 0x74, 0x72, 0x79, 0x48, 0x6f, 0x73, 0x74, 0x50, + 0x72, 0x65, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x12, 0x1b, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, + 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x39, 0x0a, 0x0c, 0x74, 0x79, 0x70, 0x65, 0x64, 0x5f, 0x63, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x14, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x41, 0x6e, + 0x79, 0x48, 0x00, 0x52, 0x0b, 0x74, 0x79, 0x70, 0x65, 0x64, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, + 0x42, 0x0d, 0x0a, 0x0b, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x3a, + 0x24, 0x9a, 0xc5, 0x88, 0x1e, 0x1f, 0x0a, 0x1d, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, + 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x52, 0x65, 0x74, 0x72, 0x79, 0x50, + 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x22, 0xe8, 0x01, 0x0a, 0x10, 0x52, 0x65, 0x6d, 0x6f, 0x74, 0x65, + 0x44, 0x61, 0x74, 0x61, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x12, 0x42, 0x0a, 0x08, 0x68, 0x74, + 0x74, 0x70, 0x5f, 0x75, 0x72, 0x69, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1d, 0x2e, 0x65, + 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, + 0x2e, 0x76, 0x33, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x55, 0x72, 0x69, 0x42, 0x08, 0xfa, 0x42, 0x05, + 0x8a, 0x01, 0x02, 0x10, 0x01, 0x52, 0x07, 0x68, 0x74, 0x74, 0x70, 0x55, 0x72, 0x69, 0x12, 0x1f, + 0x0a, 0x06, 0x73, 0x68, 0x61, 0x32, 0x35, 0x36, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, + 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x06, 0x73, 0x68, 0x61, 0x32, 0x35, 0x36, 0x12, + 0x44, 0x0a, 0x0c, 0x72, 0x65, 0x74, 0x72, 0x79, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x18, + 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, + 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x65, 0x74, + 0x72, 0x79, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x52, 0x0b, 0x72, 0x65, 0x74, 0x72, 0x79, 0x50, + 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x3a, 0x29, 0x9a, 0xc5, 0x88, 0x1e, 0x24, 0x0a, 0x22, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, - 0x43, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x50, 0x6c, 0x61, 0x6e, 0x65, 0x2a, 0x28, 0x0a, 0x0f, - 0x52, 0x6f, 0x75, 0x74, 0x69, 0x6e, 0x67, 0x50, 0x72, 0x69, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x12, - 0x0b, 0x0a, 0x07, 0x44, 0x45, 0x46, 0x41, 0x55, 0x4c, 0x54, 0x10, 0x00, 0x12, 0x08, 0x0a, 0x04, - 0x48, 0x49, 0x47, 0x48, 0x10, 0x01, 0x2a, 0x89, 0x01, 0x0a, 0x0d, 0x52, 0x65, 0x71, 0x75, 0x65, - 0x73, 0x74, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x12, 0x16, 0x0a, 0x12, 0x4d, 0x45, 0x54, 0x48, - 0x4f, 0x44, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, - 0x12, 0x07, 0x0a, 0x03, 0x47, 0x45, 0x54, 0x10, 0x01, 0x12, 0x08, 0x0a, 0x04, 0x48, 0x45, 0x41, - 0x44, 0x10, 0x02, 0x12, 0x08, 0x0a, 0x04, 0x50, 0x4f, 0x53, 0x54, 0x10, 0x03, 0x12, 0x07, 0x0a, - 0x03, 0x50, 0x55, 0x54, 0x10, 0x04, 0x12, 0x0a, 0x0a, 0x06, 0x44, 0x45, 0x4c, 0x45, 0x54, 0x45, - 0x10, 0x05, 0x12, 0x0b, 0x0a, 0x07, 0x43, 0x4f, 0x4e, 0x4e, 0x45, 0x43, 0x54, 0x10, 0x06, 0x12, - 0x0b, 0x0a, 0x07, 0x4f, 0x50, 0x54, 0x49, 0x4f, 0x4e, 0x53, 0x10, 0x07, 0x12, 0x09, 0x0a, 0x05, - 0x54, 0x52, 0x41, 0x43, 0x45, 0x10, 0x08, 0x12, 0x09, 0x0a, 0x05, 0x50, 0x41, 0x54, 0x43, 0x48, - 0x10, 0x09, 0x2a, 0x3e, 0x0a, 0x10, 0x54, 0x72, 0x61, 0x66, 0x66, 0x69, 0x63, 0x44, 0x69, 0x72, - 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x0f, 0x0a, 0x0b, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, - 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x0b, 0x0a, 0x07, 0x49, 0x4e, 0x42, 0x4f, 0x55, - 0x4e, 0x44, 0x10, 0x01, 0x12, 0x0c, 0x0a, 0x08, 0x4f, 0x55, 0x54, 0x42, 0x4f, 0x55, 0x4e, 0x44, - 0x10, 0x02, 0x42, 0x7d, 0xba, 0x80, 0xc8, 0xd1, 0x06, 0x02, 0x10, 0x02, 0x0a, 0x22, 0x69, 0x6f, - 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2e, 0x65, 0x6e, 0x76, 0x6f, - 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, - 0x42, 0x09, 0x42, 0x61, 0x73, 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x42, 0x67, - 0x69, 0x74, 0x68, 0x75, 0x62, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, - 0x72, 0x6f, 0x78, 0x79, 0x2f, 0x67, 0x6f, 0x2d, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x2d, - 0x70, 0x6c, 0x61, 0x6e, 0x65, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x63, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x2f, 0x63, 0x6f, 0x72, 0x65, 0x2f, 0x76, 0x33, 0x3b, 0x63, 0x6f, 0x72, 0x65, 0x76, - 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x52, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x44, 0x61, 0x74, 0x61, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, + 0x22, 0xc9, 0x01, 0x0a, 0x0f, 0x41, 0x73, 0x79, 0x6e, 0x63, 0x44, 0x61, 0x74, 0x61, 0x53, 0x6f, + 0x75, 0x72, 0x63, 0x65, 0x12, 0x38, 0x0a, 0x05, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x18, 0x01, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, + 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x44, 0x61, 0x74, 0x61, 0x53, + 0x6f, 0x75, 0x72, 0x63, 0x65, 0x48, 0x00, 0x52, 0x05, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x12, 0x40, + 0x0a, 0x06, 0x72, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x26, + 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, + 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x44, 0x61, 0x74, 0x61, + 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x48, 0x00, 0x52, 0x06, 0x72, 0x65, 0x6d, 0x6f, 0x74, 0x65, + 0x3a, 0x28, 0x9a, 0xc5, 0x88, 0x1e, 0x23, 0x0a, 0x21, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, + 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x41, 0x73, 0x79, 0x6e, 0x63, + 0x44, 0x61, 0x74, 0x61, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x42, 0x10, 0x0a, 0x09, 0x73, 0x70, + 0x65, 0x63, 0x69, 0x66, 0x69, 0x65, 0x72, 0x12, 0x03, 0xf8, 0x42, 0x01, 0x22, 0xb0, 0x01, 0x0a, + 0x0f, 0x54, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x53, 0x6f, 0x63, 0x6b, 0x65, 0x74, + 0x12, 0x1b, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, + 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x39, 0x0a, + 0x0c, 0x74, 0x79, 0x70, 0x65, 0x64, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x03, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x14, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, + 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x41, 0x6e, 0x79, 0x48, 0x00, 0x52, 0x0b, 0x74, 0x79, 0x70, + 0x65, 0x64, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x3a, 0x28, 0x9a, 0xc5, 0x88, 0x1e, 0x23, 0x0a, + 0x21, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, + 0x72, 0x65, 0x2e, 0x54, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x53, 0x6f, 0x63, 0x6b, + 0x65, 0x74, 0x42, 0x0d, 0x0a, 0x0b, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x5f, 0x74, 0x79, 0x70, + 0x65, 0x4a, 0x04, 0x08, 0x02, 0x10, 0x03, 0x52, 0x06, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x22, + 0xbf, 0x01, 0x0a, 0x18, 0x52, 0x75, 0x6e, 0x74, 0x69, 0x6d, 0x65, 0x46, 0x72, 0x61, 0x63, 0x74, + 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x50, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74, 0x12, 0x4f, 0x0a, 0x0d, + 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x01, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, + 0x2e, 0x76, 0x33, 0x2e, 0x46, 0x72, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x50, 0x65, + 0x72, 0x63, 0x65, 0x6e, 0x74, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x8a, 0x01, 0x02, 0x10, 0x01, 0x52, + 0x0c, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x1f, 0x0a, + 0x0b, 0x72, 0x75, 0x6e, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x02, 0x20, 0x01, + 0x28, 0x09, 0x52, 0x0a, 0x72, 0x75, 0x6e, 0x74, 0x69, 0x6d, 0x65, 0x4b, 0x65, 0x79, 0x3a, 0x31, + 0x9a, 0xc5, 0x88, 0x1e, 0x2c, 0x0a, 0x2a, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, + 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x52, 0x75, 0x6e, 0x74, 0x69, 0x6d, 0x65, + 0x46, 0x72, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x50, 0x65, 0x72, 0x63, 0x65, 0x6e, + 0x74, 0x22, 0x55, 0x0a, 0x0c, 0x43, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x50, 0x6c, 0x61, 0x6e, + 0x65, 0x12, 0x1e, 0x0a, 0x0a, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x65, 0x72, 0x18, + 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0a, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x65, + 0x72, 0x3a, 0x25, 0x9a, 0xc5, 0x88, 0x1e, 0x20, 0x0a, 0x1e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, + 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x43, 0x6f, 0x6e, 0x74, + 0x72, 0x6f, 0x6c, 0x50, 0x6c, 0x61, 0x6e, 0x65, 0x2a, 0x28, 0x0a, 0x0f, 0x52, 0x6f, 0x75, 0x74, + 0x69, 0x6e, 0x67, 0x50, 0x72, 0x69, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x12, 0x0b, 0x0a, 0x07, 0x44, + 0x45, 0x46, 0x41, 0x55, 0x4c, 0x54, 0x10, 0x00, 0x12, 0x08, 0x0a, 0x04, 0x48, 0x49, 0x47, 0x48, + 0x10, 0x01, 0x2a, 0x89, 0x01, 0x0a, 0x0d, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x4d, 0x65, + 0x74, 0x68, 0x6f, 0x64, 0x12, 0x16, 0x0a, 0x12, 0x4d, 0x45, 0x54, 0x48, 0x4f, 0x44, 0x5f, 0x55, + 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x07, 0x0a, 0x03, + 0x47, 0x45, 0x54, 0x10, 0x01, 0x12, 0x08, 0x0a, 0x04, 0x48, 0x45, 0x41, 0x44, 0x10, 0x02, 0x12, + 0x08, 0x0a, 0x04, 0x50, 0x4f, 0x53, 0x54, 0x10, 0x03, 0x12, 0x07, 0x0a, 0x03, 0x50, 0x55, 0x54, + 0x10, 0x04, 0x12, 0x0a, 0x0a, 0x06, 0x44, 0x45, 0x4c, 0x45, 0x54, 0x45, 0x10, 0x05, 0x12, 0x0b, + 0x0a, 0x07, 0x43, 0x4f, 0x4e, 0x4e, 0x45, 0x43, 0x54, 0x10, 0x06, 0x12, 0x0b, 0x0a, 0x07, 0x4f, + 0x50, 0x54, 0x49, 0x4f, 0x4e, 0x53, 0x10, 0x07, 0x12, 0x09, 0x0a, 0x05, 0x54, 0x52, 0x41, 0x43, + 0x45, 0x10, 0x08, 0x12, 0x09, 0x0a, 0x05, 0x50, 0x41, 0x54, 0x43, 0x48, 0x10, 0x09, 0x2a, 0x3e, + 0x0a, 0x10, 0x54, 0x72, 0x61, 0x66, 0x66, 0x69, 0x63, 0x44, 0x69, 0x72, 0x65, 0x63, 0x74, 0x69, + 0x6f, 0x6e, 0x12, 0x0f, 0x0a, 0x0b, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, + 0x44, 0x10, 0x00, 0x12, 0x0b, 0x0a, 0x07, 0x49, 0x4e, 0x42, 0x4f, 0x55, 0x4e, 0x44, 0x10, 0x01, + 0x12, 0x0c, 0x0a, 0x08, 0x4f, 0x55, 0x54, 0x42, 0x4f, 0x55, 0x4e, 0x44, 0x10, 0x02, 0x42, 0x7d, + 0xba, 0x80, 0xc8, 0xd1, 0x06, 0x02, 0x10, 0x02, 0x0a, 0x22, 0x69, 0x6f, 0x2e, 0x65, 0x6e, 0x76, + 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, + 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x42, 0x09, 0x42, 0x61, + 0x73, 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x42, 0x67, 0x69, 0x74, 0x68, 0x75, + 0x62, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, + 0x2f, 0x67, 0x6f, 0x2d, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x2d, 0x70, 0x6c, 0x61, 0x6e, + 0x65, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2f, 0x63, + 0x6f, 0x72, 0x65, 0x2f, 0x76, 0x33, 0x3b, 0x63, 0x6f, 0x72, 0x65, 0x76, 0x33, 0x62, 0x06, 0x70, + 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( @@ -2783,7 +2882,7 @@ func file_envoy_config_core_v3_base_proto_rawDescGZIP() []byte { } var file_envoy_config_core_v3_base_proto_enumTypes = make([]protoimpl.EnumInfo, 5) -var file_envoy_config_core_v3_base_proto_msgTypes = make([]protoimpl.MessageInfo, 29) +var file_envoy_config_core_v3_base_proto_msgTypes = make([]protoimpl.MessageInfo, 30) var file_envoy_config_core_v3_base_proto_goTypes = []interface{}{ (RoutingPriority)(0), // 0: envoy.config.core.v3.RoutingPriority (RequestMethod)(0), // 1: envoy.config.core.v3.RequestMethod @@ -2800,79 +2899,83 @@ var file_envoy_config_core_v3_base_proto_goTypes = []interface{}{ (*RuntimeDouble)(nil), // 12: envoy.config.core.v3.RuntimeDouble (*RuntimeFeatureFlag)(nil), // 13: envoy.config.core.v3.RuntimeFeatureFlag (*KeyValue)(nil), // 14: envoy.config.core.v3.KeyValue - (*KeyValueAppend)(nil), // 15: envoy.config.core.v3.KeyValueAppend - (*KeyValueMutation)(nil), // 16: envoy.config.core.v3.KeyValueMutation - (*QueryParameter)(nil), // 17: envoy.config.core.v3.QueryParameter - (*HeaderValue)(nil), // 18: envoy.config.core.v3.HeaderValue - (*HeaderValueOption)(nil), // 19: envoy.config.core.v3.HeaderValueOption - (*HeaderMap)(nil), // 20: envoy.config.core.v3.HeaderMap - (*WatchedDirectory)(nil), // 21: envoy.config.core.v3.WatchedDirectory - (*DataSource)(nil), // 22: envoy.config.core.v3.DataSource - (*RetryPolicy)(nil), // 23: envoy.config.core.v3.RetryPolicy - (*RemoteDataSource)(nil), // 24: envoy.config.core.v3.RemoteDataSource - (*AsyncDataSource)(nil), // 25: envoy.config.core.v3.AsyncDataSource - (*TransportSocket)(nil), // 26: envoy.config.core.v3.TransportSocket - (*RuntimeFractionalPercent)(nil), // 27: envoy.config.core.v3.RuntimeFractionalPercent - (*ControlPlane)(nil), // 28: envoy.config.core.v3.ControlPlane - nil, // 29: envoy.config.core.v3.Node.DynamicParametersEntry - nil, // 30: envoy.config.core.v3.Metadata.FilterMetadataEntry - nil, // 31: envoy.config.core.v3.Metadata.TypedFilterMetadataEntry - (*RetryPolicy_RetryPriority)(nil), // 32: envoy.config.core.v3.RetryPolicy.RetryPriority - (*RetryPolicy_RetryHostPredicate)(nil), // 33: envoy.config.core.v3.RetryPolicy.RetryHostPredicate - (*v3.SemanticVersion)(nil), // 34: envoy.type.v3.SemanticVersion - (*structpb.Struct)(nil), // 35: google.protobuf.Struct - (*Address)(nil), // 36: envoy.config.core.v3.Address - (*v3.Percent)(nil), // 37: envoy.type.v3.Percent - (*wrapperspb.BoolValue)(nil), // 38: google.protobuf.BoolValue - (*BackoffStrategy)(nil), // 39: envoy.config.core.v3.BackoffStrategy - (*wrapperspb.UInt32Value)(nil), // 40: google.protobuf.UInt32Value - (*HttpUri)(nil), // 41: envoy.config.core.v3.HttpUri - (*anypb.Any)(nil), // 42: google.protobuf.Any - (*v3.FractionalPercent)(nil), // 43: envoy.type.v3.FractionalPercent - (*v31.ContextParams)(nil), // 44: xds.core.v3.ContextParams + (*KeyValuePair)(nil), // 15: envoy.config.core.v3.KeyValuePair + (*KeyValueAppend)(nil), // 16: envoy.config.core.v3.KeyValueAppend + (*KeyValueMutation)(nil), // 17: envoy.config.core.v3.KeyValueMutation + (*QueryParameter)(nil), // 18: envoy.config.core.v3.QueryParameter + (*HeaderValue)(nil), // 19: envoy.config.core.v3.HeaderValue + (*HeaderValueOption)(nil), // 20: envoy.config.core.v3.HeaderValueOption + (*HeaderMap)(nil), // 21: envoy.config.core.v3.HeaderMap + (*WatchedDirectory)(nil), // 22: envoy.config.core.v3.WatchedDirectory + (*DataSource)(nil), // 23: envoy.config.core.v3.DataSource + (*RetryPolicy)(nil), // 24: envoy.config.core.v3.RetryPolicy + (*RemoteDataSource)(nil), // 25: envoy.config.core.v3.RemoteDataSource + (*AsyncDataSource)(nil), // 26: envoy.config.core.v3.AsyncDataSource + (*TransportSocket)(nil), // 27: envoy.config.core.v3.TransportSocket + (*RuntimeFractionalPercent)(nil), // 28: envoy.config.core.v3.RuntimeFractionalPercent + (*ControlPlane)(nil), // 29: envoy.config.core.v3.ControlPlane + nil, // 30: envoy.config.core.v3.Node.DynamicParametersEntry + nil, // 31: envoy.config.core.v3.Metadata.FilterMetadataEntry + nil, // 32: envoy.config.core.v3.Metadata.TypedFilterMetadataEntry + (*RetryPolicy_RetryPriority)(nil), // 33: envoy.config.core.v3.RetryPolicy.RetryPriority + (*RetryPolicy_RetryHostPredicate)(nil), // 34: envoy.config.core.v3.RetryPolicy.RetryHostPredicate + (*v3.SemanticVersion)(nil), // 35: envoy.type.v3.SemanticVersion + (*structpb.Struct)(nil), // 36: google.protobuf.Struct + (*Address)(nil), // 37: envoy.config.core.v3.Address + (*v3.Percent)(nil), // 38: envoy.type.v3.Percent + (*wrapperspb.BoolValue)(nil), // 39: google.protobuf.BoolValue + (*structpb.Value)(nil), // 40: google.protobuf.Value + (*BackoffStrategy)(nil), // 41: envoy.config.core.v3.BackoffStrategy + (*wrapperspb.UInt32Value)(nil), // 42: google.protobuf.UInt32Value + (*HttpUri)(nil), // 43: envoy.config.core.v3.HttpUri + (*anypb.Any)(nil), // 44: google.protobuf.Any + (*v3.FractionalPercent)(nil), // 45: envoy.type.v3.FractionalPercent + (*v31.ContextParams)(nil), // 46: xds.core.v3.ContextParams } var file_envoy_config_core_v3_base_proto_depIdxs = []int32{ - 34, // 0: envoy.config.core.v3.BuildVersion.version:type_name -> envoy.type.v3.SemanticVersion - 35, // 1: envoy.config.core.v3.BuildVersion.metadata:type_name -> google.protobuf.Struct + 35, // 0: envoy.config.core.v3.BuildVersion.version:type_name -> envoy.type.v3.SemanticVersion + 36, // 1: envoy.config.core.v3.BuildVersion.metadata:type_name -> google.protobuf.Struct 6, // 2: envoy.config.core.v3.Extension.version:type_name -> envoy.config.core.v3.BuildVersion - 35, // 3: envoy.config.core.v3.Node.metadata:type_name -> google.protobuf.Struct - 29, // 4: envoy.config.core.v3.Node.dynamic_parameters:type_name -> envoy.config.core.v3.Node.DynamicParametersEntry + 36, // 3: envoy.config.core.v3.Node.metadata:type_name -> google.protobuf.Struct + 30, // 4: envoy.config.core.v3.Node.dynamic_parameters:type_name -> envoy.config.core.v3.Node.DynamicParametersEntry 5, // 5: envoy.config.core.v3.Node.locality:type_name -> envoy.config.core.v3.Locality 6, // 6: envoy.config.core.v3.Node.user_agent_build_version:type_name -> envoy.config.core.v3.BuildVersion 7, // 7: envoy.config.core.v3.Node.extensions:type_name -> envoy.config.core.v3.Extension - 36, // 8: envoy.config.core.v3.Node.listening_addresses:type_name -> envoy.config.core.v3.Address - 30, // 9: envoy.config.core.v3.Metadata.filter_metadata:type_name -> envoy.config.core.v3.Metadata.FilterMetadataEntry - 31, // 10: envoy.config.core.v3.Metadata.typed_filter_metadata:type_name -> envoy.config.core.v3.Metadata.TypedFilterMetadataEntry - 37, // 11: envoy.config.core.v3.RuntimePercent.default_value:type_name -> envoy.type.v3.Percent - 38, // 12: envoy.config.core.v3.RuntimeFeatureFlag.default_value:type_name -> google.protobuf.BoolValue - 14, // 13: envoy.config.core.v3.KeyValueAppend.entry:type_name -> envoy.config.core.v3.KeyValue - 3, // 14: envoy.config.core.v3.KeyValueAppend.action:type_name -> envoy.config.core.v3.KeyValueAppend.KeyValueAppendAction - 15, // 15: envoy.config.core.v3.KeyValueMutation.append:type_name -> envoy.config.core.v3.KeyValueAppend - 18, // 16: envoy.config.core.v3.HeaderValueOption.header:type_name -> envoy.config.core.v3.HeaderValue - 38, // 17: envoy.config.core.v3.HeaderValueOption.append:type_name -> google.protobuf.BoolValue - 4, // 18: envoy.config.core.v3.HeaderValueOption.append_action:type_name -> envoy.config.core.v3.HeaderValueOption.HeaderAppendAction - 18, // 19: envoy.config.core.v3.HeaderMap.headers:type_name -> envoy.config.core.v3.HeaderValue - 21, // 20: envoy.config.core.v3.DataSource.watched_directory:type_name -> envoy.config.core.v3.WatchedDirectory - 39, // 21: envoy.config.core.v3.RetryPolicy.retry_back_off:type_name -> envoy.config.core.v3.BackoffStrategy - 40, // 22: envoy.config.core.v3.RetryPolicy.num_retries:type_name -> google.protobuf.UInt32Value - 32, // 23: envoy.config.core.v3.RetryPolicy.retry_priority:type_name -> envoy.config.core.v3.RetryPolicy.RetryPriority - 33, // 24: envoy.config.core.v3.RetryPolicy.retry_host_predicate:type_name -> envoy.config.core.v3.RetryPolicy.RetryHostPredicate - 41, // 25: envoy.config.core.v3.RemoteDataSource.http_uri:type_name -> envoy.config.core.v3.HttpUri - 23, // 26: envoy.config.core.v3.RemoteDataSource.retry_policy:type_name -> envoy.config.core.v3.RetryPolicy - 22, // 27: envoy.config.core.v3.AsyncDataSource.local:type_name -> envoy.config.core.v3.DataSource - 24, // 28: envoy.config.core.v3.AsyncDataSource.remote:type_name -> envoy.config.core.v3.RemoteDataSource - 42, // 29: envoy.config.core.v3.TransportSocket.typed_config:type_name -> google.protobuf.Any - 43, // 30: envoy.config.core.v3.RuntimeFractionalPercent.default_value:type_name -> envoy.type.v3.FractionalPercent - 44, // 31: envoy.config.core.v3.Node.DynamicParametersEntry.value:type_name -> xds.core.v3.ContextParams - 35, // 32: envoy.config.core.v3.Metadata.FilterMetadataEntry.value:type_name -> google.protobuf.Struct - 42, // 33: envoy.config.core.v3.Metadata.TypedFilterMetadataEntry.value:type_name -> google.protobuf.Any - 42, // 34: envoy.config.core.v3.RetryPolicy.RetryPriority.typed_config:type_name -> google.protobuf.Any - 42, // 35: envoy.config.core.v3.RetryPolicy.RetryHostPredicate.typed_config:type_name -> google.protobuf.Any - 36, // [36:36] is the sub-list for method output_type - 36, // [36:36] is the sub-list for method input_type - 36, // [36:36] is the sub-list for extension type_name - 36, // [36:36] is the sub-list for extension extendee - 0, // [0:36] is the sub-list for field type_name + 37, // 8: envoy.config.core.v3.Node.listening_addresses:type_name -> envoy.config.core.v3.Address + 31, // 9: envoy.config.core.v3.Metadata.filter_metadata:type_name -> envoy.config.core.v3.Metadata.FilterMetadataEntry + 32, // 10: envoy.config.core.v3.Metadata.typed_filter_metadata:type_name -> envoy.config.core.v3.Metadata.TypedFilterMetadataEntry + 38, // 11: envoy.config.core.v3.RuntimePercent.default_value:type_name -> envoy.type.v3.Percent + 39, // 12: envoy.config.core.v3.RuntimeFeatureFlag.default_value:type_name -> google.protobuf.BoolValue + 40, // 13: envoy.config.core.v3.KeyValuePair.value:type_name -> google.protobuf.Value + 15, // 14: envoy.config.core.v3.KeyValueAppend.record:type_name -> envoy.config.core.v3.KeyValuePair + 14, // 15: envoy.config.core.v3.KeyValueAppend.entry:type_name -> envoy.config.core.v3.KeyValue + 3, // 16: envoy.config.core.v3.KeyValueAppend.action:type_name -> envoy.config.core.v3.KeyValueAppend.KeyValueAppendAction + 16, // 17: envoy.config.core.v3.KeyValueMutation.append:type_name -> envoy.config.core.v3.KeyValueAppend + 19, // 18: envoy.config.core.v3.HeaderValueOption.header:type_name -> envoy.config.core.v3.HeaderValue + 39, // 19: envoy.config.core.v3.HeaderValueOption.append:type_name -> google.protobuf.BoolValue + 4, // 20: envoy.config.core.v3.HeaderValueOption.append_action:type_name -> envoy.config.core.v3.HeaderValueOption.HeaderAppendAction + 19, // 21: envoy.config.core.v3.HeaderMap.headers:type_name -> envoy.config.core.v3.HeaderValue + 22, // 22: envoy.config.core.v3.DataSource.watched_directory:type_name -> envoy.config.core.v3.WatchedDirectory + 41, // 23: envoy.config.core.v3.RetryPolicy.retry_back_off:type_name -> envoy.config.core.v3.BackoffStrategy + 42, // 24: envoy.config.core.v3.RetryPolicy.num_retries:type_name -> google.protobuf.UInt32Value + 33, // 25: envoy.config.core.v3.RetryPolicy.retry_priority:type_name -> envoy.config.core.v3.RetryPolicy.RetryPriority + 34, // 26: envoy.config.core.v3.RetryPolicy.retry_host_predicate:type_name -> envoy.config.core.v3.RetryPolicy.RetryHostPredicate + 43, // 27: envoy.config.core.v3.RemoteDataSource.http_uri:type_name -> envoy.config.core.v3.HttpUri + 24, // 28: envoy.config.core.v3.RemoteDataSource.retry_policy:type_name -> envoy.config.core.v3.RetryPolicy + 23, // 29: envoy.config.core.v3.AsyncDataSource.local:type_name -> envoy.config.core.v3.DataSource + 25, // 30: envoy.config.core.v3.AsyncDataSource.remote:type_name -> envoy.config.core.v3.RemoteDataSource + 44, // 31: envoy.config.core.v3.TransportSocket.typed_config:type_name -> google.protobuf.Any + 45, // 32: envoy.config.core.v3.RuntimeFractionalPercent.default_value:type_name -> envoy.type.v3.FractionalPercent + 46, // 33: envoy.config.core.v3.Node.DynamicParametersEntry.value:type_name -> xds.core.v3.ContextParams + 36, // 34: envoy.config.core.v3.Metadata.FilterMetadataEntry.value:type_name -> google.protobuf.Struct + 44, // 35: envoy.config.core.v3.Metadata.TypedFilterMetadataEntry.value:type_name -> google.protobuf.Any + 44, // 36: envoy.config.core.v3.RetryPolicy.RetryPriority.typed_config:type_name -> google.protobuf.Any + 44, // 37: envoy.config.core.v3.RetryPolicy.RetryHostPredicate.typed_config:type_name -> google.protobuf.Any + 38, // [38:38] is the sub-list for method output_type + 38, // [38:38] is the sub-list for method input_type + 38, // [38:38] is the sub-list for extension type_name + 38, // [38:38] is the sub-list for extension extendee + 0, // [0:38] is the sub-list for field type_name } func init() { file_envoy_config_core_v3_base_proto_init() } @@ -3005,7 +3108,7 @@ func file_envoy_config_core_v3_base_proto_init() { } } file_envoy_config_core_v3_base_proto_msgTypes[10].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*KeyValueAppend); i { + switch v := v.(*KeyValuePair); i { case 0: return &v.state case 1: @@ -3017,7 +3120,7 @@ func file_envoy_config_core_v3_base_proto_init() { } } file_envoy_config_core_v3_base_proto_msgTypes[11].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*KeyValueMutation); i { + switch v := v.(*KeyValueAppend); i { case 0: return &v.state case 1: @@ -3029,7 +3132,7 @@ func file_envoy_config_core_v3_base_proto_init() { } } file_envoy_config_core_v3_base_proto_msgTypes[12].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*QueryParameter); i { + switch v := v.(*KeyValueMutation); i { case 0: return &v.state case 1: @@ -3041,7 +3144,7 @@ func file_envoy_config_core_v3_base_proto_init() { } } file_envoy_config_core_v3_base_proto_msgTypes[13].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*HeaderValue); i { + switch v := v.(*QueryParameter); i { case 0: return &v.state case 1: @@ -3053,7 +3156,7 @@ func file_envoy_config_core_v3_base_proto_init() { } } file_envoy_config_core_v3_base_proto_msgTypes[14].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*HeaderValueOption); i { + switch v := v.(*HeaderValue); i { case 0: return &v.state case 1: @@ -3065,7 +3168,7 @@ func file_envoy_config_core_v3_base_proto_init() { } } file_envoy_config_core_v3_base_proto_msgTypes[15].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*HeaderMap); i { + switch v := v.(*HeaderValueOption); i { case 0: return &v.state case 1: @@ -3077,7 +3180,7 @@ func file_envoy_config_core_v3_base_proto_init() { } } file_envoy_config_core_v3_base_proto_msgTypes[16].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*WatchedDirectory); i { + switch v := v.(*HeaderMap); i { case 0: return &v.state case 1: @@ -3089,7 +3192,7 @@ func file_envoy_config_core_v3_base_proto_init() { } } file_envoy_config_core_v3_base_proto_msgTypes[17].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*DataSource); i { + switch v := v.(*WatchedDirectory); i { case 0: return &v.state case 1: @@ -3101,7 +3204,7 @@ func file_envoy_config_core_v3_base_proto_init() { } } file_envoy_config_core_v3_base_proto_msgTypes[18].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*RetryPolicy); i { + switch v := v.(*DataSource); i { case 0: return &v.state case 1: @@ -3113,7 +3216,7 @@ func file_envoy_config_core_v3_base_proto_init() { } } file_envoy_config_core_v3_base_proto_msgTypes[19].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*RemoteDataSource); i { + switch v := v.(*RetryPolicy); i { case 0: return &v.state case 1: @@ -3125,7 +3228,7 @@ func file_envoy_config_core_v3_base_proto_init() { } } file_envoy_config_core_v3_base_proto_msgTypes[20].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*AsyncDataSource); i { + switch v := v.(*RemoteDataSource); i { case 0: return &v.state case 1: @@ -3137,7 +3240,7 @@ func file_envoy_config_core_v3_base_proto_init() { } } file_envoy_config_core_v3_base_proto_msgTypes[21].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*TransportSocket); i { + switch v := v.(*AsyncDataSource); i { case 0: return &v.state case 1: @@ -3149,7 +3252,7 @@ func file_envoy_config_core_v3_base_proto_init() { } } file_envoy_config_core_v3_base_proto_msgTypes[22].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*RuntimeFractionalPercent); i { + switch v := v.(*TransportSocket); i { case 0: return &v.state case 1: @@ -3161,6 +3264,18 @@ func file_envoy_config_core_v3_base_proto_init() { } } file_envoy_config_core_v3_base_proto_msgTypes[23].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*RuntimeFractionalPercent); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_envoy_config_core_v3_base_proto_msgTypes[24].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*ControlPlane); i { case 0: return &v.state @@ -3172,7 +3287,7 @@ func file_envoy_config_core_v3_base_proto_init() { return nil } } - file_envoy_config_core_v3_base_proto_msgTypes[27].Exporter = func(v interface{}, i int) interface{} { + file_envoy_config_core_v3_base_proto_msgTypes[28].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*RetryPolicy_RetryPriority); i { case 0: return &v.state @@ -3184,7 +3299,7 @@ func file_envoy_config_core_v3_base_proto_init() { return nil } } - file_envoy_config_core_v3_base_proto_msgTypes[28].Exporter = func(v interface{}, i int) interface{} { + file_envoy_config_core_v3_base_proto_msgTypes[29].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*RetryPolicy_RetryHostPredicate); i { case 0: return &v.state @@ -3201,23 +3316,23 @@ func file_envoy_config_core_v3_base_proto_init() { (*Node_UserAgentVersion)(nil), (*Node_UserAgentBuildVersion)(nil), } - file_envoy_config_core_v3_base_proto_msgTypes[17].OneofWrappers = []interface{}{ + file_envoy_config_core_v3_base_proto_msgTypes[18].OneofWrappers = []interface{}{ (*DataSource_Filename)(nil), (*DataSource_InlineBytes)(nil), (*DataSource_InlineString)(nil), (*DataSource_EnvironmentVariable)(nil), } - file_envoy_config_core_v3_base_proto_msgTypes[20].OneofWrappers = []interface{}{ + file_envoy_config_core_v3_base_proto_msgTypes[21].OneofWrappers = []interface{}{ (*AsyncDataSource_Local)(nil), (*AsyncDataSource_Remote)(nil), } - file_envoy_config_core_v3_base_proto_msgTypes[21].OneofWrappers = []interface{}{ + file_envoy_config_core_v3_base_proto_msgTypes[22].OneofWrappers = []interface{}{ (*TransportSocket_TypedConfig)(nil), } - file_envoy_config_core_v3_base_proto_msgTypes[27].OneofWrappers = []interface{}{ + file_envoy_config_core_v3_base_proto_msgTypes[28].OneofWrappers = []interface{}{ (*RetryPolicy_RetryPriority_TypedConfig)(nil), } - file_envoy_config_core_v3_base_proto_msgTypes[28].OneofWrappers = []interface{}{ + file_envoy_config_core_v3_base_proto_msgTypes[29].OneofWrappers = []interface{}{ (*RetryPolicy_RetryHostPredicate_TypedConfig)(nil), } type x struct{} @@ -3226,7 +3341,7 @@ func file_envoy_config_core_v3_base_proto_init() { GoPackagePath: reflect.TypeOf(x{}).PkgPath(), RawDescriptor: file_envoy_config_core_v3_base_proto_rawDesc, NumEnums: 5, - NumMessages: 29, + NumMessages: 30, NumExtensions: 0, NumServices: 0, }, diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/base.pb.validate.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/base.pb.validate.go index 09d836dac4186..a346981f42bf7 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/base.pb.validate.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/base.pb.validate.go @@ -1619,32 +1619,43 @@ var _ interface { ErrorName() string } = KeyValueValidationError{} -// Validate checks the field values on KeyValueAppend with the rules defined in +// Validate checks the field values on KeyValuePair with the rules defined in // the proto definition for this message. If any rules are violated, the first // error encountered is returned, or nil if there are no violations. -func (m *KeyValueAppend) Validate() error { +func (m *KeyValuePair) Validate() error { return m.validate(false) } -// ValidateAll checks the field values on KeyValueAppend with the rules defined +// ValidateAll checks the field values on KeyValuePair with the rules defined // in the proto definition for this message. If any rules are violated, the -// result is a list of violation errors wrapped in KeyValueAppendMultiError, -// or nil if none found. -func (m *KeyValueAppend) ValidateAll() error { +// result is a list of violation errors wrapped in KeyValuePairMultiError, or +// nil if none found. +func (m *KeyValuePair) ValidateAll() error { return m.validate(true) } -func (m *KeyValueAppend) validate(all bool) error { +func (m *KeyValuePair) validate(all bool) error { if m == nil { return nil } var errors []error - if m.GetEntry() == nil { - err := KeyValueAppendValidationError{ - field: "Entry", - reason: "value is required", + if utf8.RuneCountInString(m.GetKey()) < 1 { + err := KeyValuePairValidationError{ + field: "Key", + reason: "value length must be at least 1 runes", + } + if !all { + return err + } + errors = append(errors, err) + } + + if len(m.GetKey()) > 16384 { + err := KeyValuePairValidationError{ + field: "Key", + reason: "value length must be at most 16384 bytes", } if !all { return err @@ -1653,11 +1664,139 @@ func (m *KeyValueAppend) validate(all bool) error { } if all { - switch v := interface{}(m.GetEntry()).(type) { + switch v := interface{}(m.GetValue()).(type) { + case interface{ ValidateAll() error }: + if err := v.ValidateAll(); err != nil { + errors = append(errors, KeyValuePairValidationError{ + field: "Value", + reason: "embedded message failed validation", + cause: err, + }) + } + case interface{ Validate() error }: + if err := v.Validate(); err != nil { + errors = append(errors, KeyValuePairValidationError{ + field: "Value", + reason: "embedded message failed validation", + cause: err, + }) + } + } + } else if v, ok := interface{}(m.GetValue()).(interface{ Validate() error }); ok { + if err := v.Validate(); err != nil { + return KeyValuePairValidationError{ + field: "Value", + reason: "embedded message failed validation", + cause: err, + } + } + } + + if len(errors) > 0 { + return KeyValuePairMultiError(errors) + } + + return nil +} + +// KeyValuePairMultiError is an error wrapping multiple validation errors +// returned by KeyValuePair.ValidateAll() if the designated constraints aren't met. +type KeyValuePairMultiError []error + +// Error returns a concatenation of all the error messages it wraps. +func (m KeyValuePairMultiError) Error() string { + var msgs []string + for _, err := range m { + msgs = append(msgs, err.Error()) + } + return strings.Join(msgs, "; ") +} + +// AllErrors returns a list of validation violation errors. +func (m KeyValuePairMultiError) AllErrors() []error { return m } + +// KeyValuePairValidationError is the validation error returned by +// KeyValuePair.Validate if the designated constraints aren't met. +type KeyValuePairValidationError struct { + field string + reason string + cause error + key bool +} + +// Field function returns field value. +func (e KeyValuePairValidationError) Field() string { return e.field } + +// Reason function returns reason value. +func (e KeyValuePairValidationError) Reason() string { return e.reason } + +// Cause function returns cause value. +func (e KeyValuePairValidationError) Cause() error { return e.cause } + +// Key function returns key value. +func (e KeyValuePairValidationError) Key() bool { return e.key } + +// ErrorName returns error name. +func (e KeyValuePairValidationError) ErrorName() string { return "KeyValuePairValidationError" } + +// Error satisfies the builtin error interface +func (e KeyValuePairValidationError) Error() string { + cause := "" + if e.cause != nil { + cause = fmt.Sprintf(" | caused by: %v", e.cause) + } + + key := "" + if e.key { + key = "key for " + } + + return fmt.Sprintf( + "invalid %sKeyValuePair.%s: %s%s", + key, + e.field, + e.reason, + cause) +} + +var _ error = KeyValuePairValidationError{} + +var _ interface { + Field() string + Reason() string + Key() bool + Cause() error + ErrorName() string +} = KeyValuePairValidationError{} + +// Validate checks the field values on KeyValueAppend with the rules defined in +// the proto definition for this message. If any rules are violated, the first +// error encountered is returned, or nil if there are no violations. +func (m *KeyValueAppend) Validate() error { + return m.validate(false) +} + +// ValidateAll checks the field values on KeyValueAppend with the rules defined +// in the proto definition for this message. If any rules are violated, the +// result is a list of violation errors wrapped in KeyValueAppendMultiError, +// or nil if none found. +func (m *KeyValueAppend) ValidateAll() error { + return m.validate(true) +} + +func (m *KeyValueAppend) validate(all bool) error { + if m == nil { + return nil + } + + var errors []error + + if all { + switch v := interface{}(m.GetRecord()).(type) { case interface{ ValidateAll() error }: if err := v.ValidateAll(); err != nil { errors = append(errors, KeyValueAppendValidationError{ - field: "Entry", + field: "Record", reason: "embedded message failed validation", cause: err, }) @@ -1665,22 +1804,24 @@ func (m *KeyValueAppend) validate(all bool) error { case interface{ Validate() error }: if err := v.Validate(); err != nil { errors = append(errors, KeyValueAppendValidationError{ - field: "Entry", + field: "Record", reason: "embedded message failed validation", cause: err, }) } } - } else if v, ok := interface{}(m.GetEntry()).(interface{ Validate() error }); ok { + } else if v, ok := interface{}(m.GetRecord()).(interface{ Validate() error }); ok { if err := v.Validate(); err != nil { return KeyValueAppendValidationError{ - field: "Entry", + field: "Record", reason: "embedded message failed validation", cause: err, } } } + // skipping validation for entry + if _, ok := KeyValueAppend_KeyValueAppendAction_name[int32(m.GetAction())]; !ok { err := KeyValueAppendValidationError{ field: "Action", diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/base_vtproto.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/base_vtproto.pb.go index fa4823023f7b3..0a2d2bcca4bf0 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/base_vtproto.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/base_vtproto.pb.go @@ -745,6 +745,56 @@ func (m *KeyValue) MarshalToSizedBufferVTStrict(dAtA []byte) (int, error) { return len(dAtA) - i, nil } +func (m *KeyValuePair) MarshalVTStrict() (dAtA []byte, err error) { + if m == nil { + return nil, nil + } + size := m.SizeVT() + dAtA = make([]byte, size) + n, err := m.MarshalToSizedBufferVTStrict(dAtA[:size]) + if err != nil { + return nil, err + } + return dAtA[:n], nil +} + +func (m *KeyValuePair) MarshalToVTStrict(dAtA []byte) (int, error) { + size := m.SizeVT() + return m.MarshalToSizedBufferVTStrict(dAtA[:size]) +} + +func (m *KeyValuePair) MarshalToSizedBufferVTStrict(dAtA []byte) (int, error) { + if m == nil { + return 0, nil + } + i := len(dAtA) + _ = i + var l int + _ = l + if m.unknownFields != nil { + i -= len(m.unknownFields) + copy(dAtA[i:], m.unknownFields) + } + if m.Value != nil { + size, err := (*structpb.Value)(m.Value).MarshalToSizedBufferVTStrict(dAtA[:i]) + if err != nil { + return 0, err + } + i -= size + i = protohelpers.EncodeVarint(dAtA, i, uint64(size)) + i-- + dAtA[i] = 0x12 + } + if len(m.Key) > 0 { + i -= len(m.Key) + copy(dAtA[i:], m.Key) + i = protohelpers.EncodeVarint(dAtA, i, uint64(len(m.Key))) + i-- + dAtA[i] = 0xa + } + return len(dAtA) - i, nil +} + func (m *KeyValueAppend) MarshalVTStrict() (dAtA []byte, err error) { if m == nil { return nil, nil @@ -775,6 +825,16 @@ func (m *KeyValueAppend) MarshalToSizedBufferVTStrict(dAtA []byte) (int, error) i -= len(m.unknownFields) copy(dAtA[i:], m.unknownFields) } + if m.Record != nil { + size, err := m.Record.MarshalToSizedBufferVTStrict(dAtA[:i]) + if err != nil { + return 0, err + } + i -= size + i = protohelpers.EncodeVarint(dAtA, i, uint64(size)) + i-- + dAtA[i] = 0x1a + } if m.Action != 0 { i = protohelpers.EncodeVarint(dAtA, i, uint64(m.Action)) i-- @@ -2081,6 +2141,24 @@ func (m *KeyValue) SizeVT() (n int) { return n } +func (m *KeyValuePair) SizeVT() (n int) { + if m == nil { + return 0 + } + var l int + _ = l + l = len(m.Key) + if l > 0 { + n += 1 + l + protohelpers.SizeOfVarint(uint64(l)) + } + if m.Value != nil { + l = (*structpb.Value)(m.Value).SizeVT() + n += 1 + l + protohelpers.SizeOfVarint(uint64(l)) + } + n += len(m.unknownFields) + return n +} + func (m *KeyValueAppend) SizeVT() (n int) { if m == nil { return 0 @@ -2094,6 +2172,10 @@ func (m *KeyValueAppend) SizeVT() (n int) { if m.Action != 0 { n += 1 + protohelpers.SizeOfVarint(uint64(m.Action)) } + if m.Record != nil { + l = m.Record.SizeVT() + n += 1 + l + protohelpers.SizeOfVarint(uint64(l)) + } n += len(m.unknownFields) return n } diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/config_source.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/config_source.pb.go index 295398b9f19a1..8d3136e2e5edb 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/config_source.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/config_source.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/core/v3/config_source.proto package corev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/event_service_config.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/event_service_config.pb.go index 8d995326c19b2..b56d50854b992 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/event_service_config.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/event_service_config.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/core/v3/event_service_config.proto package corev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/extension.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/extension.pb.go index 81ec41a6e77a6..11d845fb1993a 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/extension.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/extension.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/core/v3/extension.proto package corev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/grpc_method_list.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/grpc_method_list.pb.go index 199ac40f04561..c723600f1ea4f 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/grpc_method_list.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/grpc_method_list.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/core/v3/grpc_method_list.proto package corev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/grpc_service.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/grpc_service.pb.go index 3967277f61ca4..de6578f7febd1 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/grpc_service.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/grpc_service.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/core/v3/grpc_service.proto package corev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/health_check.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/health_check.pb.go index 96ac5fc632cac..03be5fa1c10f2 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/health_check.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/health_check.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/core/v3/health_check.proto package corev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/http_service.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/http_service.pb.go index ec8d54bb74100..0c0bf0957cdc1 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/http_service.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/http_service.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/core/v3/http_service.proto package corev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/http_uri.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/http_uri.pb.go index c1ba4357f523e..544fe0fa3ef08 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/http_uri.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/http_uri.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/core/v3/http_uri.proto package corev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/protocol.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/protocol.pb.go index 87af0321f9527..25ff9142fe206 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/protocol.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/protocol.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/core/v3/protocol.proto package corev3 @@ -146,7 +146,7 @@ type QuicKeepAliveSettings struct { // // The value should be smaller than :ref:`connection idle_timeout ` to prevent idle timeout and smaller than max_interval to take effect. // - // If absent or zero, disable keepalive probing for a server connection. For a client connection, if :ref:`max_interval ` is also zero, do not keepalive, otherwise use max_interval or QUICHE default to probe all the time. + // If absent, disable keepalive probing for a server connection. For a client connection, if :ref:`max_interval ` is zero, do not keepalive, otherwise use max_interval or QUICHE default to probe all the time. InitialInterval *durationpb.Duration `protobuf:"bytes,2,opt,name=initial_interval,json=initialInterval,proto3" json:"initial_interval,omitempty"` } @@ -353,12 +353,18 @@ type UpstreamHttpProtocolOptions struct { // header when :ref:`override_auto_sni_header ` // is set, as seen by the :ref:`router filter `. // Does nothing if a filter before the http router filter sets the corresponding metadata. + // + // See :ref:`SNI configuration ` for details on how this + // interacts with other validation options. AutoSni bool `protobuf:"varint,1,opt,name=auto_sni,json=autoSni,proto3" json:"auto_sni,omitempty"` // Automatic validate upstream presented certificate for new upstream connections based on the // downstream HTTP host/authority header or any other arbitrary header when :ref:`override_auto_sni_header ` // is set, as seen by the :ref:`router filter `. // This field is intended to be set with “auto_sni“ field. // Does nothing if a filter before the http router filter sets the corresponding metadata. + // + // See :ref:`validation configuration ` for how this interacts with + // other validation options. AutoSanValidation bool `protobuf:"varint,2,opt,name=auto_san_validation,json=autoSanValidation,proto3" json:"auto_san_validation,omitempty"` // An optional alternative to the host/authority header to be used for setting the SNI value. // It should be a valid downstream HTTP header, as seen by the @@ -1756,428 +1762,427 @@ var file_envoy_config_core_v3_protocol_proto_rawDesc = []byte{ 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x3a, 0x2b, 0x9a, 0xc5, 0x88, 0x1e, 0x26, 0x0a, 0x24, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x54, 0x63, 0x70, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x73, 0x22, 0xb7, 0x01, 0x0a, 0x15, 0x51, 0x75, 0x69, 0x63, 0x4b, 0x65, 0x65, 0x70, 0x41, - 0x6c, 0x69, 0x76, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x4a, 0x0a, 0x0c, + 0x6e, 0x73, 0x22, 0xab, 0x01, 0x0a, 0x15, 0x51, 0x75, 0x69, 0x63, 0x4b, 0x65, 0x65, 0x70, 0x41, + 0x6c, 0x69, 0x76, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3c, 0x0a, 0x0c, 0x6d, 0x61, 0x78, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x0c, 0xfa, - 0x42, 0x09, 0xaa, 0x01, 0x06, 0x22, 0x00, 0x32, 0x02, 0x08, 0x01, 0x52, 0x0b, 0x6d, 0x61, 0x78, - 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x12, 0x52, 0x0a, 0x10, 0x69, 0x6e, 0x69, 0x74, - 0x69, 0x61, 0x6c, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x0c, 0xfa, - 0x42, 0x09, 0xaa, 0x01, 0x06, 0x22, 0x00, 0x32, 0x02, 0x08, 0x01, 0x52, 0x0f, 0x69, 0x6e, 0x69, - 0x74, 0x69, 0x61, 0x6c, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x22, 0xbb, 0x06, 0x0a, - 0x13, 0x51, 0x75, 0x69, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x5b, 0x0a, 0x16, 0x6d, 0x61, 0x78, 0x5f, 0x63, 0x6f, 0x6e, 0x63, - 0x75, 0x72, 0x72, 0x65, 0x6e, 0x74, 0x5f, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x73, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, - 0x75, 0x65, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x2a, 0x02, 0x28, 0x01, 0x52, 0x14, 0x6d, 0x61, 0x78, - 0x43, 0x6f, 0x6e, 0x63, 0x75, 0x72, 0x72, 0x65, 0x6e, 0x74, 0x53, 0x74, 0x72, 0x65, 0x61, 0x6d, - 0x73, 0x12, 0x67, 0x0a, 0x1a, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x5f, 0x73, 0x74, 0x72, - 0x65, 0x61, 0x6d, 0x5f, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, - 0x6c, 0x75, 0x65, 0x42, 0x0c, 0xfa, 0x42, 0x09, 0x2a, 0x07, 0x18, 0x80, 0x80, 0x80, 0x08, 0x28, - 0x01, 0x52, 0x17, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x53, 0x74, 0x72, 0x65, 0x61, 0x6d, - 0x57, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x6f, 0x0a, 0x1e, 0x69, 0x6e, - 0x69, 0x74, 0x69, 0x61, 0x6c, 0x5f, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, - 0x5f, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x03, 0x20, 0x01, + 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0b, 0x6d, + 0x61, 0x78, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x12, 0x54, 0x0a, 0x10, 0x69, 0x6e, + 0x69, 0x74, 0x69, 0x61, 0x6c, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x18, 0x02, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, + 0x0e, 0xfa, 0x42, 0x0b, 0xaa, 0x01, 0x08, 0x22, 0x00, 0x32, 0x04, 0x10, 0xc0, 0x84, 0x3d, 0x52, + 0x0f, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, + 0x22, 0xbb, 0x06, 0x0a, 0x13, 0x51, 0x75, 0x69, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, + 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x5b, 0x0a, 0x16, 0x6d, 0x61, 0x78, 0x5f, + 0x63, 0x6f, 0x6e, 0x63, 0x75, 0x72, 0x72, 0x65, 0x6e, 0x74, 0x5f, 0x73, 0x74, 0x72, 0x65, 0x61, + 0x6d, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, + 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x2a, 0x02, 0x28, 0x01, 0x52, + 0x14, 0x6d, 0x61, 0x78, 0x43, 0x6f, 0x6e, 0x63, 0x75, 0x72, 0x72, 0x65, 0x6e, 0x74, 0x53, 0x74, + 0x72, 0x65, 0x61, 0x6d, 0x73, 0x12, 0x67, 0x0a, 0x1a, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, + 0x5f, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x5f, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x5f, 0x73, + 0x69, 0x7a, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, + 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x0c, 0xfa, 0x42, 0x09, 0x2a, 0x07, 0x18, 0x80, + 0x80, 0x80, 0x08, 0x28, 0x01, 0x52, 0x17, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x53, 0x74, + 0x72, 0x65, 0x61, 0x6d, 0x57, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x6f, + 0x0a, 0x1e, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x5f, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, + 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x5f, 0x73, 0x69, 0x7a, 0x65, + 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, + 0x61, 0x6c, 0x75, 0x65, 0x42, 0x0c, 0xfa, 0x42, 0x09, 0x2a, 0x07, 0x18, 0x80, 0x80, 0x80, 0x0c, + 0x28, 0x01, 0x52, 0x1b, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x43, 0x6f, 0x6e, 0x6e, 0x65, + 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x57, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x53, 0x69, 0x7a, 0x65, 0x12, + 0x7a, 0x0a, 0x26, 0x6e, 0x75, 0x6d, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x73, 0x5f, + 0x74, 0x6f, 0x5f, 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x5f, 0x70, 0x6f, 0x72, 0x74, 0x5f, + 0x6d, 0x69, 0x67, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x09, 0xfa, + 0x42, 0x06, 0x2a, 0x04, 0x18, 0x05, 0x28, 0x00, 0x52, 0x21, 0x6e, 0x75, 0x6d, 0x54, 0x69, 0x6d, + 0x65, 0x6f, 0x75, 0x74, 0x73, 0x54, 0x6f, 0x54, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x50, 0x6f, + 0x72, 0x74, 0x4d, 0x69, 0x67, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x5e, 0x0a, 0x14, 0x63, + 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6b, 0x65, 0x65, 0x70, 0x61, 0x6c, + 0x69, 0x76, 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2b, 0x2e, 0x65, 0x6e, 0x76, 0x6f, + 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, + 0x2e, 0x51, 0x75, 0x69, 0x63, 0x4b, 0x65, 0x65, 0x70, 0x41, 0x6c, 0x69, 0x76, 0x65, 0x53, 0x65, + 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x13, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, + 0x6f, 0x6e, 0x4b, 0x65, 0x65, 0x70, 0x61, 0x6c, 0x69, 0x76, 0x65, 0x12, 0x2d, 0x0a, 0x12, 0x63, + 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, + 0x73, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x52, 0x11, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, + 0x69, 0x6f, 0x6e, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x3a, 0x0a, 0x19, 0x63, 0x6c, + 0x69, 0x65, 0x6e, 0x74, 0x5f, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x5f, + 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x07, 0x20, 0x01, 0x28, 0x09, 0x52, 0x17, 0x63, + 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x4f, + 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x5c, 0x0a, 0x14, 0x69, 0x64, 0x6c, 0x65, 0x5f, 0x6e, + 0x65, 0x74, 0x77, 0x6f, 0x72, 0x6b, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x18, 0x08, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, + 0x0f, 0xfa, 0x42, 0x0c, 0xaa, 0x01, 0x09, 0x22, 0x03, 0x08, 0xd8, 0x04, 0x32, 0x02, 0x08, 0x01, + 0x52, 0x12, 0x69, 0x64, 0x6c, 0x65, 0x4e, 0x65, 0x74, 0x77, 0x6f, 0x72, 0x6b, 0x54, 0x69, 0x6d, + 0x65, 0x6f, 0x75, 0x74, 0x12, 0x48, 0x0a, 0x11, 0x6d, 0x61, 0x78, 0x5f, 0x70, 0x61, 0x63, 0x6b, + 0x65, 0x74, 0x5f, 0x6c, 0x65, 0x6e, 0x67, 0x74, 0x68, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x36, 0x34, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x0f, 0x6d, + 0x61, 0x78, 0x50, 0x61, 0x63, 0x6b, 0x65, 0x74, 0x4c, 0x65, 0x6e, 0x67, 0x74, 0x68, 0x22, 0xe4, + 0x01, 0x0a, 0x1b, 0x55, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x48, 0x74, 0x74, 0x70, 0x50, + 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x19, + 0x0a, 0x08, 0x61, 0x75, 0x74, 0x6f, 0x5f, 0x73, 0x6e, 0x69, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, + 0x52, 0x07, 0x61, 0x75, 0x74, 0x6f, 0x53, 0x6e, 0x69, 0x12, 0x2e, 0x0a, 0x13, 0x61, 0x75, 0x74, + 0x6f, 0x5f, 0x73, 0x61, 0x6e, 0x5f, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x11, 0x61, 0x75, 0x74, 0x6f, 0x53, 0x61, 0x6e, 0x56, + 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x44, 0x0a, 0x18, 0x6f, 0x76, 0x65, + 0x72, 0x72, 0x69, 0x64, 0x65, 0x5f, 0x61, 0x75, 0x74, 0x6f, 0x5f, 0x73, 0x6e, 0x69, 0x5f, 0x68, + 0x65, 0x61, 0x64, 0x65, 0x72, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x0b, 0xfa, 0x42, 0x08, + 0x72, 0x06, 0xd0, 0x01, 0x01, 0xc0, 0x01, 0x01, 0x52, 0x15, 0x6f, 0x76, 0x65, 0x72, 0x72, 0x69, + 0x64, 0x65, 0x41, 0x75, 0x74, 0x6f, 0x53, 0x6e, 0x69, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x3a, + 0x34, 0x9a, 0xc5, 0x88, 0x1e, 0x2f, 0x0a, 0x2d, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, + 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x55, 0x70, 0x73, 0x74, 0x72, 0x65, + 0x61, 0x6d, 0x48, 0x74, 0x74, 0x70, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, + 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x22, 0x86, 0x04, 0x0a, 0x1e, 0x41, 0x6c, 0x74, 0x65, 0x72, 0x6e, + 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x73, 0x43, 0x61, 0x63, 0x68, + 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x1b, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, + 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x46, 0x0a, 0x0b, 0x6d, 0x61, 0x78, 0x5f, 0x65, 0x6e, 0x74, + 0x72, 0x69, 0x65, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, + 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x2a, 0x02, 0x20, + 0x00, 0x52, 0x0a, 0x6d, 0x61, 0x78, 0x45, 0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, 0x12, 0x5f, 0x0a, + 0x16, 0x6b, 0x65, 0x79, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x5f, 0x73, 0x74, 0x6f, 0x72, 0x65, + 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, + 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, + 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x79, 0x70, 0x65, 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, + 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x13, 0x6b, 0x65, 0x79, 0x56, 0x61, + 0x6c, 0x75, 0x65, 0x53, 0x74, 0x6f, 0x72, 0x65, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x84, + 0x01, 0x0a, 0x14, 0x70, 0x72, 0x65, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x74, 0x65, 0x64, 0x5f, + 0x65, 0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x51, 0x2e, + 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, + 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x41, 0x6c, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x65, 0x50, 0x72, + 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x73, 0x43, 0x61, 0x63, 0x68, 0x65, 0x4f, 0x70, 0x74, 0x69, + 0x6f, 0x6e, 0x73, 0x2e, 0x41, 0x6c, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, + 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x73, 0x43, 0x61, 0x63, 0x68, 0x65, 0x45, 0x6e, 0x74, 0x72, 0x79, + 0x52, 0x13, 0x70, 0x72, 0x65, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x74, 0x65, 0x64, 0x45, 0x6e, + 0x74, 0x72, 0x69, 0x65, 0x73, 0x12, 0x2d, 0x0a, 0x12, 0x63, 0x61, 0x6e, 0x6f, 0x6e, 0x69, 0x63, + 0x61, 0x6c, 0x5f, 0x73, 0x75, 0x66, 0x66, 0x69, 0x78, 0x65, 0x73, 0x18, 0x05, 0x20, 0x03, 0x28, + 0x09, 0x52, 0x11, 0x63, 0x61, 0x6e, 0x6f, 0x6e, 0x69, 0x63, 0x61, 0x6c, 0x53, 0x75, 0x66, 0x66, + 0x69, 0x78, 0x65, 0x73, 0x1a, 0x68, 0x0a, 0x1c, 0x41, 0x6c, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, + 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x73, 0x43, 0x61, 0x63, 0x68, 0x65, 0x45, + 0x6e, 0x74, 0x72, 0x79, 0x12, 0x27, 0x0a, 0x08, 0x68, 0x6f, 0x73, 0x74, 0x6e, 0x61, 0x6d, 0x65, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x0b, 0xfa, 0x42, 0x08, 0x72, 0x06, 0xd0, 0x01, 0x01, + 0xc0, 0x01, 0x01, 0x52, 0x08, 0x68, 0x6f, 0x73, 0x74, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x1f, 0x0a, + 0x04, 0x70, 0x6f, 0x72, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0d, 0x42, 0x0b, 0xfa, 0x42, 0x08, + 0x2a, 0x06, 0x10, 0xff, 0xff, 0x03, 0x20, 0x00, 0x52, 0x04, 0x70, 0x6f, 0x72, 0x74, 0x22, 0x90, + 0x06, 0x0a, 0x13, 0x48, 0x74, 0x74, 0x70, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, + 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x3c, 0x0a, 0x0c, 0x69, 0x64, 0x6c, 0x65, 0x5f, 0x74, + 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, + 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0b, 0x69, 0x64, 0x6c, 0x65, 0x54, 0x69, 0x6d, + 0x65, 0x6f, 0x75, 0x74, 0x12, 0x51, 0x0a, 0x17, 0x6d, 0x61, 0x78, 0x5f, 0x63, 0x6f, 0x6e, 0x6e, + 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, + 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, + 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x52, 0x15, 0x6d, 0x61, 0x78, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x44, + 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x51, 0x0a, 0x11, 0x6d, 0x61, 0x78, 0x5f, 0x68, + 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, - 0x42, 0x0c, 0xfa, 0x42, 0x09, 0x2a, 0x07, 0x18, 0x80, 0x80, 0x80, 0x0c, 0x28, 0x01, 0x52, 0x1b, - 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, - 0x6e, 0x57, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x7a, 0x0a, 0x26, 0x6e, - 0x75, 0x6d, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x73, 0x5f, 0x74, 0x6f, 0x5f, 0x74, - 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x5f, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x6d, 0x69, 0x67, 0x72, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, + 0x42, 0x07, 0xfa, 0x42, 0x04, 0x2a, 0x02, 0x28, 0x01, 0x52, 0x0f, 0x6d, 0x61, 0x78, 0x48, 0x65, + 0x61, 0x64, 0x65, 0x72, 0x73, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x12, 0x5f, 0x0a, 0x17, 0x6d, 0x61, + 0x78, 0x5f, 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, + 0x72, 0x73, 0x5f, 0x6b, 0x62, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, - 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x09, 0xfa, 0x42, 0x06, 0x2a, 0x04, - 0x18, 0x05, 0x28, 0x00, 0x52, 0x21, 0x6e, 0x75, 0x6d, 0x54, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, - 0x73, 0x54, 0x6f, 0x54, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x50, 0x6f, 0x72, 0x74, 0x4d, 0x69, - 0x67, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x5e, 0x0a, 0x14, 0x63, 0x6f, 0x6e, 0x6e, 0x65, - 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6b, 0x65, 0x65, 0x70, 0x61, 0x6c, 0x69, 0x76, 0x65, 0x18, - 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2b, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, - 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x51, 0x75, 0x69, - 0x63, 0x4b, 0x65, 0x65, 0x70, 0x41, 0x6c, 0x69, 0x76, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, - 0x67, 0x73, 0x52, 0x13, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x4b, 0x65, - 0x65, 0x70, 0x61, 0x6c, 0x69, 0x76, 0x65, 0x12, 0x2d, 0x0a, 0x12, 0x63, 0x6f, 0x6e, 0x6e, 0x65, - 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x06, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x11, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x4f, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x3a, 0x0a, 0x19, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, - 0x5f, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6f, 0x70, 0x74, 0x69, - 0x6f, 0x6e, 0x73, 0x18, 0x07, 0x20, 0x01, 0x28, 0x09, 0x52, 0x17, 0x63, 0x6c, 0x69, 0x65, 0x6e, - 0x74, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x4f, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x73, 0x12, 0x5c, 0x0a, 0x14, 0x69, 0x64, 0x6c, 0x65, 0x5f, 0x6e, 0x65, 0x74, 0x77, 0x6f, - 0x72, 0x6b, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x0f, 0xfa, 0x42, 0x0c, - 0xaa, 0x01, 0x09, 0x22, 0x03, 0x08, 0xd8, 0x04, 0x32, 0x02, 0x08, 0x01, 0x52, 0x12, 0x69, 0x64, - 0x6c, 0x65, 0x4e, 0x65, 0x74, 0x77, 0x6f, 0x72, 0x6b, 0x54, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, - 0x12, 0x48, 0x0a, 0x11, 0x6d, 0x61, 0x78, 0x5f, 0x70, 0x61, 0x63, 0x6b, 0x65, 0x74, 0x5f, 0x6c, - 0x65, 0x6e, 0x67, 0x74, 0x68, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, + 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x0a, 0xfa, 0x42, 0x07, 0x2a, 0x05, + 0x18, 0x80, 0x40, 0x20, 0x00, 0x52, 0x14, 0x6d, 0x61, 0x78, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, + 0x73, 0x65, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x4b, 0x62, 0x12, 0x49, 0x0a, 0x13, 0x6d, + 0x61, 0x78, 0x5f, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x5f, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x52, 0x11, 0x6d, 0x61, 0x78, 0x53, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x44, 0x75, + 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x8d, 0x01, 0x0a, 0x1f, 0x68, 0x65, 0x61, 0x64, 0x65, + 0x72, 0x73, 0x5f, 0x77, 0x69, 0x74, 0x68, 0x5f, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x73, 0x63, 0x6f, + 0x72, 0x65, 0x73, 0x5f, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0e, + 0x32, 0x46, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, + 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x50, 0x72, 0x6f, 0x74, + 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x48, 0x65, 0x61, 0x64, + 0x65, 0x72, 0x73, 0x57, 0x69, 0x74, 0x68, 0x55, 0x6e, 0x64, 0x65, 0x72, 0x73, 0x63, 0x6f, 0x72, + 0x65, 0x73, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x1c, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, + 0x73, 0x57, 0x69, 0x74, 0x68, 0x55, 0x6e, 0x64, 0x65, 0x72, 0x73, 0x63, 0x6f, 0x72, 0x65, 0x73, + 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x5b, 0x0a, 0x1b, 0x6d, 0x61, 0x78, 0x5f, 0x72, 0x65, + 0x71, 0x75, 0x65, 0x73, 0x74, 0x73, 0x5f, 0x70, 0x65, 0x72, 0x5f, 0x63, 0x6f, 0x6e, 0x6e, 0x65, + 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, - 0x6e, 0x74, 0x36, 0x34, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x0f, 0x6d, 0x61, 0x78, 0x50, 0x61, - 0x63, 0x6b, 0x65, 0x74, 0x4c, 0x65, 0x6e, 0x67, 0x74, 0x68, 0x22, 0xe4, 0x01, 0x0a, 0x1b, 0x55, - 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x48, 0x74, 0x74, 0x70, 0x50, 0x72, 0x6f, 0x74, 0x6f, - 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x19, 0x0a, 0x08, 0x61, 0x75, - 0x74, 0x6f, 0x5f, 0x73, 0x6e, 0x69, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x52, 0x07, 0x61, 0x75, - 0x74, 0x6f, 0x53, 0x6e, 0x69, 0x12, 0x2e, 0x0a, 0x13, 0x61, 0x75, 0x74, 0x6f, 0x5f, 0x73, 0x61, - 0x6e, 0x5f, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x08, 0x52, 0x11, 0x61, 0x75, 0x74, 0x6f, 0x53, 0x61, 0x6e, 0x56, 0x61, 0x6c, 0x69, 0x64, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x44, 0x0a, 0x18, 0x6f, 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, - 0x65, 0x5f, 0x61, 0x75, 0x74, 0x6f, 0x5f, 0x73, 0x6e, 0x69, 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, - 0x72, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x0b, 0xfa, 0x42, 0x08, 0x72, 0x06, 0xd0, 0x01, - 0x01, 0xc0, 0x01, 0x01, 0x52, 0x15, 0x6f, 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, 0x65, 0x41, 0x75, - 0x74, 0x6f, 0x53, 0x6e, 0x69, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x3a, 0x34, 0x9a, 0xc5, 0x88, - 0x1e, 0x2f, 0x0a, 0x2d, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, - 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x55, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x48, 0x74, + 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x18, 0x6d, 0x61, 0x78, 0x52, 0x65, + 0x71, 0x75, 0x65, 0x73, 0x74, 0x73, 0x50, 0x65, 0x72, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, + 0x69, 0x6f, 0x6e, 0x22, 0x4e, 0x0a, 0x1c, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x57, 0x69, + 0x74, 0x68, 0x55, 0x6e, 0x64, 0x65, 0x72, 0x73, 0x63, 0x6f, 0x72, 0x65, 0x73, 0x41, 0x63, 0x74, + 0x69, 0x6f, 0x6e, 0x12, 0x09, 0x0a, 0x05, 0x41, 0x4c, 0x4c, 0x4f, 0x57, 0x10, 0x00, 0x12, 0x12, + 0x0a, 0x0e, 0x52, 0x45, 0x4a, 0x45, 0x43, 0x54, 0x5f, 0x52, 0x45, 0x51, 0x55, 0x45, 0x53, 0x54, + 0x10, 0x01, 0x12, 0x0f, 0x0a, 0x0b, 0x44, 0x52, 0x4f, 0x50, 0x5f, 0x48, 0x45, 0x41, 0x44, 0x45, + 0x52, 0x10, 0x02, 0x3a, 0x2c, 0x9a, 0xc5, 0x88, 0x1e, 0x27, 0x0a, 0x25, 0x65, 0x6e, 0x76, 0x6f, + 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, - 0x73, 0x22, 0x86, 0x04, 0x0a, 0x1e, 0x41, 0x6c, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x65, 0x50, - 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x73, 0x43, 0x61, 0x63, 0x68, 0x65, 0x4f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x1b, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, - 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x04, 0x6e, 0x61, 0x6d, - 0x65, 0x12, 0x46, 0x0a, 0x0b, 0x6d, 0x61, 0x78, 0x5f, 0x65, 0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, - 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, - 0x61, 0x6c, 0x75, 0x65, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x2a, 0x02, 0x20, 0x00, 0x52, 0x0a, 0x6d, - 0x61, 0x78, 0x45, 0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, 0x12, 0x5f, 0x0a, 0x16, 0x6b, 0x65, 0x79, - 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x5f, 0x73, 0x74, 0x6f, 0x72, 0x65, 0x5f, 0x63, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, - 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, - 0x2e, 0x54, 0x79, 0x70, 0x65, 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x43, - 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x13, 0x6b, 0x65, 0x79, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x53, - 0x74, 0x6f, 0x72, 0x65, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x84, 0x01, 0x0a, 0x14, 0x70, - 0x72, 0x65, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x74, 0x65, 0x64, 0x5f, 0x65, 0x6e, 0x74, 0x72, - 0x69, 0x65, 0x73, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x51, 0x2e, 0x65, 0x6e, 0x76, 0x6f, - 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, - 0x2e, 0x41, 0x6c, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, - 0x6f, 0x6c, 0x73, 0x43, 0x61, 0x63, 0x68, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, - 0x41, 0x6c, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, - 0x6c, 0x73, 0x43, 0x61, 0x63, 0x68, 0x65, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x13, 0x70, 0x72, - 0x65, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x74, 0x65, 0x64, 0x45, 0x6e, 0x74, 0x72, 0x69, 0x65, - 0x73, 0x12, 0x2d, 0x0a, 0x12, 0x63, 0x61, 0x6e, 0x6f, 0x6e, 0x69, 0x63, 0x61, 0x6c, 0x5f, 0x73, - 0x75, 0x66, 0x66, 0x69, 0x78, 0x65, 0x73, 0x18, 0x05, 0x20, 0x03, 0x28, 0x09, 0x52, 0x11, 0x63, - 0x61, 0x6e, 0x6f, 0x6e, 0x69, 0x63, 0x61, 0x6c, 0x53, 0x75, 0x66, 0x66, 0x69, 0x78, 0x65, 0x73, - 0x1a, 0x68, 0x0a, 0x1c, 0x41, 0x6c, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, - 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x73, 0x43, 0x61, 0x63, 0x68, 0x65, 0x45, 0x6e, 0x74, 0x72, 0x79, - 0x12, 0x27, 0x0a, 0x08, 0x68, 0x6f, 0x73, 0x74, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, - 0x28, 0x09, 0x42, 0x0b, 0xfa, 0x42, 0x08, 0x72, 0x06, 0xd0, 0x01, 0x01, 0xc0, 0x01, 0x01, 0x52, - 0x08, 0x68, 0x6f, 0x73, 0x74, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x1f, 0x0a, 0x04, 0x70, 0x6f, 0x72, - 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0d, 0x42, 0x0b, 0xfa, 0x42, 0x08, 0x2a, 0x06, 0x10, 0xff, - 0xff, 0x03, 0x20, 0x00, 0x52, 0x04, 0x70, 0x6f, 0x72, 0x74, 0x22, 0x90, 0x06, 0x0a, 0x13, 0x48, - 0x74, 0x74, 0x70, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x73, 0x12, 0x3c, 0x0a, 0x0c, 0x69, 0x64, 0x6c, 0x65, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x6f, - 0x75, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x52, 0x0b, 0x69, 0x64, 0x6c, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, - 0x12, 0x51, 0x0a, 0x17, 0x6d, 0x61, 0x78, 0x5f, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, - 0x6f, 0x6e, 0x5f, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x15, 0x6d, 0x61, - 0x78, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x75, 0x72, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x12, 0x51, 0x0a, 0x11, 0x6d, 0x61, 0x78, 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, - 0x72, 0x73, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, - 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x07, 0xfa, 0x42, - 0x04, 0x2a, 0x02, 0x28, 0x01, 0x52, 0x0f, 0x6d, 0x61, 0x78, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, - 0x73, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x12, 0x5f, 0x0a, 0x17, 0x6d, 0x61, 0x78, 0x5f, 0x72, 0x65, - 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x5f, 0x6b, - 0x62, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, - 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x0a, 0xfa, 0x42, 0x07, 0x2a, 0x05, 0x18, 0x80, 0x40, 0x20, - 0x00, 0x52, 0x14, 0x6d, 0x61, 0x78, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x48, 0x65, - 0x61, 0x64, 0x65, 0x72, 0x73, 0x4b, 0x62, 0x12, 0x49, 0x0a, 0x13, 0x6d, 0x61, 0x78, 0x5f, 0x73, - 0x74, 0x72, 0x65, 0x61, 0x6d, 0x5f, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, - 0x11, 0x6d, 0x61, 0x78, 0x53, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x12, 0x8d, 0x01, 0x0a, 0x1f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x5f, 0x77, - 0x69, 0x74, 0x68, 0x5f, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x73, 0x63, 0x6f, 0x72, 0x65, 0x73, 0x5f, - 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x46, 0x2e, 0x65, - 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, - 0x2e, 0x76, 0x33, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, - 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x57, - 0x69, 0x74, 0x68, 0x55, 0x6e, 0x64, 0x65, 0x72, 0x73, 0x63, 0x6f, 0x72, 0x65, 0x73, 0x41, 0x63, - 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x1c, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x57, 0x69, 0x74, - 0x68, 0x55, 0x6e, 0x64, 0x65, 0x72, 0x73, 0x63, 0x6f, 0x72, 0x65, 0x73, 0x41, 0x63, 0x74, 0x69, - 0x6f, 0x6e, 0x12, 0x5b, 0x0a, 0x1b, 0x6d, 0x61, 0x78, 0x5f, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, - 0x74, 0x73, 0x5f, 0x70, 0x65, 0x72, 0x5f, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, - 0x6e, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, - 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x18, 0x6d, 0x61, 0x78, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, - 0x74, 0x73, 0x50, 0x65, 0x72, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x22, - 0x4e, 0x0a, 0x1c, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x57, 0x69, 0x74, 0x68, 0x55, 0x6e, - 0x64, 0x65, 0x72, 0x73, 0x63, 0x6f, 0x72, 0x65, 0x73, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, - 0x09, 0x0a, 0x05, 0x41, 0x4c, 0x4c, 0x4f, 0x57, 0x10, 0x00, 0x12, 0x12, 0x0a, 0x0e, 0x52, 0x45, - 0x4a, 0x45, 0x43, 0x54, 0x5f, 0x52, 0x45, 0x51, 0x55, 0x45, 0x53, 0x54, 0x10, 0x01, 0x12, 0x0f, - 0x0a, 0x0b, 0x44, 0x52, 0x4f, 0x50, 0x5f, 0x48, 0x45, 0x41, 0x44, 0x45, 0x52, 0x10, 0x02, 0x3a, - 0x2c, 0x9a, 0xc5, 0x88, 0x1e, 0x27, 0x0a, 0x25, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, - 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x50, 0x72, - 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x22, 0x93, 0x09, - 0x0a, 0x14, 0x48, 0x74, 0x74, 0x70, 0x31, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x48, 0x0a, 0x12, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x5f, - 0x61, 0x62, 0x73, 0x6f, 0x6c, 0x75, 0x74, 0x65, 0x5f, 0x75, 0x72, 0x6c, 0x18, 0x01, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x10, - 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x41, 0x62, 0x73, 0x6f, 0x6c, 0x75, 0x74, 0x65, 0x55, 0x72, 0x6c, - 0x12, 0x24, 0x0a, 0x0e, 0x61, 0x63, 0x63, 0x65, 0x70, 0x74, 0x5f, 0x68, 0x74, 0x74, 0x70, 0x5f, - 0x31, 0x30, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0c, 0x61, 0x63, 0x63, 0x65, 0x70, 0x74, - 0x48, 0x74, 0x74, 0x70, 0x31, 0x30, 0x12, 0x36, 0x0a, 0x18, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, - 0x74, 0x5f, 0x68, 0x6f, 0x73, 0x74, 0x5f, 0x66, 0x6f, 0x72, 0x5f, 0x68, 0x74, 0x74, 0x70, 0x5f, - 0x31, 0x30, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x14, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, - 0x74, 0x48, 0x6f, 0x73, 0x74, 0x46, 0x6f, 0x72, 0x48, 0x74, 0x74, 0x70, 0x31, 0x30, 0x12, 0x66, - 0x0a, 0x11, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x5f, 0x6b, 0x65, 0x79, 0x5f, 0x66, 0x6f, 0x72, - 0x6d, 0x61, 0x74, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x3a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, - 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, - 0x2e, 0x48, 0x74, 0x74, 0x70, 0x31, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, - 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x4b, 0x65, 0x79, 0x46, - 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x52, 0x0f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x4b, 0x65, 0x79, - 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x12, 0x27, 0x0a, 0x0f, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, - 0x5f, 0x74, 0x72, 0x61, 0x69, 0x6c, 0x65, 0x72, 0x73, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x52, - 0x0e, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x54, 0x72, 0x61, 0x69, 0x6c, 0x65, 0x72, 0x73, 0x12, - 0x30, 0x0a, 0x14, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x5f, 0x63, 0x68, 0x75, 0x6e, 0x6b, 0x65, 0x64, - 0x5f, 0x6c, 0x65, 0x6e, 0x67, 0x74, 0x68, 0x18, 0x06, 0x20, 0x01, 0x28, 0x08, 0x52, 0x12, 0x61, - 0x6c, 0x6c, 0x6f, 0x77, 0x43, 0x68, 0x75, 0x6e, 0x6b, 0x65, 0x64, 0x4c, 0x65, 0x6e, 0x67, 0x74, - 0x68, 0x12, 0x7a, 0x0a, 0x2d, 0x6f, 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, 0x65, 0x5f, 0x73, 0x74, - 0x72, 0x65, 0x61, 0x6d, 0x5f, 0x65, 0x72, 0x72, 0x6f, 0x72, 0x5f, 0x6f, 0x6e, 0x5f, 0x69, 0x6e, - 0x76, 0x61, 0x6c, 0x69, 0x64, 0x5f, 0x68, 0x74, 0x74, 0x70, 0x5f, 0x6d, 0x65, 0x73, 0x73, 0x61, - 0x67, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, - 0x61, 0x6c, 0x75, 0x65, 0x52, 0x27, 0x6f, 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, 0x65, 0x53, 0x74, - 0x72, 0x65, 0x61, 0x6d, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x4f, 0x6e, 0x49, 0x6e, 0x76, 0x61, 0x6c, - 0x69, 0x64, 0x48, 0x74, 0x74, 0x70, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x12, 0x37, 0x0a, - 0x18, 0x73, 0x65, 0x6e, 0x64, 0x5f, 0x66, 0x75, 0x6c, 0x6c, 0x79, 0x5f, 0x71, 0x75, 0x61, 0x6c, - 0x69, 0x66, 0x69, 0x65, 0x64, 0x5f, 0x75, 0x72, 0x6c, 0x18, 0x08, 0x20, 0x01, 0x28, 0x08, 0x52, - 0x15, 0x73, 0x65, 0x6e, 0x64, 0x46, 0x75, 0x6c, 0x6c, 0x79, 0x51, 0x75, 0x61, 0x6c, 0x69, 0x66, - 0x69, 0x65, 0x64, 0x55, 0x72, 0x6c, 0x12, 0x4e, 0x0a, 0x10, 0x75, 0x73, 0x65, 0x5f, 0x62, 0x61, - 0x6c, 0x73, 0x61, 0x5f, 0x70, 0x61, 0x72, 0x73, 0x65, 0x72, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x08, 0xd2, 0xc6, - 0xa4, 0xe1, 0x06, 0x02, 0x08, 0x01, 0x52, 0x0e, 0x75, 0x73, 0x65, 0x42, 0x61, 0x6c, 0x73, 0x61, - 0x50, 0x61, 0x72, 0x73, 0x65, 0x72, 0x12, 0x3a, 0x0a, 0x14, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x5f, - 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x5f, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x73, 0x18, 0x0a, - 0x20, 0x01, 0x28, 0x08, 0x42, 0x08, 0xd2, 0xc6, 0xa4, 0xe1, 0x06, 0x02, 0x08, 0x01, 0x52, 0x12, - 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x43, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x4d, 0x65, 0x74, 0x68, 0x6f, - 0x64, 0x73, 0x1a, 0x9f, 0x03, 0x0a, 0x0f, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x4b, 0x65, 0x79, - 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x12, 0x78, 0x0a, 0x11, 0x70, 0x72, 0x6f, 0x70, 0x65, 0x72, - 0x5f, 0x63, 0x61, 0x73, 0x65, 0x5f, 0x77, 0x6f, 0x72, 0x64, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x4a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x31, 0x50, 0x72, - 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x48, 0x65, - 0x61, 0x64, 0x65, 0x72, 0x4b, 0x65, 0x79, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x2e, 0x50, 0x72, - 0x6f, 0x70, 0x65, 0x72, 0x43, 0x61, 0x73, 0x65, 0x57, 0x6f, 0x72, 0x64, 0x73, 0x48, 0x00, 0x52, - 0x0f, 0x70, 0x72, 0x6f, 0x70, 0x65, 0x72, 0x43, 0x61, 0x73, 0x65, 0x57, 0x6f, 0x72, 0x64, 0x73, - 0x12, 0x5b, 0x0a, 0x12, 0x73, 0x74, 0x61, 0x74, 0x65, 0x66, 0x75, 0x6c, 0x5f, 0x66, 0x6f, 0x72, - 0x6d, 0x61, 0x74, 0x74, 0x65, 0x72, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x65, - 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, - 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x79, 0x70, 0x65, 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, - 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x48, 0x00, 0x52, 0x11, 0x73, 0x74, 0x61, 0x74, - 0x65, 0x66, 0x75, 0x6c, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x74, 0x65, 0x72, 0x1a, 0x60, 0x0a, - 0x0f, 0x50, 0x72, 0x6f, 0x70, 0x65, 0x72, 0x43, 0x61, 0x73, 0x65, 0x57, 0x6f, 0x72, 0x64, 0x73, - 0x3a, 0x4d, 0x9a, 0xc5, 0x88, 0x1e, 0x48, 0x0a, 0x46, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, - 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x31, - 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, - 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x4b, 0x65, 0x79, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x2e, - 0x50, 0x72, 0x6f, 0x70, 0x65, 0x72, 0x43, 0x61, 0x73, 0x65, 0x57, 0x6f, 0x72, 0x64, 0x73, 0x3a, - 0x3d, 0x9a, 0xc5, 0x88, 0x1e, 0x38, 0x0a, 0x36, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, - 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x31, 0x50, - 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x48, - 0x65, 0x61, 0x64, 0x65, 0x72, 0x4b, 0x65, 0x79, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x42, 0x14, - 0x0a, 0x0d, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x5f, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x12, - 0x03, 0xf8, 0x42, 0x01, 0x3a, 0x2d, 0x9a, 0xc5, 0x88, 0x1e, 0x28, 0x0a, 0x26, 0x65, 0x6e, 0x76, + 0x73, 0x22, 0x93, 0x09, 0x0a, 0x14, 0x48, 0x74, 0x74, 0x70, 0x31, 0x50, 0x72, 0x6f, 0x74, 0x6f, + 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x48, 0x0a, 0x12, 0x61, 0x6c, + 0x6c, 0x6f, 0x77, 0x5f, 0x61, 0x62, 0x73, 0x6f, 0x6c, 0x75, 0x74, 0x65, 0x5f, 0x75, 0x72, 0x6c, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, + 0x75, 0x65, 0x52, 0x10, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x41, 0x62, 0x73, 0x6f, 0x6c, 0x75, 0x74, + 0x65, 0x55, 0x72, 0x6c, 0x12, 0x24, 0x0a, 0x0e, 0x61, 0x63, 0x63, 0x65, 0x70, 0x74, 0x5f, 0x68, + 0x74, 0x74, 0x70, 0x5f, 0x31, 0x30, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0c, 0x61, 0x63, + 0x63, 0x65, 0x70, 0x74, 0x48, 0x74, 0x74, 0x70, 0x31, 0x30, 0x12, 0x36, 0x0a, 0x18, 0x64, 0x65, + 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, 0x68, 0x6f, 0x73, 0x74, 0x5f, 0x66, 0x6f, 0x72, 0x5f, 0x68, + 0x74, 0x74, 0x70, 0x5f, 0x31, 0x30, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x14, 0x64, 0x65, + 0x66, 0x61, 0x75, 0x6c, 0x74, 0x48, 0x6f, 0x73, 0x74, 0x46, 0x6f, 0x72, 0x48, 0x74, 0x74, 0x70, + 0x31, 0x30, 0x12, 0x66, 0x0a, 0x11, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x5f, 0x6b, 0x65, 0x79, + 0x5f, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x3a, 0x2e, + 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, + 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x31, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, + 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, + 0x4b, 0x65, 0x79, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x52, 0x0f, 0x68, 0x65, 0x61, 0x64, 0x65, + 0x72, 0x4b, 0x65, 0x79, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x12, 0x27, 0x0a, 0x0f, 0x65, 0x6e, + 0x61, 0x62, 0x6c, 0x65, 0x5f, 0x74, 0x72, 0x61, 0x69, 0x6c, 0x65, 0x72, 0x73, 0x18, 0x05, 0x20, + 0x01, 0x28, 0x08, 0x52, 0x0e, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x54, 0x72, 0x61, 0x69, 0x6c, + 0x65, 0x72, 0x73, 0x12, 0x30, 0x0a, 0x14, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x5f, 0x63, 0x68, 0x75, + 0x6e, 0x6b, 0x65, 0x64, 0x5f, 0x6c, 0x65, 0x6e, 0x67, 0x74, 0x68, 0x18, 0x06, 0x20, 0x01, 0x28, + 0x08, 0x52, 0x12, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x43, 0x68, 0x75, 0x6e, 0x6b, 0x65, 0x64, 0x4c, + 0x65, 0x6e, 0x67, 0x74, 0x68, 0x12, 0x7a, 0x0a, 0x2d, 0x6f, 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, + 0x65, 0x5f, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x5f, 0x65, 0x72, 0x72, 0x6f, 0x72, 0x5f, 0x6f, + 0x6e, 0x5f, 0x69, 0x6e, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x5f, 0x68, 0x74, 0x74, 0x70, 0x5f, 0x6d, + 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, + 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x27, 0x6f, 0x76, 0x65, 0x72, 0x72, 0x69, + 0x64, 0x65, 0x53, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x4f, 0x6e, 0x49, + 0x6e, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x48, 0x74, 0x74, 0x70, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, + 0x65, 0x12, 0x37, 0x0a, 0x18, 0x73, 0x65, 0x6e, 0x64, 0x5f, 0x66, 0x75, 0x6c, 0x6c, 0x79, 0x5f, + 0x71, 0x75, 0x61, 0x6c, 0x69, 0x66, 0x69, 0x65, 0x64, 0x5f, 0x75, 0x72, 0x6c, 0x18, 0x08, 0x20, + 0x01, 0x28, 0x08, 0x52, 0x15, 0x73, 0x65, 0x6e, 0x64, 0x46, 0x75, 0x6c, 0x6c, 0x79, 0x51, 0x75, + 0x61, 0x6c, 0x69, 0x66, 0x69, 0x65, 0x64, 0x55, 0x72, 0x6c, 0x12, 0x4e, 0x0a, 0x10, 0x75, 0x73, + 0x65, 0x5f, 0x62, 0x61, 0x6c, 0x73, 0x61, 0x5f, 0x70, 0x61, 0x72, 0x73, 0x65, 0x72, 0x18, 0x09, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, + 0x42, 0x08, 0xd2, 0xc6, 0xa4, 0xe1, 0x06, 0x02, 0x08, 0x01, 0x52, 0x0e, 0x75, 0x73, 0x65, 0x42, + 0x61, 0x6c, 0x73, 0x61, 0x50, 0x61, 0x72, 0x73, 0x65, 0x72, 0x12, 0x3a, 0x0a, 0x14, 0x61, 0x6c, + 0x6c, 0x6f, 0x77, 0x5f, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x5f, 0x6d, 0x65, 0x74, 0x68, 0x6f, + 0x64, 0x73, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x08, 0x42, 0x08, 0xd2, 0xc6, 0xa4, 0xe1, 0x06, 0x02, + 0x08, 0x01, 0x52, 0x12, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x43, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x4d, + 0x65, 0x74, 0x68, 0x6f, 0x64, 0x73, 0x1a, 0x9f, 0x03, 0x0a, 0x0f, 0x48, 0x65, 0x61, 0x64, 0x65, + 0x72, 0x4b, 0x65, 0x79, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x12, 0x78, 0x0a, 0x11, 0x70, 0x72, + 0x6f, 0x70, 0x65, 0x72, 0x5f, 0x63, 0x61, 0x73, 0x65, 0x5f, 0x77, 0x6f, 0x72, 0x64, 0x73, 0x18, + 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x4a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, + 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x48, 0x74, 0x74, + 0x70, 0x31, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, + 0x73, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x4b, 0x65, 0x79, 0x46, 0x6f, 0x72, 0x6d, 0x61, + 0x74, 0x2e, 0x50, 0x72, 0x6f, 0x70, 0x65, 0x72, 0x43, 0x61, 0x73, 0x65, 0x57, 0x6f, 0x72, 0x64, + 0x73, 0x48, 0x00, 0x52, 0x0f, 0x70, 0x72, 0x6f, 0x70, 0x65, 0x72, 0x43, 0x61, 0x73, 0x65, 0x57, + 0x6f, 0x72, 0x64, 0x73, 0x12, 0x5b, 0x0a, 0x12, 0x73, 0x74, 0x61, 0x74, 0x65, 0x66, 0x75, 0x6c, + 0x5f, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x74, 0x65, 0x72, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x2a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, + 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x79, 0x70, 0x65, 0x64, 0x45, 0x78, 0x74, + 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x48, 0x00, 0x52, 0x11, + 0x73, 0x74, 0x61, 0x74, 0x65, 0x66, 0x75, 0x6c, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x74, 0x65, + 0x72, 0x1a, 0x60, 0x0a, 0x0f, 0x50, 0x72, 0x6f, 0x70, 0x65, 0x72, 0x43, 0x61, 0x73, 0x65, 0x57, + 0x6f, 0x72, 0x64, 0x73, 0x3a, 0x4d, 0x9a, 0xc5, 0x88, 0x1e, 0x48, 0x0a, 0x46, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x31, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, - 0x6f, 0x6e, 0x73, 0x22, 0xc1, 0x02, 0x0a, 0x11, 0x4b, 0x65, 0x65, 0x70, 0x61, 0x6c, 0x69, 0x76, - 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x43, 0x0a, 0x08, 0x69, 0x6e, 0x74, - 0x65, 0x72, 0x76, 0x61, 0x6c, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, - 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x0c, 0xfa, 0x42, 0x09, 0xaa, 0x01, 0x06, 0x32, 0x04, - 0x10, 0xc0, 0x84, 0x3d, 0x52, 0x08, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x12, 0x43, - 0x0a, 0x07, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x6f, 0x6e, 0x73, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x4b, 0x65, 0x79, 0x46, 0x6f, 0x72, + 0x6d, 0x61, 0x74, 0x2e, 0x50, 0x72, 0x6f, 0x70, 0x65, 0x72, 0x43, 0x61, 0x73, 0x65, 0x57, 0x6f, + 0x72, 0x64, 0x73, 0x3a, 0x3d, 0x9a, 0xc5, 0x88, 0x1e, 0x38, 0x0a, 0x36, 0x65, 0x6e, 0x76, 0x6f, + 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x48, 0x74, + 0x74, 0x70, 0x31, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, + 0x6e, 0x73, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x4b, 0x65, 0x79, 0x46, 0x6f, 0x72, 0x6d, + 0x61, 0x74, 0x42, 0x14, 0x0a, 0x0d, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x5f, 0x66, 0x6f, 0x72, + 0x6d, 0x61, 0x74, 0x12, 0x03, 0xf8, 0x42, 0x01, 0x3a, 0x2d, 0x9a, 0xc5, 0x88, 0x1e, 0x28, 0x0a, + 0x26, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, + 0x72, 0x65, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x31, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, + 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x22, 0xc1, 0x02, 0x0a, 0x11, 0x4b, 0x65, 0x65, 0x70, + 0x61, 0x6c, 0x69, 0x76, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x43, 0x0a, + 0x08, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x0e, 0xfa, 0x42, 0x0b, 0xaa, - 0x01, 0x08, 0x08, 0x01, 0x32, 0x04, 0x10, 0xc0, 0x84, 0x3d, 0x52, 0x07, 0x74, 0x69, 0x6d, 0x65, - 0x6f, 0x75, 0x74, 0x12, 0x3f, 0x0a, 0x0f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x5f, - 0x6a, 0x69, 0x74, 0x74, 0x65, 0x72, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x16, 0x2e, 0x65, - 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x65, 0x72, - 0x63, 0x65, 0x6e, 0x74, 0x52, 0x0e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x4a, 0x69, - 0x74, 0x74, 0x65, 0x72, 0x12, 0x61, 0x0a, 0x18, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, - 0x6f, 0x6e, 0x5f, 0x69, 0x64, 0x6c, 0x65, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, - 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x42, 0x0c, 0xfa, 0x42, 0x09, 0xaa, 0x01, 0x06, 0x32, 0x04, 0x10, 0xc0, 0x84, 0x3d, 0x52, - 0x16, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x49, 0x64, 0x6c, 0x65, 0x49, - 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x22, 0xd0, 0x0e, 0x0a, 0x14, 0x48, 0x74, 0x74, 0x70, - 0x32, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, - 0x12, 0x46, 0x0a, 0x10, 0x68, 0x70, 0x61, 0x63, 0x6b, 0x5f, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x5f, - 0x73, 0x69, 0x7a, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, - 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x0e, 0x68, 0x70, 0x61, 0x63, 0x6b, 0x54, - 0x61, 0x62, 0x6c, 0x65, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x61, 0x0a, 0x16, 0x6d, 0x61, 0x78, 0x5f, - 0x63, 0x6f, 0x6e, 0x63, 0x75, 0x72, 0x72, 0x65, 0x6e, 0x74, 0x5f, 0x73, 0x74, 0x72, 0x65, 0x61, - 0x6d, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x0c, 0xfa, 0x42, 0x09, 0xaa, + 0x01, 0x06, 0x32, 0x04, 0x10, 0xc0, 0x84, 0x3d, 0x52, 0x08, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, + 0x61, 0x6c, 0x12, 0x43, 0x0a, 0x07, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x18, 0x02, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, + 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x0e, + 0xfa, 0x42, 0x0b, 0xaa, 0x01, 0x08, 0x08, 0x01, 0x32, 0x04, 0x10, 0xc0, 0x84, 0x3d, 0x52, 0x07, + 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x12, 0x3f, 0x0a, 0x0f, 0x69, 0x6e, 0x74, 0x65, 0x72, + 0x76, 0x61, 0x6c, 0x5f, 0x6a, 0x69, 0x74, 0x74, 0x65, 0x72, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x16, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x76, 0x33, + 0x2e, 0x50, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74, 0x52, 0x0e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, + 0x61, 0x6c, 0x4a, 0x69, 0x74, 0x74, 0x65, 0x72, 0x12, 0x61, 0x0a, 0x18, 0x63, 0x6f, 0x6e, 0x6e, + 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x69, 0x64, 0x6c, 0x65, 0x5f, 0x69, 0x6e, 0x74, 0x65, + 0x72, 0x76, 0x61, 0x6c, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x0c, 0xfa, 0x42, 0x09, 0xaa, 0x01, 0x06, 0x32, 0x04, 0x10, + 0xc0, 0x84, 0x3d, 0x52, 0x16, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x49, + 0x64, 0x6c, 0x65, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x22, 0xd0, 0x0e, 0x0a, 0x14, + 0x48, 0x74, 0x74, 0x70, 0x32, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, + 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x46, 0x0a, 0x10, 0x68, 0x70, 0x61, 0x63, 0x6b, 0x5f, 0x74, 0x61, + 0x62, 0x6c, 0x65, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, + 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x0e, 0x68, 0x70, + 0x61, 0x63, 0x6b, 0x54, 0x61, 0x62, 0x6c, 0x65, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x61, 0x0a, 0x16, + 0x6d, 0x61, 0x78, 0x5f, 0x63, 0x6f, 0x6e, 0x63, 0x75, 0x72, 0x72, 0x65, 0x6e, 0x74, 0x5f, 0x73, + 0x74, 0x72, 0x65, 0x61, 0x6d, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, + 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x0d, 0xfa, 0x42, 0x0a, 0x2a, + 0x08, 0x18, 0xff, 0xff, 0xff, 0xff, 0x07, 0x28, 0x01, 0x52, 0x14, 0x6d, 0x61, 0x78, 0x43, 0x6f, + 0x6e, 0x63, 0x75, 0x72, 0x72, 0x65, 0x6e, 0x74, 0x53, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x73, 0x12, + 0x6a, 0x0a, 0x1a, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x5f, 0x73, 0x74, 0x72, 0x65, 0x61, + 0x6d, 0x5f, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x03, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, + 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, + 0x65, 0x42, 0x0f, 0xfa, 0x42, 0x0c, 0x2a, 0x0a, 0x18, 0xff, 0xff, 0xff, 0xff, 0x07, 0x28, 0xff, + 0xff, 0x03, 0x52, 0x17, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x53, 0x74, 0x72, 0x65, 0x61, + 0x6d, 0x57, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x72, 0x0a, 0x1e, 0x69, + 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x5f, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, + 0x6e, 0x5f, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x04, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, + 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, + 0x65, 0x42, 0x0f, 0xfa, 0x42, 0x0c, 0x2a, 0x0a, 0x18, 0xff, 0xff, 0xff, 0xff, 0x07, 0x28, 0xff, + 0xff, 0x03, 0x52, 0x1b, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x43, 0x6f, 0x6e, 0x6e, 0x65, + 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x57, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x53, 0x69, 0x7a, 0x65, 0x12, + 0x23, 0x0a, 0x0d, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x5f, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, + 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0c, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x43, 0x6f, 0x6e, + 0x6e, 0x65, 0x63, 0x74, 0x12, 0x25, 0x0a, 0x0e, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x5f, 0x6d, 0x65, + 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x18, 0x06, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0d, 0x61, 0x6c, + 0x6c, 0x6f, 0x77, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x12, 0x55, 0x0a, 0x13, 0x6d, + 0x61, 0x78, 0x5f, 0x6f, 0x75, 0x74, 0x62, 0x6f, 0x75, 0x6e, 0x64, 0x5f, 0x66, 0x72, 0x61, 0x6d, + 0x65, 0x73, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, - 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x0d, 0xfa, 0x42, 0x0a, 0x2a, 0x08, 0x18, 0xff, 0xff, - 0xff, 0xff, 0x07, 0x28, 0x01, 0x52, 0x14, 0x6d, 0x61, 0x78, 0x43, 0x6f, 0x6e, 0x63, 0x75, 0x72, - 0x72, 0x65, 0x6e, 0x74, 0x53, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x73, 0x12, 0x6a, 0x0a, 0x1a, 0x69, - 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x5f, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x5f, 0x77, 0x69, - 0x6e, 0x64, 0x6f, 0x77, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x2a, 0x02, 0x28, 0x01, 0x52, + 0x11, 0x6d, 0x61, 0x78, 0x4f, 0x75, 0x74, 0x62, 0x6f, 0x75, 0x6e, 0x64, 0x46, 0x72, 0x61, 0x6d, + 0x65, 0x73, 0x12, 0x64, 0x0a, 0x1b, 0x6d, 0x61, 0x78, 0x5f, 0x6f, 0x75, 0x74, 0x62, 0x6f, 0x75, + 0x6e, 0x64, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x5f, 0x66, 0x72, 0x61, 0x6d, 0x65, + 0x73, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, + 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x2a, 0x02, 0x28, 0x01, 0x52, 0x18, + 0x6d, 0x61, 0x78, 0x4f, 0x75, 0x74, 0x62, 0x6f, 0x75, 0x6e, 0x64, 0x43, 0x6f, 0x6e, 0x74, 0x72, + 0x6f, 0x6c, 0x46, 0x72, 0x61, 0x6d, 0x65, 0x73, 0x12, 0x84, 0x01, 0x0a, 0x31, 0x6d, 0x61, 0x78, + 0x5f, 0x63, 0x6f, 0x6e, 0x73, 0x65, 0x63, 0x75, 0x74, 0x69, 0x76, 0x65, 0x5f, 0x69, 0x6e, 0x62, + 0x6f, 0x75, 0x6e, 0x64, 0x5f, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x73, 0x5f, 0x77, 0x69, 0x74, 0x68, + 0x5f, 0x65, 0x6d, 0x70, 0x74, 0x79, 0x5f, 0x70, 0x61, 0x79, 0x6c, 0x6f, 0x61, 0x64, 0x18, 0x09, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, + 0x75, 0x65, 0x52, 0x2b, 0x6d, 0x61, 0x78, 0x43, 0x6f, 0x6e, 0x73, 0x65, 0x63, 0x75, 0x74, 0x69, + 0x76, 0x65, 0x49, 0x6e, 0x62, 0x6f, 0x75, 0x6e, 0x64, 0x46, 0x72, 0x61, 0x6d, 0x65, 0x73, 0x57, + 0x69, 0x74, 0x68, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x50, 0x61, 0x79, 0x6c, 0x6f, 0x61, 0x64, 0x12, + 0x6f, 0x0a, 0x26, 0x6d, 0x61, 0x78, 0x5f, 0x69, 0x6e, 0x62, 0x6f, 0x75, 0x6e, 0x64, 0x5f, 0x70, + 0x72, 0x69, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x5f, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x73, 0x5f, 0x70, + 0x65, 0x72, 0x5f, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x0f, 0xfa, - 0x42, 0x0c, 0x2a, 0x0a, 0x18, 0xff, 0xff, 0xff, 0xff, 0x07, 0x28, 0xff, 0xff, 0x03, 0x52, 0x17, - 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x53, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x57, 0x69, 0x6e, - 0x64, 0x6f, 0x77, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x72, 0x0a, 0x1e, 0x69, 0x6e, 0x69, 0x74, 0x69, - 0x61, 0x6c, 0x5f, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x77, 0x69, - 0x6e, 0x64, 0x6f, 0x77, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x21, 0x6d, + 0x61, 0x78, 0x49, 0x6e, 0x62, 0x6f, 0x75, 0x6e, 0x64, 0x50, 0x72, 0x69, 0x6f, 0x72, 0x69, 0x74, + 0x79, 0x46, 0x72, 0x61, 0x6d, 0x65, 0x73, 0x50, 0x65, 0x72, 0x53, 0x74, 0x72, 0x65, 0x61, 0x6d, + 0x12, 0x91, 0x01, 0x0a, 0x34, 0x6d, 0x61, 0x78, 0x5f, 0x69, 0x6e, 0x62, 0x6f, 0x75, 0x6e, 0x64, + 0x5f, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x5f, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x5f, 0x66, + 0x72, 0x61, 0x6d, 0x65, 0x73, 0x5f, 0x70, 0x65, 0x72, 0x5f, 0x64, 0x61, 0x74, 0x61, 0x5f, 0x66, + 0x72, 0x61, 0x6d, 0x65, 0x5f, 0x73, 0x65, 0x6e, 0x74, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x0f, 0xfa, - 0x42, 0x0c, 0x2a, 0x0a, 0x18, 0xff, 0xff, 0xff, 0xff, 0x07, 0x28, 0xff, 0xff, 0x03, 0x52, 0x1b, - 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, - 0x6e, 0x57, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x23, 0x0a, 0x0d, 0x61, - 0x6c, 0x6c, 0x6f, 0x77, 0x5f, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x18, 0x05, 0x20, 0x01, - 0x28, 0x08, 0x52, 0x0c, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, - 0x12, 0x25, 0x0a, 0x0e, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, - 0x74, 0x61, 0x18, 0x06, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0d, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x4d, - 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x12, 0x55, 0x0a, 0x13, 0x6d, 0x61, 0x78, 0x5f, 0x6f, - 0x75, 0x74, 0x62, 0x6f, 0x75, 0x6e, 0x64, 0x5f, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x73, 0x18, 0x07, + 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x07, 0xfa, + 0x42, 0x04, 0x2a, 0x02, 0x28, 0x01, 0x52, 0x2c, 0x6d, 0x61, 0x78, 0x49, 0x6e, 0x62, 0x6f, 0x75, + 0x6e, 0x64, 0x57, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x46, 0x72, + 0x61, 0x6d, 0x65, 0x73, 0x50, 0x65, 0x72, 0x44, 0x61, 0x74, 0x61, 0x46, 0x72, 0x61, 0x6d, 0x65, + 0x53, 0x65, 0x6e, 0x74, 0x12, 0x5e, 0x0a, 0x26, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x5f, 0x65, + 0x72, 0x72, 0x6f, 0x72, 0x5f, 0x6f, 0x6e, 0x5f, 0x69, 0x6e, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x5f, + 0x68, 0x74, 0x74, 0x70, 0x5f, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x69, 0x6e, 0x67, 0x18, 0x0c, + 0x20, 0x01, 0x28, 0x08, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, + 0x01, 0x52, 0x21, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x4f, 0x6e, + 0x49, 0x6e, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x48, 0x74, 0x74, 0x70, 0x4d, 0x65, 0x73, 0x73, 0x61, + 0x67, 0x69, 0x6e, 0x67, 0x12, 0x7a, 0x0a, 0x2d, 0x6f, 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, 0x65, + 0x5f, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x5f, 0x65, 0x72, 0x72, 0x6f, 0x72, 0x5f, 0x6f, 0x6e, + 0x5f, 0x69, 0x6e, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x5f, 0x68, 0x74, 0x74, 0x70, 0x5f, 0x6d, 0x65, + 0x73, 0x73, 0x61, 0x67, 0x65, 0x18, 0x0e, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, + 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x27, 0x6f, 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, + 0x65, 0x53, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x4f, 0x6e, 0x49, 0x6e, + 0x76, 0x61, 0x6c, 0x69, 0x64, 0x48, 0x74, 0x74, 0x70, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, + 0x12, 0x7a, 0x0a, 0x1a, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, + 0x6e, 0x67, 0x73, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x73, 0x18, 0x0d, + 0x20, 0x03, 0x28, 0x0b, 0x32, 0x3c, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x48, 0x74, 0x74, 0x70, + 0x32, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, + 0x2e, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, + 0x65, 0x72, 0x52, 0x18, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, + 0x67, 0x73, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x73, 0x12, 0x5a, 0x0a, 0x14, + 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6b, 0x65, 0x65, 0x70, 0x61, + 0x6c, 0x69, 0x76, 0x65, 0x18, 0x0f, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x27, 0x2e, 0x65, 0x6e, 0x76, + 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, + 0x33, 0x2e, 0x4b, 0x65, 0x65, 0x70, 0x61, 0x6c, 0x69, 0x76, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, + 0x6e, 0x67, 0x73, 0x52, 0x13, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x4b, + 0x65, 0x65, 0x70, 0x61, 0x6c, 0x69, 0x76, 0x65, 0x12, 0x50, 0x0a, 0x11, 0x75, 0x73, 0x65, 0x5f, + 0x6f, 0x67, 0x68, 0x74, 0x74, 0x70, 0x32, 0x5f, 0x63, 0x6f, 0x64, 0x65, 0x63, 0x18, 0x10, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, + 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, + 0x08, 0xd2, 0xc6, 0xa4, 0xe1, 0x06, 0x02, 0x08, 0x01, 0x52, 0x0f, 0x75, 0x73, 0x65, 0x4f, 0x67, + 0x68, 0x74, 0x74, 0x70, 0x32, 0x43, 0x6f, 0x64, 0x65, 0x63, 0x1a, 0xe2, 0x01, 0x0a, 0x11, 0x53, + 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, + 0x12, 0x4e, 0x0a, 0x0a, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x65, 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, - 0x75, 0x65, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x2a, 0x02, 0x28, 0x01, 0x52, 0x11, 0x6d, 0x61, 0x78, - 0x4f, 0x75, 0x74, 0x62, 0x6f, 0x75, 0x6e, 0x64, 0x46, 0x72, 0x61, 0x6d, 0x65, 0x73, 0x12, 0x64, - 0x0a, 0x1b, 0x6d, 0x61, 0x78, 0x5f, 0x6f, 0x75, 0x74, 0x62, 0x6f, 0x75, 0x6e, 0x64, 0x5f, 0x63, - 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x5f, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x73, 0x18, 0x08, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, - 0x65, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x2a, 0x02, 0x28, 0x01, 0x52, 0x18, 0x6d, 0x61, 0x78, 0x4f, - 0x75, 0x74, 0x62, 0x6f, 0x75, 0x6e, 0x64, 0x43, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x46, 0x72, - 0x61, 0x6d, 0x65, 0x73, 0x12, 0x84, 0x01, 0x0a, 0x31, 0x6d, 0x61, 0x78, 0x5f, 0x63, 0x6f, 0x6e, - 0x73, 0x65, 0x63, 0x75, 0x74, 0x69, 0x76, 0x65, 0x5f, 0x69, 0x6e, 0x62, 0x6f, 0x75, 0x6e, 0x64, - 0x5f, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x73, 0x5f, 0x77, 0x69, 0x74, 0x68, 0x5f, 0x65, 0x6d, 0x70, - 0x74, 0x79, 0x5f, 0x70, 0x61, 0x79, 0x6c, 0x6f, 0x61, 0x64, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x2b, - 0x6d, 0x61, 0x78, 0x43, 0x6f, 0x6e, 0x73, 0x65, 0x63, 0x75, 0x74, 0x69, 0x76, 0x65, 0x49, 0x6e, - 0x62, 0x6f, 0x75, 0x6e, 0x64, 0x46, 0x72, 0x61, 0x6d, 0x65, 0x73, 0x57, 0x69, 0x74, 0x68, 0x45, - 0x6d, 0x70, 0x74, 0x79, 0x50, 0x61, 0x79, 0x6c, 0x6f, 0x61, 0x64, 0x12, 0x6f, 0x0a, 0x26, 0x6d, - 0x61, 0x78, 0x5f, 0x69, 0x6e, 0x62, 0x6f, 0x75, 0x6e, 0x64, 0x5f, 0x70, 0x72, 0x69, 0x6f, 0x72, - 0x69, 0x74, 0x79, 0x5f, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x73, 0x5f, 0x70, 0x65, 0x72, 0x5f, 0x73, - 0x74, 0x72, 0x65, 0x61, 0x6d, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, - 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x21, 0x6d, 0x61, 0x78, 0x49, 0x6e, - 0x62, 0x6f, 0x75, 0x6e, 0x64, 0x50, 0x72, 0x69, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x46, 0x72, 0x61, - 0x6d, 0x65, 0x73, 0x50, 0x65, 0x72, 0x53, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x12, 0x91, 0x01, 0x0a, - 0x34, 0x6d, 0x61, 0x78, 0x5f, 0x69, 0x6e, 0x62, 0x6f, 0x75, 0x6e, 0x64, 0x5f, 0x77, 0x69, 0x6e, - 0x64, 0x6f, 0x77, 0x5f, 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x5f, 0x66, 0x72, 0x61, 0x6d, 0x65, - 0x73, 0x5f, 0x70, 0x65, 0x72, 0x5f, 0x64, 0x61, 0x74, 0x61, 0x5f, 0x66, 0x72, 0x61, 0x6d, 0x65, - 0x5f, 0x73, 0x65, 0x6e, 0x74, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, - 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x2a, 0x02, - 0x28, 0x01, 0x52, 0x2c, 0x6d, 0x61, 0x78, 0x49, 0x6e, 0x62, 0x6f, 0x75, 0x6e, 0x64, 0x57, 0x69, - 0x6e, 0x64, 0x6f, 0x77, 0x55, 0x70, 0x64, 0x61, 0x74, 0x65, 0x46, 0x72, 0x61, 0x6d, 0x65, 0x73, - 0x50, 0x65, 0x72, 0x44, 0x61, 0x74, 0x61, 0x46, 0x72, 0x61, 0x6d, 0x65, 0x53, 0x65, 0x6e, 0x74, - 0x12, 0x5e, 0x0a, 0x26, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x5f, 0x65, 0x72, 0x72, 0x6f, 0x72, - 0x5f, 0x6f, 0x6e, 0x5f, 0x69, 0x6e, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x5f, 0x68, 0x74, 0x74, 0x70, - 0x5f, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x69, 0x6e, 0x67, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x08, - 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x52, 0x21, 0x73, - 0x74, 0x72, 0x65, 0x61, 0x6d, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x4f, 0x6e, 0x49, 0x6e, 0x76, 0x61, - 0x6c, 0x69, 0x64, 0x48, 0x74, 0x74, 0x70, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x69, 0x6e, 0x67, - 0x12, 0x7a, 0x0a, 0x2d, 0x6f, 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, 0x65, 0x5f, 0x73, 0x74, 0x72, - 0x65, 0x61, 0x6d, 0x5f, 0x65, 0x72, 0x72, 0x6f, 0x72, 0x5f, 0x6f, 0x6e, 0x5f, 0x69, 0x6e, 0x76, - 0x61, 0x6c, 0x69, 0x64, 0x5f, 0x68, 0x74, 0x74, 0x70, 0x5f, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, - 0x65, 0x18, 0x0e, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, - 0x6c, 0x75, 0x65, 0x52, 0x27, 0x6f, 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, 0x65, 0x53, 0x74, 0x72, - 0x65, 0x61, 0x6d, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x4f, 0x6e, 0x49, 0x6e, 0x76, 0x61, 0x6c, 0x69, - 0x64, 0x48, 0x74, 0x74, 0x70, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x12, 0x7a, 0x0a, 0x1a, - 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x5f, - 0x70, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x73, 0x18, 0x0d, 0x20, 0x03, 0x28, 0x0b, - 0x32, 0x3c, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, - 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x32, 0x50, 0x72, 0x6f, - 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x53, 0x65, 0x74, - 0x74, 0x69, 0x6e, 0x67, 0x73, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x52, 0x18, - 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x50, 0x61, - 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x73, 0x12, 0x5a, 0x0a, 0x14, 0x63, 0x6f, 0x6e, 0x6e, - 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x6b, 0x65, 0x65, 0x70, 0x61, 0x6c, 0x69, 0x76, 0x65, - 0x18, 0x0f, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x27, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, - 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x4b, 0x65, - 0x65, 0x70, 0x61, 0x6c, 0x69, 0x76, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, - 0x13, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x4b, 0x65, 0x65, 0x70, 0x61, - 0x6c, 0x69, 0x76, 0x65, 0x12, 0x50, 0x0a, 0x11, 0x75, 0x73, 0x65, 0x5f, 0x6f, 0x67, 0x68, 0x74, - 0x74, 0x70, 0x32, 0x5f, 0x63, 0x6f, 0x64, 0x65, 0x63, 0x18, 0x10, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x08, 0xd2, 0xc6, 0xa4, - 0xe1, 0x06, 0x02, 0x08, 0x01, 0x52, 0x0f, 0x75, 0x73, 0x65, 0x4f, 0x67, 0x68, 0x74, 0x74, 0x70, - 0x32, 0x43, 0x6f, 0x64, 0x65, 0x63, 0x1a, 0xe2, 0x01, 0x0a, 0x11, 0x53, 0x65, 0x74, 0x74, 0x69, - 0x6e, 0x67, 0x73, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x12, 0x4e, 0x0a, 0x0a, - 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x65, 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x10, - 0xfa, 0x42, 0x0d, 0x8a, 0x01, 0x02, 0x10, 0x01, 0x2a, 0x06, 0x18, 0xff, 0xff, 0x03, 0x28, 0x00, - 0x52, 0x0a, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x65, 0x72, 0x12, 0x3c, 0x0a, 0x05, - 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, - 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x8a, 0x01, - 0x02, 0x10, 0x01, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x3f, 0x9a, 0xc5, 0x88, 0x1e, - 0x3a, 0x0a, 0x38, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, - 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x32, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, - 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, - 0x67, 0x73, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x3a, 0x2d, 0x9a, 0xc5, 0x88, - 0x1e, 0x28, 0x0a, 0x26, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, - 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x32, 0x50, 0x72, 0x6f, 0x74, 0x6f, - 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x22, 0xa5, 0x01, 0x0a, 0x13, 0x47, - 0x72, 0x70, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x73, 0x12, 0x60, 0x0a, 0x16, 0x68, 0x74, 0x74, 0x70, 0x32, 0x5f, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x63, 0x6f, 0x6c, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x01, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x32, 0x50, - 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x14, - 0x68, 0x74, 0x74, 0x70, 0x32, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0x3a, 0x2c, 0x9a, 0xc5, 0x88, 0x1e, 0x27, 0x0a, 0x25, 0x65, 0x6e, 0x76, - 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x47, - 0x72, 0x70, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x73, 0x22, 0xd8, 0x02, 0x0a, 0x14, 0x48, 0x74, 0x74, 0x70, 0x33, 0x50, 0x72, 0x6f, 0x74, - 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x5d, 0x0a, 0x15, 0x71, - 0x75, 0x69, 0x63, 0x5f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x5f, 0x6f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x29, 0x2e, 0x65, 0x6e, 0x76, - 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, - 0x33, 0x2e, 0x51, 0x75, 0x69, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, - 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x13, 0x71, 0x75, 0x69, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, - 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x7a, 0x0a, 0x2d, 0x6f, 0x76, - 0x65, 0x72, 0x72, 0x69, 0x64, 0x65, 0x5f, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x5f, 0x65, 0x72, - 0x72, 0x6f, 0x72, 0x5f, 0x6f, 0x6e, 0x5f, 0x69, 0x6e, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x5f, 0x68, - 0x74, 0x74, 0x70, 0x5f, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x27, 0x6f, - 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, 0x65, 0x53, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x45, 0x72, 0x72, - 0x6f, 0x72, 0x4f, 0x6e, 0x49, 0x6e, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x48, 0x74, 0x74, 0x70, 0x4d, - 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x12, 0x3e, 0x0a, 0x16, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x5f, - 0x65, 0x78, 0x74, 0x65, 0x6e, 0x64, 0x65, 0x64, 0x5f, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, - 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x42, 0x08, 0xd2, 0xc6, 0xa4, 0xe1, 0x06, 0x02, 0x08, 0x01, - 0x52, 0x14, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x64, 0x65, 0x64, 0x43, - 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x12, 0x25, 0x0a, 0x0e, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x5f, - 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x18, 0x06, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0d, - 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x22, 0x9b, 0x01, - 0x0a, 0x1a, 0x53, 0x63, 0x68, 0x65, 0x6d, 0x65, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x54, 0x72, - 0x61, 0x6e, 0x73, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x44, 0x0a, 0x13, - 0x73, 0x63, 0x68, 0x65, 0x6d, 0x65, 0x5f, 0x74, 0x6f, 0x5f, 0x6f, 0x76, 0x65, 0x72, 0x77, 0x72, - 0x69, 0x74, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x12, 0xfa, 0x42, 0x0f, 0x72, 0x0d, - 0x52, 0x04, 0x68, 0x74, 0x74, 0x70, 0x52, 0x05, 0x68, 0x74, 0x74, 0x70, 0x73, 0x48, 0x00, 0x52, - 0x11, 0x73, 0x63, 0x68, 0x65, 0x6d, 0x65, 0x54, 0x6f, 0x4f, 0x76, 0x65, 0x72, 0x77, 0x72, 0x69, - 0x74, 0x65, 0x12, 0x25, 0x0a, 0x0e, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x5f, 0x75, 0x70, 0x73, 0x74, - 0x72, 0x65, 0x61, 0x6d, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0d, 0x6d, 0x61, 0x74, 0x63, - 0x68, 0x55, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x42, 0x10, 0x0a, 0x0e, 0x74, 0x72, 0x61, - 0x6e, 0x73, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x81, 0x01, 0xba, 0x80, - 0xc8, 0xd1, 0x06, 0x02, 0x10, 0x02, 0x0a, 0x22, 0x69, 0x6f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, - 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x42, 0x0d, 0x50, 0x72, 0x6f, 0x74, - 0x6f, 0x63, 0x6f, 0x6c, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x42, 0x67, 0x69, 0x74, - 0x68, 0x75, 0x62, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, - 0x78, 0x79, 0x2f, 0x67, 0x6f, 0x2d, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x2d, 0x70, 0x6c, - 0x61, 0x6e, 0x65, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x2f, 0x63, 0x6f, 0x72, 0x65, 0x2f, 0x76, 0x33, 0x3b, 0x63, 0x6f, 0x72, 0x65, 0x76, 0x33, 0x62, - 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x75, 0x65, 0x42, 0x10, 0xfa, 0x42, 0x0d, 0x8a, 0x01, 0x02, 0x10, 0x01, 0x2a, 0x06, 0x18, 0xff, + 0xff, 0x03, 0x28, 0x00, 0x52, 0x0a, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x65, 0x72, + 0x12, 0x3c, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x08, 0xfa, + 0x42, 0x05, 0x8a, 0x01, 0x02, 0x10, 0x01, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x3f, + 0x9a, 0xc5, 0x88, 0x1e, 0x3a, 0x0a, 0x38, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, + 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x32, 0x50, 0x72, + 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x53, 0x65, + 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x3a, + 0x2d, 0x9a, 0xc5, 0x88, 0x1e, 0x28, 0x0a, 0x26, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, + 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x48, 0x74, 0x74, 0x70, 0x32, 0x50, + 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x22, 0xa5, + 0x01, 0x0a, 0x13, 0x47, 0x72, 0x70, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, + 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x60, 0x0a, 0x16, 0x68, 0x74, 0x74, 0x70, 0x32, 0x5f, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x48, 0x74, + 0x74, 0x70, 0x32, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, + 0x6e, 0x73, 0x52, 0x14, 0x68, 0x74, 0x74, 0x70, 0x32, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, + 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x3a, 0x2c, 0x9a, 0xc5, 0x88, 0x1e, 0x27, 0x0a, + 0x25, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x63, 0x6f, + 0x72, 0x65, 0x2e, 0x47, 0x72, 0x70, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, + 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x22, 0xd8, 0x02, 0x0a, 0x14, 0x48, 0x74, 0x74, 0x70, 0x33, + 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, + 0x5d, 0x0a, 0x15, 0x71, 0x75, 0x69, 0x63, 0x5f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, + 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x29, + 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, + 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x51, 0x75, 0x69, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, + 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x13, 0x71, 0x75, 0x69, 0x63, 0x50, + 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x7a, + 0x0a, 0x2d, 0x6f, 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, 0x65, 0x5f, 0x73, 0x74, 0x72, 0x65, 0x61, + 0x6d, 0x5f, 0x65, 0x72, 0x72, 0x6f, 0x72, 0x5f, 0x6f, 0x6e, 0x5f, 0x69, 0x6e, 0x76, 0x61, 0x6c, + 0x69, 0x64, 0x5f, 0x68, 0x74, 0x74, 0x70, 0x5f, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x18, + 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, + 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, + 0x65, 0x52, 0x27, 0x6f, 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, 0x65, 0x53, 0x74, 0x72, 0x65, 0x61, + 0x6d, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x4f, 0x6e, 0x49, 0x6e, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x48, + 0x74, 0x74, 0x70, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x12, 0x3e, 0x0a, 0x16, 0x61, 0x6c, + 0x6c, 0x6f, 0x77, 0x5f, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x64, 0x65, 0x64, 0x5f, 0x63, 0x6f, 0x6e, + 0x6e, 0x65, 0x63, 0x74, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x42, 0x08, 0xd2, 0xc6, 0xa4, 0xe1, + 0x06, 0x02, 0x08, 0x01, 0x52, 0x14, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x45, 0x78, 0x74, 0x65, 0x6e, + 0x64, 0x65, 0x64, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x12, 0x25, 0x0a, 0x0e, 0x61, 0x6c, + 0x6c, 0x6f, 0x77, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x18, 0x06, 0x20, 0x01, + 0x28, 0x08, 0x52, 0x0d, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, + 0x61, 0x22, 0x9b, 0x01, 0x0a, 0x1a, 0x53, 0x63, 0x68, 0x65, 0x6d, 0x65, 0x48, 0x65, 0x61, 0x64, + 0x65, 0x72, 0x54, 0x72, 0x61, 0x6e, 0x73, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x12, 0x44, 0x0a, 0x13, 0x73, 0x63, 0x68, 0x65, 0x6d, 0x65, 0x5f, 0x74, 0x6f, 0x5f, 0x6f, 0x76, + 0x65, 0x72, 0x77, 0x72, 0x69, 0x74, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x12, 0xfa, + 0x42, 0x0f, 0x72, 0x0d, 0x52, 0x04, 0x68, 0x74, 0x74, 0x70, 0x52, 0x05, 0x68, 0x74, 0x74, 0x70, + 0x73, 0x48, 0x00, 0x52, 0x11, 0x73, 0x63, 0x68, 0x65, 0x6d, 0x65, 0x54, 0x6f, 0x4f, 0x76, 0x65, + 0x72, 0x77, 0x72, 0x69, 0x74, 0x65, 0x12, 0x25, 0x0a, 0x0e, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x5f, + 0x75, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0d, + 0x6d, 0x61, 0x74, 0x63, 0x68, 0x55, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x42, 0x10, 0x0a, + 0x0e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, + 0x81, 0x01, 0xba, 0x80, 0xc8, 0xd1, 0x06, 0x02, 0x10, 0x02, 0x0a, 0x22, 0x69, 0x6f, 0x2e, 0x65, + 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, + 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x42, 0x0d, + 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, + 0x42, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x65, 0x6e, 0x76, 0x6f, + 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2f, 0x67, 0x6f, 0x2d, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, + 0x6c, 0x2d, 0x70, 0x6c, 0x61, 0x6e, 0x65, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x63, 0x6f, + 0x6e, 0x66, 0x69, 0x67, 0x2f, 0x63, 0x6f, 0x72, 0x65, 0x2f, 0x76, 0x33, 0x3b, 0x63, 0x6f, 0x72, + 0x65, 0x76, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/protocol.pb.validate.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/protocol.pb.validate.go index 1b7d8342dd8dc..68aa9e21328e6 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/protocol.pb.validate.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/protocol.pb.validate.go @@ -160,34 +160,32 @@ func (m *QuicKeepAliveSettings) validate(all bool) error { var errors []error - if d := m.GetMaxInterval(); d != nil { - dur, err := d.AsDuration(), d.CheckValid() - if err != nil { - err = QuicKeepAliveSettingsValidationError{ - field: "MaxInterval", - reason: "value is not a valid duration", - cause: err, - } - if !all { - return err + if all { + switch v := interface{}(m.GetMaxInterval()).(type) { + case interface{ ValidateAll() error }: + if err := v.ValidateAll(); err != nil { + errors = append(errors, QuicKeepAliveSettingsValidationError{ + field: "MaxInterval", + reason: "embedded message failed validation", + cause: err, + }) } - errors = append(errors, err) - } else { - - lte := time.Duration(0*time.Second + 0*time.Nanosecond) - gte := time.Duration(1*time.Second + 0*time.Nanosecond) - - if dur > lte && dur < gte { - err := QuicKeepAliveSettingsValidationError{ + case interface{ Validate() error }: + if err := v.Validate(); err != nil { + errors = append(errors, QuicKeepAliveSettingsValidationError{ field: "MaxInterval", - reason: "value must be outside range (0s, 1s)", - } - if !all { - return err - } - errors = append(errors, err) + reason: "embedded message failed validation", + cause: err, + }) + } + } + } else if v, ok := interface{}(m.GetMaxInterval()).(interface{ Validate() error }); ok { + if err := v.Validate(); err != nil { + return QuicKeepAliveSettingsValidationError{ + field: "MaxInterval", + reason: "embedded message failed validation", + cause: err, } - } } @@ -206,12 +204,12 @@ func (m *QuicKeepAliveSettings) validate(all bool) error { } else { lte := time.Duration(0*time.Second + 0*time.Nanosecond) - gte := time.Duration(1*time.Second + 0*time.Nanosecond) + gte := time.Duration(0*time.Second + 1000000*time.Nanosecond) if dur > lte && dur < gte { err := QuicKeepAliveSettingsValidationError{ field: "InitialInterval", - reason: "value must be outside range (0s, 1s)", + reason: "value must be outside range (0s, 1ms)", } if !all { return err diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/proxy_protocol.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/proxy_protocol.pb.go index 43e7d77061881..e6f9df9f4957c 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/proxy_protocol.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/proxy_protocol.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/core/v3/proxy_protocol.proto package corev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/resolver.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/resolver.pb.go index fc4ec52de9ce2..5f98f12b031b1 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/resolver.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/resolver.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/core/v3/resolver.proto package corev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/socket_cmsg_headers.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/socket_cmsg_headers.pb.go index 769e2f4548ef8..441da590762c3 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/socket_cmsg_headers.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/socket_cmsg_headers.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/core/v3/socket_cmsg_headers.proto package corev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/socket_option.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/socket_option.pb.go index 2b684f57b67d3..d5f0d9fbf5d04 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/socket_option.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/socket_option.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/core/v3/socket_option.proto package corev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/substitution_format_string.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/substitution_format_string.pb.go index 8c7fda3a1a4c0..c1856cbb16121 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/substitution_format_string.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/substitution_format_string.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/core/v3/substitution_format_string.proto package corev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/udp_socket_config.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/udp_socket_config.pb.go index ebef4e6425446..9b8bc974a8a68 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/udp_socket_config.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/core/v3/udp_socket_config.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/core/v3/udp_socket_config.proto package corev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/endpoint/v3/endpoint.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/endpoint/v3/endpoint.pb.go index 96122a01d0577..108951e317cdf 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/endpoint/v3/endpoint.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/endpoint/v3/endpoint.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/endpoint/v3/endpoint.proto package endpointv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/endpoint/v3/endpoint_components.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/endpoint/v3/endpoint_components.pb.go index 4cff3e6df0568..3757fe9955149 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/endpoint/v3/endpoint_components.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/endpoint/v3/endpoint_components.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/endpoint/v3/endpoint_components.proto package endpointv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/endpoint/v3/load_report.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/endpoint/v3/load_report.pb.go index 07d96da4966a3..60c8d2f506dff 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/endpoint/v3/load_report.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/endpoint/v3/load_report.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/endpoint/v3/load_report.proto package endpointv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/api_listener.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/api_listener.pb.go index 1adc7d96f46e9..e65d3b5ea2dd6 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/api_listener.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/api_listener.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/listener/v3/api_listener.proto package listenerv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/listener.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/listener.pb.go index c639e62b1cd33..9b52e02b4c2e0 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/listener.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/listener.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/listener/v3/listener.proto package listenerv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/listener_components.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/listener_components.pb.go index b6dad7e30b4be..2652709eab424 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/listener_components.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/listener_components.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/listener/v3/listener_components.proto package listenerv3 @@ -461,10 +461,6 @@ type FilterChain struct { // ` // requires that filter chains are uniquely named within a listener. Name string `protobuf:"bytes,7,opt,name=name,proto3" json:"name,omitempty"` - // [#not-implemented-hide:] The configuration to specify whether the filter chain will be built on-demand. - // If this field is not empty, the filter chain will be built on-demand. - // Otherwise, the filter chain will be built normally and block listener warming. - OnDemandConfiguration *FilterChain_OnDemandConfiguration `protobuf:"bytes,8,opt,name=on_demand_configuration,json=onDemandConfiguration,proto3" json:"on_demand_configuration,omitempty"` } func (x *FilterChain) Reset() { @@ -549,13 +545,6 @@ func (x *FilterChain) GetName() string { return "" } -func (x *FilterChain) GetOnDemandConfiguration() *FilterChain_OnDemandConfiguration { - if x != nil { - return x.OnDemandConfiguration - } - return nil -} - // Listener filter chain match configuration. This is a recursive structure which allows complex // nested match configurations to be built using various logical operators. // @@ -823,64 +812,6 @@ func (*ListenerFilter_TypedConfig) isListenerFilter_ConfigType() {} func (*ListenerFilter_ConfigDiscovery) isListenerFilter_ConfigType() {} -// The configuration for on-demand filter chain. If this field is not empty in FilterChain message, -// a filter chain will be built on-demand. -// On-demand filter chains help speedup the warming up of listeners since the building and initialization of -// an on-demand filter chain will be postponed to the arrival of new connection requests that require this filter chain. -// Filter chains that are not often used can be set as on-demand. -type FilterChain_OnDemandConfiguration struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - // The timeout to wait for filter chain placeholders to complete rebuilding. - // 1. If this field is set to 0, timeout is disabled. - // 2. If not specified, a default timeout of 15s is used. - // Rebuilding will wait until dependencies are ready, have failed, or this timeout is reached. - // Upon failure or timeout, all connections related to this filter chain will be closed. - // Rebuilding will start again on the next new connection. - RebuildTimeout *durationpb.Duration `protobuf:"bytes,1,opt,name=rebuild_timeout,json=rebuildTimeout,proto3" json:"rebuild_timeout,omitempty"` -} - -func (x *FilterChain_OnDemandConfiguration) Reset() { - *x = FilterChain_OnDemandConfiguration{} - if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_listener_v3_listener_components_proto_msgTypes[5] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *FilterChain_OnDemandConfiguration) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*FilterChain_OnDemandConfiguration) ProtoMessage() {} - -func (x *FilterChain_OnDemandConfiguration) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_listener_v3_listener_components_proto_msgTypes[5] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use FilterChain_OnDemandConfiguration.ProtoReflect.Descriptor instead. -func (*FilterChain_OnDemandConfiguration) Descriptor() ([]byte, []int) { - return file_envoy_config_listener_v3_listener_components_proto_rawDescGZIP(), []int{2, 0} -} - -func (x *FilterChain_OnDemandConfiguration) GetRebuildTimeout() *durationpb.Duration { - if x != nil { - return x.RebuildTimeout - } - return nil -} - // A set of match configurations used for logical operations. type ListenerFilterChainMatchPredicate_MatchSet struct { state protoimpl.MessageState @@ -894,7 +825,7 @@ type ListenerFilterChainMatchPredicate_MatchSet struct { func (x *ListenerFilterChainMatchPredicate_MatchSet) Reset() { *x = ListenerFilterChainMatchPredicate_MatchSet{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_listener_v3_listener_components_proto_msgTypes[6] + mi := &file_envoy_config_listener_v3_listener_components_proto_msgTypes[5] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -907,7 +838,7 @@ func (x *ListenerFilterChainMatchPredicate_MatchSet) String() string { func (*ListenerFilterChainMatchPredicate_MatchSet) ProtoMessage() {} func (x *ListenerFilterChainMatchPredicate_MatchSet) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_listener_v3_listener_components_proto_msgTypes[6] + mi := &file_envoy_config_listener_v3_listener_components_proto_msgTypes[5] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1031,7 +962,7 @@ var file_envoy_config_listener_v3_listener_components_proto_rawDesc = []byte{ 0x3a, 0x2d, 0x9a, 0xc5, 0x88, 0x1e, 0x28, 0x0a, 0x26, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x6c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x2e, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x43, 0x68, 0x61, 0x69, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x4a, - 0x04, 0x08, 0x01, 0x10, 0x02, 0x22, 0x89, 0x06, 0x0a, 0x0b, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, + 0x04, 0x08, 0x01, 0x10, 0x02, 0x22, 0xd6, 0x04, 0x0a, 0x0b, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x43, 0x68, 0x61, 0x69, 0x6e, 0x12, 0x58, 0x0a, 0x12, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x5f, 0x63, 0x68, 0x61, 0x69, 0x6e, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, @@ -1063,101 +994,90 @@ var file_envoy_config_listener_v3_listener_components_proto_rawDesc = []byte{ 0x1d, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x53, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, - 0x6d, 0x65, 0x12, 0x73, 0x0a, 0x17, 0x6f, 0x6e, 0x5f, 0x64, 0x65, 0x6d, 0x61, 0x6e, 0x64, 0x5f, - 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x08, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x3b, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x2e, 0x6c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x46, - 0x69, 0x6c, 0x74, 0x65, 0x72, 0x43, 0x68, 0x61, 0x69, 0x6e, 0x2e, 0x4f, 0x6e, 0x44, 0x65, 0x6d, - 0x61, 0x6e, 0x64, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x52, 0x15, 0x6f, 0x6e, 0x44, 0x65, 0x6d, 0x61, 0x6e, 0x64, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0x5b, 0x0a, 0x15, 0x4f, 0x6e, 0x44, 0x65, 0x6d, - 0x61, 0x6e, 0x64, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x12, 0x42, 0x0a, 0x0f, 0x72, 0x65, 0x62, 0x75, 0x69, 0x6c, 0x64, 0x5f, 0x74, 0x69, 0x6d, 0x65, - 0x6f, 0x75, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0e, 0x72, 0x65, 0x62, 0x75, 0x69, 0x6c, 0x64, 0x54, 0x69, 0x6d, - 0x65, 0x6f, 0x75, 0x74, 0x3a, 0x28, 0x9a, 0xc5, 0x88, 0x1e, 0x23, 0x0a, 0x21, 0x65, 0x6e, 0x76, - 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x6c, 0x69, 0x73, 0x74, 0x65, 0x6e, - 0x65, 0x72, 0x2e, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x43, 0x68, 0x61, 0x69, 0x6e, 0x4a, 0x04, - 0x08, 0x02, 0x10, 0x03, 0x52, 0x0b, 0x74, 0x6c, 0x73, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x78, - 0x74, 0x22, 0xc2, 0x05, 0x0a, 0x21, 0x4c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x46, 0x69, + 0x6d, 0x65, 0x3a, 0x28, 0x9a, 0xc5, 0x88, 0x1e, 0x23, 0x0a, 0x21, 0x65, 0x6e, 0x76, 0x6f, 0x79, + 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x6c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, + 0x2e, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x43, 0x68, 0x61, 0x69, 0x6e, 0x4a, 0x04, 0x08, 0x02, + 0x10, 0x03, 0x4a, 0x04, 0x08, 0x08, 0x10, 0x09, 0x52, 0x0b, 0x74, 0x6c, 0x73, 0x5f, 0x63, 0x6f, + 0x6e, 0x74, 0x65, 0x78, 0x74, 0x52, 0x17, 0x6f, 0x6e, 0x5f, 0x64, 0x65, 0x6d, 0x61, 0x6e, 0x64, + 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0xc2, + 0x05, 0x0a, 0x21, 0x4c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x46, 0x69, 0x6c, 0x74, 0x65, + 0x72, 0x43, 0x68, 0x61, 0x69, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x50, 0x72, 0x65, 0x64, 0x69, + 0x63, 0x61, 0x74, 0x65, 0x12, 0x61, 0x0a, 0x08, 0x6f, 0x72, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x44, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x6c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x2e, 0x76, + 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, + 0x43, 0x68, 0x61, 0x69, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x50, 0x72, 0x65, 0x64, 0x69, 0x63, + 0x61, 0x74, 0x65, 0x2e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x53, 0x65, 0x74, 0x48, 0x00, 0x52, 0x07, + 0x6f, 0x72, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x63, 0x0a, 0x09, 0x61, 0x6e, 0x64, 0x5f, 0x6d, + 0x61, 0x74, 0x63, 0x68, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x44, 0x2e, 0x65, 0x6e, 0x76, + 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x6c, 0x69, 0x73, 0x74, 0x65, 0x6e, + 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x43, 0x68, 0x61, 0x69, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x50, 0x72, - 0x65, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x12, 0x61, 0x0a, 0x08, 0x6f, 0x72, 0x5f, 0x6d, 0x61, - 0x74, 0x63, 0x68, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x44, 0x2e, 0x65, 0x6e, 0x76, 0x6f, - 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x6c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, - 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x46, 0x69, 0x6c, + 0x65, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x2e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x53, 0x65, 0x74, + 0x48, 0x00, 0x52, 0x08, 0x61, 0x6e, 0x64, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x5a, 0x0a, 0x09, + 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x3b, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x6c, + 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x65, + 0x6e, 0x65, 0x72, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x43, 0x68, 0x61, 0x69, 0x6e, 0x4d, 0x61, + 0x74, 0x63, 0x68, 0x50, 0x72, 0x65, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x48, 0x00, 0x52, 0x08, + 0x6e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x26, 0x0a, 0x09, 0x61, 0x6e, 0x79, 0x5f, + 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x04, 0x20, 0x01, 0x28, 0x08, 0x42, 0x07, 0xfa, 0x42, 0x04, + 0x6a, 0x02, 0x08, 0x01, 0x48, 0x00, 0x52, 0x08, 0x61, 0x6e, 0x79, 0x4d, 0x61, 0x74, 0x63, 0x68, + 0x12, 0x51, 0x0a, 0x16, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, + 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x19, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x76, 0x33, + 0x2e, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x48, 0x00, 0x52, 0x14, 0x64, + 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x6f, 0x72, 0x74, 0x52, 0x61, + 0x6e, 0x67, 0x65, 0x1a, 0xb0, 0x01, 0x0a, 0x08, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x53, 0x65, 0x74, + 0x12, 0x5b, 0x0a, 0x05, 0x72, 0x75, 0x6c, 0x65, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, + 0x3b, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x6c, + 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x65, + 0x6e, 0x65, 0x72, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x43, 0x68, 0x61, 0x69, 0x6e, 0x4d, 0x61, + 0x74, 0x63, 0x68, 0x50, 0x72, 0x65, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x42, 0x08, 0xfa, 0x42, + 0x05, 0x92, 0x01, 0x02, 0x08, 0x02, 0x52, 0x05, 0x72, 0x75, 0x6c, 0x65, 0x73, 0x3a, 0x47, 0x9a, + 0xc5, 0x88, 0x1e, 0x42, 0x0a, 0x40, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, + 0x76, 0x32, 0x2e, 0x6c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x2e, 0x4c, 0x69, 0x73, 0x74, + 0x65, 0x6e, 0x65, 0x72, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x43, 0x68, 0x61, 0x69, 0x6e, 0x4d, + 0x61, 0x74, 0x63, 0x68, 0x50, 0x72, 0x65, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x2e, 0x4d, 0x61, + 0x74, 0x63, 0x68, 0x53, 0x65, 0x74, 0x3a, 0x3e, 0x9a, 0xc5, 0x88, 0x1e, 0x39, 0x0a, 0x37, 0x65, + 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x6c, 0x69, 0x73, 0x74, + 0x65, 0x6e, 0x65, 0x72, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x43, 0x68, 0x61, 0x69, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x50, 0x72, 0x65, - 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x2e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x53, 0x65, 0x74, 0x48, - 0x00, 0x52, 0x07, 0x6f, 0x72, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x63, 0x0a, 0x09, 0x61, 0x6e, - 0x64, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x44, 0x2e, - 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x6c, 0x69, 0x73, - 0x74, 0x65, 0x6e, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, - 0x72, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x43, 0x68, 0x61, 0x69, 0x6e, 0x4d, 0x61, 0x74, 0x63, - 0x68, 0x50, 0x72, 0x65, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x2e, 0x4d, 0x61, 0x74, 0x63, 0x68, - 0x53, 0x65, 0x74, 0x48, 0x00, 0x52, 0x08, 0x61, 0x6e, 0x64, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, - 0x5a, 0x0a, 0x09, 0x6e, 0x6f, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x03, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x3b, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x2e, 0x6c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, - 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x43, 0x68, 0x61, 0x69, - 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x50, 0x72, 0x65, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x48, - 0x00, 0x52, 0x08, 0x6e, 0x6f, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x26, 0x0a, 0x09, 0x61, - 0x6e, 0x79, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x04, 0x20, 0x01, 0x28, 0x08, 0x42, 0x07, - 0xfa, 0x42, 0x04, 0x6a, 0x02, 0x08, 0x01, 0x48, 0x00, 0x52, 0x08, 0x61, 0x6e, 0x79, 0x4d, 0x61, - 0x74, 0x63, 0x68, 0x12, 0x51, 0x0a, 0x16, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x5f, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x18, 0x05, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, - 0x2e, 0x76, 0x33, 0x2e, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x48, 0x00, - 0x52, 0x14, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x6f, 0x72, - 0x74, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x1a, 0xb0, 0x01, 0x0a, 0x08, 0x4d, 0x61, 0x74, 0x63, 0x68, - 0x53, 0x65, 0x74, 0x12, 0x5b, 0x0a, 0x05, 0x72, 0x75, 0x6c, 0x65, 0x73, 0x18, 0x01, 0x20, 0x03, - 0x28, 0x0b, 0x32, 0x3b, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x2e, 0x6c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, - 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x43, 0x68, 0x61, 0x69, - 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x50, 0x72, 0x65, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x42, - 0x08, 0xfa, 0x42, 0x05, 0x92, 0x01, 0x02, 0x08, 0x02, 0x52, 0x05, 0x72, 0x75, 0x6c, 0x65, 0x73, - 0x3a, 0x47, 0x9a, 0xc5, 0x88, 0x1e, 0x42, 0x0a, 0x40, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, - 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x6c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x2e, 0x4c, - 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x43, 0x68, 0x61, - 0x69, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x50, 0x72, 0x65, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, - 0x2e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x53, 0x65, 0x74, 0x3a, 0x3e, 0x9a, 0xc5, 0x88, 0x1e, 0x39, - 0x0a, 0x37, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x6c, - 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, - 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x43, 0x68, 0x61, 0x69, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, - 0x50, 0x72, 0x65, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x42, 0x0b, 0x0a, 0x04, 0x72, 0x75, 0x6c, - 0x65, 0x12, 0x03, 0xf8, 0x42, 0x01, 0x22, 0xf2, 0x02, 0x0a, 0x0e, 0x4c, 0x69, 0x73, 0x74, 0x65, - 0x6e, 0x65, 0x72, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, 0x1b, 0x0a, 0x04, 0x6e, 0x61, 0x6d, - 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, - 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x39, 0x0a, 0x0c, 0x74, 0x79, 0x70, 0x65, 0x64, 0x5f, - 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x14, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x41, - 0x6e, 0x79, 0x48, 0x00, 0x52, 0x0b, 0x74, 0x79, 0x70, 0x65, 0x64, 0x43, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x12, 0x58, 0x0a, 0x10, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x5f, 0x64, 0x69, 0x73, 0x63, - 0x6f, 0x76, 0x65, 0x72, 0x79, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2b, 0x2e, 0x65, 0x6e, - 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, - 0x76, 0x33, 0x2e, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x48, 0x00, 0x52, 0x0f, 0x63, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x44, 0x69, 0x73, 0x63, 0x6f, 0x76, 0x65, 0x72, 0x79, 0x12, 0x64, 0x0a, 0x0f, 0x66, - 0x69, 0x6c, 0x74, 0x65, 0x72, 0x5f, 0x64, 0x69, 0x73, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x04, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x3b, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x2e, 0x6c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, - 0x4c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x43, 0x68, - 0x61, 0x69, 0x6e, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x50, 0x72, 0x65, 0x64, 0x69, 0x63, 0x61, 0x74, - 0x65, 0x52, 0x0e, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x44, 0x69, 0x73, 0x61, 0x62, 0x6c, 0x65, - 0x64, 0x3a, 0x2b, 0x9a, 0xc5, 0x88, 0x1e, 0x26, 0x0a, 0x24, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, - 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x6c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x2e, - 0x4c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x42, 0x0d, - 0x0a, 0x0b, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x4a, 0x04, 0x08, - 0x02, 0x10, 0x03, 0x52, 0x06, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x42, 0x97, 0x01, 0xba, 0x80, - 0xc8, 0xd1, 0x06, 0x02, 0x10, 0x02, 0x0a, 0x26, 0x69, 0x6f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, - 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x2e, 0x6c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x42, 0x17, - 0x4c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x43, 0x6f, 0x6d, 0x70, 0x6f, 0x6e, 0x65, 0x6e, - 0x74, 0x73, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x4a, 0x67, 0x69, 0x74, 0x68, 0x75, - 0x62, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, - 0x2f, 0x67, 0x6f, 0x2d, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x2d, 0x70, 0x6c, 0x61, 0x6e, - 0x65, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2f, 0x6c, - 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x2f, 0x76, 0x33, 0x3b, 0x6c, 0x69, 0x73, 0x74, 0x65, - 0x6e, 0x65, 0x72, 0x76, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x42, 0x0b, 0x0a, 0x04, 0x72, 0x75, 0x6c, 0x65, 0x12, 0x03, + 0xf8, 0x42, 0x01, 0x22, 0xf2, 0x02, 0x0a, 0x0e, 0x4c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, + 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, 0x1b, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, + 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x04, 0x6e, + 0x61, 0x6d, 0x65, 0x12, 0x39, 0x0a, 0x0c, 0x74, 0x79, 0x70, 0x65, 0x64, 0x5f, 0x63, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x14, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x41, 0x6e, 0x79, 0x48, + 0x00, 0x52, 0x0b, 0x74, 0x79, 0x70, 0x65, 0x64, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x58, + 0x0a, 0x10, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x5f, 0x64, 0x69, 0x73, 0x63, 0x6f, 0x76, 0x65, + 0x72, 0x79, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2b, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, + 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, + 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x53, + 0x6f, 0x75, 0x72, 0x63, 0x65, 0x48, 0x00, 0x52, 0x0f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x44, + 0x69, 0x73, 0x63, 0x6f, 0x76, 0x65, 0x72, 0x79, 0x12, 0x64, 0x0a, 0x0f, 0x66, 0x69, 0x6c, 0x74, + 0x65, 0x72, 0x5f, 0x64, 0x69, 0x73, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x04, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x3b, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, + 0x2e, 0x6c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x69, 0x73, + 0x74, 0x65, 0x6e, 0x65, 0x72, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x43, 0x68, 0x61, 0x69, 0x6e, + 0x4d, 0x61, 0x74, 0x63, 0x68, 0x50, 0x72, 0x65, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x52, 0x0e, + 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x44, 0x69, 0x73, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x3a, 0x2b, + 0x9a, 0xc5, 0x88, 0x1e, 0x26, 0x0a, 0x24, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, + 0x2e, 0x76, 0x32, 0x2e, 0x6c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x2e, 0x4c, 0x69, 0x73, + 0x74, 0x65, 0x6e, 0x65, 0x72, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x42, 0x0d, 0x0a, 0x0b, 0x63, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x4a, 0x04, 0x08, 0x02, 0x10, 0x03, + 0x52, 0x06, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x42, 0x97, 0x01, 0xba, 0x80, 0xc8, 0xd1, 0x06, + 0x02, 0x10, 0x02, 0x0a, 0x26, 0x69, 0x6f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, + 0x78, 0x79, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, + 0x6c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x42, 0x17, 0x4c, 0x69, 0x73, + 0x74, 0x65, 0x6e, 0x65, 0x72, 0x43, 0x6f, 0x6d, 0x70, 0x6f, 0x6e, 0x65, 0x6e, 0x74, 0x73, 0x50, + 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x4a, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, 0x2e, 0x63, + 0x6f, 0x6d, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2f, 0x67, 0x6f, + 0x2d, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x2d, 0x70, 0x6c, 0x61, 0x6e, 0x65, 0x2f, 0x65, + 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2f, 0x6c, 0x69, 0x73, 0x74, + 0x65, 0x6e, 0x65, 0x72, 0x2f, 0x76, 0x33, 0x3b, 0x6c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, + 0x76, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( @@ -1173,7 +1093,7 @@ func file_envoy_config_listener_v3_listener_components_proto_rawDescGZIP() []byt } var file_envoy_config_listener_v3_listener_components_proto_enumTypes = make([]protoimpl.EnumInfo, 1) -var file_envoy_config_listener_v3_listener_components_proto_msgTypes = make([]protoimpl.MessageInfo, 7) +var file_envoy_config_listener_v3_listener_components_proto_msgTypes = make([]protoimpl.MessageInfo, 6) var file_envoy_config_listener_v3_listener_components_proto_goTypes = []interface{}{ (FilterChainMatch_ConnectionSourceType)(0), // 0: envoy.config.listener.v3.FilterChainMatch.ConnectionSourceType (*Filter)(nil), // 1: envoy.config.listener.v3.Filter @@ -1181,48 +1101,45 @@ var file_envoy_config_listener_v3_listener_components_proto_goTypes = []interfac (*FilterChain)(nil), // 3: envoy.config.listener.v3.FilterChain (*ListenerFilterChainMatchPredicate)(nil), // 4: envoy.config.listener.v3.ListenerFilterChainMatchPredicate (*ListenerFilter)(nil), // 5: envoy.config.listener.v3.ListenerFilter - (*FilterChain_OnDemandConfiguration)(nil), // 6: envoy.config.listener.v3.FilterChain.OnDemandConfiguration - (*ListenerFilterChainMatchPredicate_MatchSet)(nil), // 7: envoy.config.listener.v3.ListenerFilterChainMatchPredicate.MatchSet - (*anypb.Any)(nil), // 8: google.protobuf.Any - (*v3.ExtensionConfigSource)(nil), // 9: envoy.config.core.v3.ExtensionConfigSource - (*wrapperspb.UInt32Value)(nil), // 10: google.protobuf.UInt32Value - (*v3.CidrRange)(nil), // 11: envoy.config.core.v3.CidrRange - (*wrapperspb.BoolValue)(nil), // 12: google.protobuf.BoolValue - (*v3.Metadata)(nil), // 13: envoy.config.core.v3.Metadata - (*v3.TransportSocket)(nil), // 14: envoy.config.core.v3.TransportSocket - (*durationpb.Duration)(nil), // 15: google.protobuf.Duration - (*v31.Int32Range)(nil), // 16: envoy.type.v3.Int32Range + (*ListenerFilterChainMatchPredicate_MatchSet)(nil), // 6: envoy.config.listener.v3.ListenerFilterChainMatchPredicate.MatchSet + (*anypb.Any)(nil), // 7: google.protobuf.Any + (*v3.ExtensionConfigSource)(nil), // 8: envoy.config.core.v3.ExtensionConfigSource + (*wrapperspb.UInt32Value)(nil), // 9: google.protobuf.UInt32Value + (*v3.CidrRange)(nil), // 10: envoy.config.core.v3.CidrRange + (*wrapperspb.BoolValue)(nil), // 11: google.protobuf.BoolValue + (*v3.Metadata)(nil), // 12: envoy.config.core.v3.Metadata + (*v3.TransportSocket)(nil), // 13: envoy.config.core.v3.TransportSocket + (*durationpb.Duration)(nil), // 14: google.protobuf.Duration + (*v31.Int32Range)(nil), // 15: envoy.type.v3.Int32Range } var file_envoy_config_listener_v3_listener_components_proto_depIdxs = []int32{ - 8, // 0: envoy.config.listener.v3.Filter.typed_config:type_name -> google.protobuf.Any - 9, // 1: envoy.config.listener.v3.Filter.config_discovery:type_name -> envoy.config.core.v3.ExtensionConfigSource - 10, // 2: envoy.config.listener.v3.FilterChainMatch.destination_port:type_name -> google.protobuf.UInt32Value - 11, // 3: envoy.config.listener.v3.FilterChainMatch.prefix_ranges:type_name -> envoy.config.core.v3.CidrRange - 10, // 4: envoy.config.listener.v3.FilterChainMatch.suffix_len:type_name -> google.protobuf.UInt32Value - 11, // 5: envoy.config.listener.v3.FilterChainMatch.direct_source_prefix_ranges:type_name -> envoy.config.core.v3.CidrRange + 7, // 0: envoy.config.listener.v3.Filter.typed_config:type_name -> google.protobuf.Any + 8, // 1: envoy.config.listener.v3.Filter.config_discovery:type_name -> envoy.config.core.v3.ExtensionConfigSource + 9, // 2: envoy.config.listener.v3.FilterChainMatch.destination_port:type_name -> google.protobuf.UInt32Value + 10, // 3: envoy.config.listener.v3.FilterChainMatch.prefix_ranges:type_name -> envoy.config.core.v3.CidrRange + 9, // 4: envoy.config.listener.v3.FilterChainMatch.suffix_len:type_name -> google.protobuf.UInt32Value + 10, // 5: envoy.config.listener.v3.FilterChainMatch.direct_source_prefix_ranges:type_name -> envoy.config.core.v3.CidrRange 0, // 6: envoy.config.listener.v3.FilterChainMatch.source_type:type_name -> envoy.config.listener.v3.FilterChainMatch.ConnectionSourceType - 11, // 7: envoy.config.listener.v3.FilterChainMatch.source_prefix_ranges:type_name -> envoy.config.core.v3.CidrRange + 10, // 7: envoy.config.listener.v3.FilterChainMatch.source_prefix_ranges:type_name -> envoy.config.core.v3.CidrRange 2, // 8: envoy.config.listener.v3.FilterChain.filter_chain_match:type_name -> envoy.config.listener.v3.FilterChainMatch 1, // 9: envoy.config.listener.v3.FilterChain.filters:type_name -> envoy.config.listener.v3.Filter - 12, // 10: envoy.config.listener.v3.FilterChain.use_proxy_proto:type_name -> google.protobuf.BoolValue - 13, // 11: envoy.config.listener.v3.FilterChain.metadata:type_name -> envoy.config.core.v3.Metadata - 14, // 12: envoy.config.listener.v3.FilterChain.transport_socket:type_name -> envoy.config.core.v3.TransportSocket - 15, // 13: envoy.config.listener.v3.FilterChain.transport_socket_connect_timeout:type_name -> google.protobuf.Duration - 6, // 14: envoy.config.listener.v3.FilterChain.on_demand_configuration:type_name -> envoy.config.listener.v3.FilterChain.OnDemandConfiguration - 7, // 15: envoy.config.listener.v3.ListenerFilterChainMatchPredicate.or_match:type_name -> envoy.config.listener.v3.ListenerFilterChainMatchPredicate.MatchSet - 7, // 16: envoy.config.listener.v3.ListenerFilterChainMatchPredicate.and_match:type_name -> envoy.config.listener.v3.ListenerFilterChainMatchPredicate.MatchSet - 4, // 17: envoy.config.listener.v3.ListenerFilterChainMatchPredicate.not_match:type_name -> envoy.config.listener.v3.ListenerFilterChainMatchPredicate - 16, // 18: envoy.config.listener.v3.ListenerFilterChainMatchPredicate.destination_port_range:type_name -> envoy.type.v3.Int32Range - 8, // 19: envoy.config.listener.v3.ListenerFilter.typed_config:type_name -> google.protobuf.Any - 9, // 20: envoy.config.listener.v3.ListenerFilter.config_discovery:type_name -> envoy.config.core.v3.ExtensionConfigSource - 4, // 21: envoy.config.listener.v3.ListenerFilter.filter_disabled:type_name -> envoy.config.listener.v3.ListenerFilterChainMatchPredicate - 15, // 22: envoy.config.listener.v3.FilterChain.OnDemandConfiguration.rebuild_timeout:type_name -> google.protobuf.Duration - 4, // 23: envoy.config.listener.v3.ListenerFilterChainMatchPredicate.MatchSet.rules:type_name -> envoy.config.listener.v3.ListenerFilterChainMatchPredicate - 24, // [24:24] is the sub-list for method output_type - 24, // [24:24] is the sub-list for method input_type - 24, // [24:24] is the sub-list for extension type_name - 24, // [24:24] is the sub-list for extension extendee - 0, // [0:24] is the sub-list for field type_name + 11, // 10: envoy.config.listener.v3.FilterChain.use_proxy_proto:type_name -> google.protobuf.BoolValue + 12, // 11: envoy.config.listener.v3.FilterChain.metadata:type_name -> envoy.config.core.v3.Metadata + 13, // 12: envoy.config.listener.v3.FilterChain.transport_socket:type_name -> envoy.config.core.v3.TransportSocket + 14, // 13: envoy.config.listener.v3.FilterChain.transport_socket_connect_timeout:type_name -> google.protobuf.Duration + 6, // 14: envoy.config.listener.v3.ListenerFilterChainMatchPredicate.or_match:type_name -> envoy.config.listener.v3.ListenerFilterChainMatchPredicate.MatchSet + 6, // 15: envoy.config.listener.v3.ListenerFilterChainMatchPredicate.and_match:type_name -> envoy.config.listener.v3.ListenerFilterChainMatchPredicate.MatchSet + 4, // 16: envoy.config.listener.v3.ListenerFilterChainMatchPredicate.not_match:type_name -> envoy.config.listener.v3.ListenerFilterChainMatchPredicate + 15, // 17: envoy.config.listener.v3.ListenerFilterChainMatchPredicate.destination_port_range:type_name -> envoy.type.v3.Int32Range + 7, // 18: envoy.config.listener.v3.ListenerFilter.typed_config:type_name -> google.protobuf.Any + 8, // 19: envoy.config.listener.v3.ListenerFilter.config_discovery:type_name -> envoy.config.core.v3.ExtensionConfigSource + 4, // 20: envoy.config.listener.v3.ListenerFilter.filter_disabled:type_name -> envoy.config.listener.v3.ListenerFilterChainMatchPredicate + 4, // 21: envoy.config.listener.v3.ListenerFilterChainMatchPredicate.MatchSet.rules:type_name -> envoy.config.listener.v3.ListenerFilterChainMatchPredicate + 22, // [22:22] is the sub-list for method output_type + 22, // [22:22] is the sub-list for method input_type + 22, // [22:22] is the sub-list for extension type_name + 22, // [22:22] is the sub-list for extension extendee + 0, // [0:22] is the sub-list for field type_name } func init() { file_envoy_config_listener_v3_listener_components_proto_init() } @@ -1292,18 +1209,6 @@ func file_envoy_config_listener_v3_listener_components_proto_init() { } } file_envoy_config_listener_v3_listener_components_proto_msgTypes[5].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*FilterChain_OnDemandConfiguration); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_envoy_config_listener_v3_listener_components_proto_msgTypes[6].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*ListenerFilterChainMatchPredicate_MatchSet); i { case 0: return &v.state @@ -1337,7 +1242,7 @@ func file_envoy_config_listener_v3_listener_components_proto_init() { GoPackagePath: reflect.TypeOf(x{}).PkgPath(), RawDescriptor: file_envoy_config_listener_v3_listener_components_proto_rawDesc, NumEnums: 1, - NumMessages: 7, + NumMessages: 6, NumExtensions: 0, NumServices: 0, }, diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/listener_components.pb.validate.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/listener_components.pb.validate.go index 4a18f8b084ac1..6fd67372a1eeb 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/listener_components.pb.validate.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/listener_components.pb.validate.go @@ -712,35 +712,6 @@ func (m *FilterChain) validate(all bool) error { // no validation rules for Name - if all { - switch v := interface{}(m.GetOnDemandConfiguration()).(type) { - case interface{ ValidateAll() error }: - if err := v.ValidateAll(); err != nil { - errors = append(errors, FilterChainValidationError{ - field: "OnDemandConfiguration", - reason: "embedded message failed validation", - cause: err, - }) - } - case interface{ Validate() error }: - if err := v.Validate(); err != nil { - errors = append(errors, FilterChainValidationError{ - field: "OnDemandConfiguration", - reason: "embedded message failed validation", - cause: err, - }) - } - } - } else if v, ok := interface{}(m.GetOnDemandConfiguration()).(interface{ Validate() error }); ok { - if err := v.Validate(); err != nil { - return FilterChainValidationError{ - field: "OnDemandConfiguration", - reason: "embedded message failed validation", - cause: err, - } - } - } - if len(errors) > 0 { return FilterChainMultiError(errors) } @@ -1358,140 +1329,6 @@ var _ interface { ErrorName() string } = ListenerFilterValidationError{} -// Validate checks the field values on FilterChain_OnDemandConfiguration with -// the rules defined in the proto definition for this message. If any rules -// are violated, the first error encountered is returned, or nil if there are -// no violations. -func (m *FilterChain_OnDemandConfiguration) Validate() error { - return m.validate(false) -} - -// ValidateAll checks the field values on FilterChain_OnDemandConfiguration -// with the rules defined in the proto definition for this message. If any -// rules are violated, the result is a list of violation errors wrapped in -// FilterChain_OnDemandConfigurationMultiError, or nil if none found. -func (m *FilterChain_OnDemandConfiguration) ValidateAll() error { - return m.validate(true) -} - -func (m *FilterChain_OnDemandConfiguration) validate(all bool) error { - if m == nil { - return nil - } - - var errors []error - - if all { - switch v := interface{}(m.GetRebuildTimeout()).(type) { - case interface{ ValidateAll() error }: - if err := v.ValidateAll(); err != nil { - errors = append(errors, FilterChain_OnDemandConfigurationValidationError{ - field: "RebuildTimeout", - reason: "embedded message failed validation", - cause: err, - }) - } - case interface{ Validate() error }: - if err := v.Validate(); err != nil { - errors = append(errors, FilterChain_OnDemandConfigurationValidationError{ - field: "RebuildTimeout", - reason: "embedded message failed validation", - cause: err, - }) - } - } - } else if v, ok := interface{}(m.GetRebuildTimeout()).(interface{ Validate() error }); ok { - if err := v.Validate(); err != nil { - return FilterChain_OnDemandConfigurationValidationError{ - field: "RebuildTimeout", - reason: "embedded message failed validation", - cause: err, - } - } - } - - if len(errors) > 0 { - return FilterChain_OnDemandConfigurationMultiError(errors) - } - - return nil -} - -// FilterChain_OnDemandConfigurationMultiError is an error wrapping multiple -// validation errors returned by -// FilterChain_OnDemandConfiguration.ValidateAll() if the designated -// constraints aren't met. -type FilterChain_OnDemandConfigurationMultiError []error - -// Error returns a concatenation of all the error messages it wraps. -func (m FilterChain_OnDemandConfigurationMultiError) Error() string { - var msgs []string - for _, err := range m { - msgs = append(msgs, err.Error()) - } - return strings.Join(msgs, "; ") -} - -// AllErrors returns a list of validation violation errors. -func (m FilterChain_OnDemandConfigurationMultiError) AllErrors() []error { return m } - -// FilterChain_OnDemandConfigurationValidationError is the validation error -// returned by FilterChain_OnDemandConfiguration.Validate if the designated -// constraints aren't met. -type FilterChain_OnDemandConfigurationValidationError struct { - field string - reason string - cause error - key bool -} - -// Field function returns field value. -func (e FilterChain_OnDemandConfigurationValidationError) Field() string { return e.field } - -// Reason function returns reason value. -func (e FilterChain_OnDemandConfigurationValidationError) Reason() string { return e.reason } - -// Cause function returns cause value. -func (e FilterChain_OnDemandConfigurationValidationError) Cause() error { return e.cause } - -// Key function returns key value. -func (e FilterChain_OnDemandConfigurationValidationError) Key() bool { return e.key } - -// ErrorName returns error name. -func (e FilterChain_OnDemandConfigurationValidationError) ErrorName() string { - return "FilterChain_OnDemandConfigurationValidationError" -} - -// Error satisfies the builtin error interface -func (e FilterChain_OnDemandConfigurationValidationError) Error() string { - cause := "" - if e.cause != nil { - cause = fmt.Sprintf(" | caused by: %v", e.cause) - } - - key := "" - if e.key { - key = "key for " - } - - return fmt.Sprintf( - "invalid %sFilterChain_OnDemandConfiguration.%s: %s%s", - key, - e.field, - e.reason, - cause) -} - -var _ error = FilterChain_OnDemandConfigurationValidationError{} - -var _ interface { - Field() string - Reason() string - Key() bool - Cause() error - ErrorName() string -} = FilterChain_OnDemandConfigurationValidationError{} - // Validate checks the field values on // ListenerFilterChainMatchPredicate_MatchSet with the rules defined in the // proto definition for this message. If any rules are violated, the first diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/listener_components_vtproto.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/listener_components_vtproto.pb.go index 7896458b8a8c9..c0f1bcca5e276 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/listener_components_vtproto.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/listener_components_vtproto.pb.go @@ -316,49 +316,6 @@ func (m *FilterChainMatch) MarshalToSizedBufferVTStrict(dAtA []byte) (int, error return len(dAtA) - i, nil } -func (m *FilterChain_OnDemandConfiguration) MarshalVTStrict() (dAtA []byte, err error) { - if m == nil { - return nil, nil - } - size := m.SizeVT() - dAtA = make([]byte, size) - n, err := m.MarshalToSizedBufferVTStrict(dAtA[:size]) - if err != nil { - return nil, err - } - return dAtA[:n], nil -} - -func (m *FilterChain_OnDemandConfiguration) MarshalToVTStrict(dAtA []byte) (int, error) { - size := m.SizeVT() - return m.MarshalToSizedBufferVTStrict(dAtA[:size]) -} - -func (m *FilterChain_OnDemandConfiguration) MarshalToSizedBufferVTStrict(dAtA []byte) (int, error) { - if m == nil { - return 0, nil - } - i := len(dAtA) - _ = i - var l int - _ = l - if m.unknownFields != nil { - i -= len(m.unknownFields) - copy(dAtA[i:], m.unknownFields) - } - if m.RebuildTimeout != nil { - size, err := (*durationpb.Duration)(m.RebuildTimeout).MarshalToSizedBufferVTStrict(dAtA[:i]) - if err != nil { - return 0, err - } - i -= size - i = protohelpers.EncodeVarint(dAtA, i, uint64(size)) - i-- - dAtA[i] = 0xa - } - return len(dAtA) - i, nil -} - func (m *FilterChain) MarshalVTStrict() (dAtA []byte, err error) { if m == nil { return nil, nil @@ -399,16 +356,6 @@ func (m *FilterChain) MarshalToSizedBufferVTStrict(dAtA []byte) (int, error) { i-- dAtA[i] = 0x4a } - if m.OnDemandConfiguration != nil { - size, err := m.OnDemandConfiguration.MarshalToSizedBufferVTStrict(dAtA[:i]) - if err != nil { - return 0, err - } - i -= size - i = protohelpers.EncodeVarint(dAtA, i, uint64(size)) - i-- - dAtA[i] = 0x42 - } if len(m.Name) > 0 { i -= len(m.Name) copy(dAtA[i:], m.Name) @@ -986,20 +933,6 @@ func (m *FilterChainMatch) SizeVT() (n int) { return n } -func (m *FilterChain_OnDemandConfiguration) SizeVT() (n int) { - if m == nil { - return 0 - } - var l int - _ = l - if m.RebuildTimeout != nil { - l = (*durationpb.Duration)(m.RebuildTimeout).SizeVT() - n += 1 + l + protohelpers.SizeOfVarint(uint64(l)) - } - n += len(m.unknownFields) - return n -} - func (m *FilterChain) SizeVT() (n int) { if m == nil { return 0 @@ -1044,10 +977,6 @@ func (m *FilterChain) SizeVT() (n int) { if l > 0 { n += 1 + l + protohelpers.SizeOfVarint(uint64(l)) } - if m.OnDemandConfiguration != nil { - l = m.OnDemandConfiguration.SizeVT() - n += 1 + l + protohelpers.SizeOfVarint(uint64(l)) - } if m.TransportSocketConnectTimeout != nil { l = (*durationpb.Duration)(m.TransportSocketConnectTimeout).SizeVT() n += 1 + l + protohelpers.SizeOfVarint(uint64(l)) diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/quic_config.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/quic_config.pb.go index ea97b5987e56a..609e75bc34ca5 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/quic_config.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/quic_config.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/listener/v3/quic_config.proto package listenerv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/udp_listener_config.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/udp_listener_config.pb.go index a5fb162223876..dfb57b46533d3 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/udp_listener_config.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/listener/v3/udp_listener_config.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/listener/v3/udp_listener_config.proto package listenerv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/metrics/v3/metrics_service.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/metrics/v3/metrics_service.pb.go index 7ff4dff1654b4..9fd2f54daf710 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/metrics/v3/metrics_service.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/metrics/v3/metrics_service.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/metrics/v3/metrics_service.proto package metricsv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/metrics/v3/stats.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/metrics/v3/stats.pb.go index 026899002820c..fb82790f0a897 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/metrics/v3/stats.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/metrics/v3/stats.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/metrics/v3/stats.proto package metricsv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/overload/v3/overload.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/overload/v3/overload.pb.go index 6feac91299608..f31b02b6ab5b4 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/overload/v3/overload.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/overload/v3/overload.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/overload/v3/overload.proto package overloadv3 @@ -44,6 +44,11 @@ const ( // This affects the value of // :ref:`FilterChain.transport_socket_connect_timeout `. ScaleTimersOverloadActionConfig_TRANSPORT_SOCKET_CONNECT ScaleTimersOverloadActionConfig_TimerType = 3 + // Adjusts the max connection duration timer for downstream HTTP connections. + // This affects the value of + // :ref:`HttpConnectionManager.common_http_protocol_options.max_connection_duration + // `. + ScaleTimersOverloadActionConfig_HTTP_DOWNSTREAM_CONNECTION_MAX ScaleTimersOverloadActionConfig_TimerType = 4 ) // Enum value maps for ScaleTimersOverloadActionConfig_TimerType. @@ -53,12 +58,14 @@ var ( 1: "HTTP_DOWNSTREAM_CONNECTION_IDLE", 2: "HTTP_DOWNSTREAM_STREAM_IDLE", 3: "TRANSPORT_SOCKET_CONNECT", + 4: "HTTP_DOWNSTREAM_CONNECTION_MAX", } ScaleTimersOverloadActionConfig_TimerType_value = map[string]int32{ "UNSPECIFIED": 0, "HTTP_DOWNSTREAM_CONNECTION_IDLE": 1, "HTTP_DOWNSTREAM_STREAM_IDLE": 2, "TRANSPORT_SOCKET_CONNECT": 3, + "HTTP_DOWNSTREAM_CONNECTION_MAX": 4, } ) @@ -867,7 +874,7 @@ var file_envoy_config_overload_v3_overload_proto_rawDesc = []byte{ 0x2e, 0x6f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x2e, 0x76, 0x32, 0x61, 0x6c, 0x70, 0x68, 0x61, 0x2e, 0x54, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x42, 0x14, 0x0a, 0x0d, 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x5f, 0x6f, 0x6e, 0x65, 0x6f, 0x66, 0x12, 0x03, 0xf8, 0x42, 0x01, 0x22, - 0xa7, 0x04, 0x0a, 0x1f, 0x53, 0x63, 0x61, 0x6c, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x72, 0x73, 0x4f, + 0xcb, 0x04, 0x0a, 0x1f, 0x53, 0x63, 0x61, 0x6c, 0x65, 0x54, 0x69, 0x6d, 0x65, 0x72, 0x73, 0x4f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x7e, 0x0a, 0x13, 0x74, 0x69, 0x6d, 0x65, 0x72, 0x5f, 0x73, 0x63, 0x61, 0x6c, 0x65, 0x5f, 0x66, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, @@ -893,7 +900,7 @@ var file_envoy_config_overload_v3_overload_proto_rawDesc = []byte{ 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74, 0x48, 0x00, 0x52, 0x08, 0x6d, 0x69, 0x6e, 0x53, 0x63, 0x61, 0x6c, 0x65, 0x42, 0x16, 0x0a, 0x0f, 0x6f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x61, 0x64, 0x6a, 0x75, 0x73, - 0x74, 0x12, 0x03, 0xf8, 0x42, 0x01, 0x22, 0x80, 0x01, 0x0a, 0x09, 0x54, 0x69, 0x6d, 0x65, 0x72, + 0x74, 0x12, 0x03, 0xf8, 0x42, 0x01, 0x22, 0xa4, 0x01, 0x0a, 0x09, 0x54, 0x69, 0x6d, 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, 0x12, 0x0f, 0x0a, 0x0b, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x23, 0x0a, 0x1f, 0x48, 0x54, 0x54, 0x50, 0x5f, 0x44, 0x4f, 0x57, 0x4e, 0x53, 0x54, 0x52, 0x45, 0x41, 0x4d, 0x5f, 0x43, 0x4f, 0x4e, 0x4e, 0x45, 0x43, 0x54, @@ -901,76 +908,78 @@ var file_envoy_config_overload_v3_overload_proto_rawDesc = []byte{ 0x54, 0x50, 0x5f, 0x44, 0x4f, 0x57, 0x4e, 0x53, 0x54, 0x52, 0x45, 0x41, 0x4d, 0x5f, 0x53, 0x54, 0x52, 0x45, 0x41, 0x4d, 0x5f, 0x49, 0x44, 0x4c, 0x45, 0x10, 0x02, 0x12, 0x1c, 0x0a, 0x18, 0x54, 0x52, 0x41, 0x4e, 0x53, 0x50, 0x4f, 0x52, 0x54, 0x5f, 0x53, 0x4f, 0x43, 0x4b, 0x45, 0x54, 0x5f, - 0x43, 0x4f, 0x4e, 0x4e, 0x45, 0x43, 0x54, 0x10, 0x03, 0x22, 0xe4, 0x01, 0x0a, 0x0e, 0x4f, 0x76, - 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1b, 0x0a, 0x04, - 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, - 0x02, 0x10, 0x01, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x47, 0x0a, 0x08, 0x74, 0x72, 0x69, - 0x67, 0x67, 0x65, 0x72, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x65, 0x6e, - 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x6f, 0x76, 0x65, 0x72, 0x6c, - 0x6f, 0x61, 0x64, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x42, 0x08, - 0xfa, 0x42, 0x05, 0x92, 0x01, 0x02, 0x08, 0x01, 0x52, 0x08, 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, - 0x72, 0x73, 0x12, 0x37, 0x0a, 0x0c, 0x74, 0x79, 0x70, 0x65, 0x64, 0x5f, 0x63, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x14, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x41, 0x6e, 0x79, 0x52, 0x0b, - 0x74, 0x79, 0x70, 0x65, 0x64, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x3a, 0x33, 0x9a, 0xc5, 0x88, - 0x1e, 0x2e, 0x0a, 0x2c, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x2e, 0x6f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x2e, 0x76, 0x32, 0x61, 0x6c, 0x70, 0x68, - 0x61, 0x2e, 0x4f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, - 0x22, 0x75, 0x0a, 0x0d, 0x4c, 0x6f, 0x61, 0x64, 0x53, 0x68, 0x65, 0x64, 0x50, 0x6f, 0x69, 0x6e, - 0x74, 0x12, 0x1b, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, - 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x47, - 0x0a, 0x08, 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, - 0x32, 0x21, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, - 0x6f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x72, 0x69, 0x67, - 0x67, 0x65, 0x72, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x92, 0x01, 0x02, 0x08, 0x01, 0x52, 0x08, 0x74, - 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x73, 0x22, 0x70, 0x0a, 0x13, 0x42, 0x75, 0x66, 0x66, 0x65, - 0x72, 0x46, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x79, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x59, - 0x0a, 0x25, 0x6d, 0x69, 0x6e, 0x69, 0x6d, 0x75, 0x6d, 0x5f, 0x61, 0x63, 0x63, 0x6f, 0x75, 0x6e, - 0x74, 0x5f, 0x74, 0x6f, 0x5f, 0x74, 0x72, 0x61, 0x63, 0x6b, 0x5f, 0x70, 0x6f, 0x77, 0x65, 0x72, - 0x5f, 0x6f, 0x66, 0x5f, 0x74, 0x77, 0x6f, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0d, 0x42, 0x09, 0xfa, - 0x42, 0x06, 0x2a, 0x04, 0x18, 0x38, 0x28, 0x0a, 0x52, 0x1f, 0x6d, 0x69, 0x6e, 0x69, 0x6d, 0x75, - 0x6d, 0x41, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x54, 0x6f, 0x54, 0x72, 0x61, 0x63, 0x6b, 0x50, - 0x6f, 0x77, 0x65, 0x72, 0x4f, 0x66, 0x54, 0x77, 0x6f, 0x22, 0xe8, 0x03, 0x0a, 0x0f, 0x4f, 0x76, - 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x4d, 0x61, 0x6e, 0x61, 0x67, 0x65, 0x72, 0x12, 0x44, 0x0a, - 0x10, 0x72, 0x65, 0x66, 0x72, 0x65, 0x73, 0x68, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, - 0x6c, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x52, 0x0f, 0x72, 0x65, 0x66, 0x72, 0x65, 0x73, 0x68, 0x49, 0x6e, 0x74, 0x65, 0x72, - 0x76, 0x61, 0x6c, 0x12, 0x60, 0x0a, 0x11, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, - 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x29, - 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x6f, 0x76, - 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x92, 0x01, - 0x02, 0x08, 0x01, 0x52, 0x10, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x4d, 0x6f, 0x6e, - 0x69, 0x74, 0x6f, 0x72, 0x73, 0x12, 0x42, 0x0a, 0x07, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, - 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x28, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, - 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x6f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x2e, 0x76, - 0x33, 0x2e, 0x4f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, - 0x52, 0x07, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x50, 0x0a, 0x0f, 0x6c, 0x6f, 0x61, - 0x64, 0x73, 0x68, 0x65, 0x64, 0x5f, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x73, 0x18, 0x05, 0x20, 0x03, - 0x28, 0x0b, 0x32, 0x27, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x2e, 0x6f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x2e, 0x76, 0x33, 0x2e, 0x4c, 0x6f, - 0x61, 0x64, 0x53, 0x68, 0x65, 0x64, 0x50, 0x6f, 0x69, 0x6e, 0x74, 0x52, 0x0e, 0x6c, 0x6f, 0x61, - 0x64, 0x73, 0x68, 0x65, 0x64, 0x50, 0x6f, 0x69, 0x6e, 0x74, 0x73, 0x12, 0x61, 0x0a, 0x15, 0x62, - 0x75, 0x66, 0x66, 0x65, 0x72, 0x5f, 0x66, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x79, 0x5f, 0x63, 0x6f, - 0x6e, 0x66, 0x69, 0x67, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2d, 0x2e, 0x65, 0x6e, 0x76, + 0x43, 0x4f, 0x4e, 0x4e, 0x45, 0x43, 0x54, 0x10, 0x03, 0x12, 0x22, 0x0a, 0x1e, 0x48, 0x54, 0x54, + 0x50, 0x5f, 0x44, 0x4f, 0x57, 0x4e, 0x53, 0x54, 0x52, 0x45, 0x41, 0x4d, 0x5f, 0x43, 0x4f, 0x4e, + 0x4e, 0x45, 0x43, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x4d, 0x41, 0x58, 0x10, 0x04, 0x22, 0xe4, 0x01, + 0x0a, 0x0e, 0x4f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, + 0x12, 0x1b, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, + 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x47, 0x0a, + 0x08, 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, + 0x21, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x6f, + 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x72, 0x69, 0x67, 0x67, + 0x65, 0x72, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x92, 0x01, 0x02, 0x08, 0x01, 0x52, 0x08, 0x74, 0x72, + 0x69, 0x67, 0x67, 0x65, 0x72, 0x73, 0x12, 0x37, 0x0a, 0x0c, 0x74, 0x79, 0x70, 0x65, 0x64, 0x5f, + 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x14, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x41, + 0x6e, 0x79, 0x52, 0x0b, 0x74, 0x79, 0x70, 0x65, 0x64, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x3a, + 0x33, 0x9a, 0xc5, 0x88, 0x1e, 0x2e, 0x0a, 0x2c, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, + 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x6f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x2e, 0x76, 0x32, + 0x61, 0x6c, 0x70, 0x68, 0x61, 0x2e, 0x4f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x41, 0x63, + 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x75, 0x0a, 0x0d, 0x4c, 0x6f, 0x61, 0x64, 0x53, 0x68, 0x65, 0x64, + 0x50, 0x6f, 0x69, 0x6e, 0x74, 0x12, 0x1b, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, + 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x04, 0x6e, 0x61, + 0x6d, 0x65, 0x12, 0x47, 0x0a, 0x08, 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x73, 0x18, 0x02, + 0x20, 0x03, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x2e, 0x6f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x2e, 0x76, 0x33, 0x2e, + 0x54, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x92, 0x01, 0x02, 0x08, + 0x01, 0x52, 0x08, 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72, 0x73, 0x22, 0x70, 0x0a, 0x13, 0x42, + 0x75, 0x66, 0x66, 0x65, 0x72, 0x46, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x79, 0x43, 0x6f, 0x6e, 0x66, + 0x69, 0x67, 0x12, 0x59, 0x0a, 0x25, 0x6d, 0x69, 0x6e, 0x69, 0x6d, 0x75, 0x6d, 0x5f, 0x61, 0x63, + 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x5f, 0x74, 0x6f, 0x5f, 0x74, 0x72, 0x61, 0x63, 0x6b, 0x5f, 0x70, + 0x6f, 0x77, 0x65, 0x72, 0x5f, 0x6f, 0x66, 0x5f, 0x74, 0x77, 0x6f, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x0d, 0x42, 0x09, 0xfa, 0x42, 0x06, 0x2a, 0x04, 0x18, 0x38, 0x28, 0x0a, 0x52, 0x1f, 0x6d, 0x69, + 0x6e, 0x69, 0x6d, 0x75, 0x6d, 0x41, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x54, 0x6f, 0x54, 0x72, + 0x61, 0x63, 0x6b, 0x50, 0x6f, 0x77, 0x65, 0x72, 0x4f, 0x66, 0x54, 0x77, 0x6f, 0x22, 0xe8, 0x03, + 0x0a, 0x0f, 0x4f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x4d, 0x61, 0x6e, 0x61, 0x67, 0x65, + 0x72, 0x12, 0x44, 0x0a, 0x10, 0x72, 0x65, 0x66, 0x72, 0x65, 0x73, 0x68, 0x5f, 0x69, 0x6e, 0x74, + 0x65, 0x72, 0x76, 0x61, 0x6c, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, + 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0f, 0x72, 0x65, 0x66, 0x72, 0x65, 0x73, 0x68, 0x49, + 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x12, 0x60, 0x0a, 0x11, 0x72, 0x65, 0x73, 0x6f, 0x75, + 0x72, 0x63, 0x65, 0x5f, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x73, 0x18, 0x02, 0x20, 0x03, + 0x28, 0x0b, 0x32, 0x29, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, + 0x67, 0x2e, 0x6f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x65, + 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x42, 0x08, 0xfa, + 0x42, 0x05, 0x92, 0x01, 0x02, 0x08, 0x01, 0x52, 0x10, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, + 0x65, 0x4d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x73, 0x12, 0x42, 0x0a, 0x07, 0x61, 0x63, 0x74, + 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x28, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x6f, 0x76, 0x65, 0x72, 0x6c, 0x6f, - 0x61, 0x64, 0x2e, 0x76, 0x33, 0x2e, 0x42, 0x75, 0x66, 0x66, 0x65, 0x72, 0x46, 0x61, 0x63, 0x74, - 0x6f, 0x72, 0x79, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x13, 0x62, 0x75, 0x66, 0x66, 0x65, - 0x72, 0x46, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x79, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x3a, 0x34, - 0x9a, 0xc5, 0x88, 0x1e, 0x2f, 0x0a, 0x2d, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x2e, 0x6f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x2e, 0x76, 0x32, 0x61, - 0x6c, 0x70, 0x68, 0x61, 0x2e, 0x4f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x4d, 0x61, 0x6e, - 0x61, 0x67, 0x65, 0x72, 0x42, 0x8d, 0x01, 0xba, 0x80, 0xc8, 0xd1, 0x06, 0x02, 0x10, 0x02, 0x0a, - 0x26, 0x69, 0x6f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2e, 0x65, - 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x6f, 0x76, 0x65, 0x72, - 0x6c, 0x6f, 0x61, 0x64, 0x2e, 0x76, 0x33, 0x42, 0x0d, 0x4f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, - 0x64, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x4a, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, - 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2f, - 0x67, 0x6f, 0x2d, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x2d, 0x70, 0x6c, 0x61, 0x6e, 0x65, - 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2f, 0x6f, 0x76, - 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x2f, 0x76, 0x33, 0x3b, 0x6f, 0x76, 0x65, 0x72, 0x6c, 0x6f, - 0x61, 0x64, 0x76, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x61, 0x64, 0x2e, 0x76, 0x33, 0x2e, 0x4f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x41, 0x63, + 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x07, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x50, 0x0a, + 0x0f, 0x6c, 0x6f, 0x61, 0x64, 0x73, 0x68, 0x65, 0x64, 0x5f, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x73, + 0x18, 0x05, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x27, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x6f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x2e, 0x76, + 0x33, 0x2e, 0x4c, 0x6f, 0x61, 0x64, 0x53, 0x68, 0x65, 0x64, 0x50, 0x6f, 0x69, 0x6e, 0x74, 0x52, + 0x0e, 0x6c, 0x6f, 0x61, 0x64, 0x73, 0x68, 0x65, 0x64, 0x50, 0x6f, 0x69, 0x6e, 0x74, 0x73, 0x12, + 0x61, 0x0a, 0x15, 0x62, 0x75, 0x66, 0x66, 0x65, 0x72, 0x5f, 0x66, 0x61, 0x63, 0x74, 0x6f, 0x72, + 0x79, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2d, + 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x6f, 0x76, + 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x2e, 0x76, 0x33, 0x2e, 0x42, 0x75, 0x66, 0x66, 0x65, 0x72, + 0x46, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x79, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x13, 0x62, + 0x75, 0x66, 0x66, 0x65, 0x72, 0x46, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x79, 0x43, 0x6f, 0x6e, 0x66, + 0x69, 0x67, 0x3a, 0x34, 0x9a, 0xc5, 0x88, 0x1e, 0x2f, 0x0a, 0x2d, 0x65, 0x6e, 0x76, 0x6f, 0x79, + 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x6f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, + 0x2e, 0x76, 0x32, 0x61, 0x6c, 0x70, 0x68, 0x61, 0x2e, 0x4f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, + 0x64, 0x4d, 0x61, 0x6e, 0x61, 0x67, 0x65, 0x72, 0x42, 0x8d, 0x01, 0xba, 0x80, 0xc8, 0xd1, 0x06, + 0x02, 0x10, 0x02, 0x0a, 0x26, 0x69, 0x6f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, + 0x78, 0x79, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, + 0x6f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x2e, 0x76, 0x33, 0x42, 0x0d, 0x4f, 0x76, 0x65, + 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x4a, 0x67, 0x69, + 0x74, 0x68, 0x75, 0x62, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, + 0x6f, 0x78, 0x79, 0x2f, 0x67, 0x6f, 0x2d, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x2d, 0x70, + 0x6c, 0x61, 0x6e, 0x65, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x63, 0x6f, 0x6e, 0x66, 0x69, + 0x67, 0x2f, 0x6f, 0x76, 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x2f, 0x76, 0x33, 0x3b, 0x6f, 0x76, + 0x65, 0x72, 0x6c, 0x6f, 0x61, 0x64, 0x76, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/rbac/v3/rbac.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/rbac/v3/rbac.pb.go index c069fae842a99..47d0e510f700f 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/rbac/v3/rbac.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/rbac/v3/rbac.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/rbac/v3/rbac.proto package rbacv3 @@ -10,8 +10,8 @@ import ( _ "github.com/cncf/xds/go/udpa/annotations" _ "github.com/envoyproxy/go-control-plane/envoy/annotations" v32 "github.com/envoyproxy/go-control-plane/envoy/config/core/v3" - v3 "github.com/envoyproxy/go-control-plane/envoy/config/route/v3" - v31 "github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3" + v31 "github.com/envoyproxy/go-control-plane/envoy/config/route/v3" + v3 "github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3" v33 "github.com/envoyproxy/go-control-plane/envoy/type/v3" _ "github.com/envoyproxy/protoc-gen-validate/validate" v1alpha1 "google.golang.org/genproto/googleapis/api/expr/v1alpha1" @@ -28,6 +28,54 @@ const ( _ = protoimpl.EnforceVersion(protoimpl.MaxVersion - 20) ) +type MetadataSource int32 + +const ( + // Query :ref:`dynamic metadata ` + MetadataSource_DYNAMIC MetadataSource = 0 + // Query :ref:`route metadata ` + MetadataSource_ROUTE MetadataSource = 1 +) + +// Enum value maps for MetadataSource. +var ( + MetadataSource_name = map[int32]string{ + 0: "DYNAMIC", + 1: "ROUTE", + } + MetadataSource_value = map[string]int32{ + "DYNAMIC": 0, + "ROUTE": 1, + } +) + +func (x MetadataSource) Enum() *MetadataSource { + p := new(MetadataSource) + *p = x + return p +} + +func (x MetadataSource) String() string { + return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) +} + +func (MetadataSource) Descriptor() protoreflect.EnumDescriptor { + return file_envoy_config_rbac_v3_rbac_proto_enumTypes[0].Descriptor() +} + +func (MetadataSource) Type() protoreflect.EnumType { + return &file_envoy_config_rbac_v3_rbac_proto_enumTypes[0] +} + +func (x MetadataSource) Number() protoreflect.EnumNumber { + return protoreflect.EnumNumber(x) +} + +// Deprecated: Use MetadataSource.Descriptor instead. +func (MetadataSource) EnumDescriptor() ([]byte, []int) { + return file_envoy_config_rbac_v3_rbac_proto_rawDescGZIP(), []int{0} +} + // Should we do safe-list or block-list style access control? type RBAC_Action int32 @@ -68,11 +116,11 @@ func (x RBAC_Action) String() string { } func (RBAC_Action) Descriptor() protoreflect.EnumDescriptor { - return file_envoy_config_rbac_v3_rbac_proto_enumTypes[0].Descriptor() + return file_envoy_config_rbac_v3_rbac_proto_enumTypes[1].Descriptor() } func (RBAC_Action) Type() protoreflect.EnumType { - return &file_envoy_config_rbac_v3_rbac_proto_enumTypes[0] + return &file_envoy_config_rbac_v3_rbac_proto_enumTypes[1] } func (x RBAC_Action) Number() protoreflect.EnumNumber { @@ -125,11 +173,11 @@ func (x RBAC_AuditLoggingOptions_AuditCondition) String() string { } func (RBAC_AuditLoggingOptions_AuditCondition) Descriptor() protoreflect.EnumDescriptor { - return file_envoy_config_rbac_v3_rbac_proto_enumTypes[1].Descriptor() + return file_envoy_config_rbac_v3_rbac_proto_enumTypes[2].Descriptor() } func (RBAC_AuditLoggingOptions_AuditCondition) Type() protoreflect.EnumType { - return &file_envoy_config_rbac_v3_rbac_proto_enumTypes[1] + return &file_envoy_config_rbac_v3_rbac_proto_enumTypes[2] } func (x RBAC_AuditLoggingOptions_AuditCondition) Number() protoreflect.EnumNumber { @@ -370,8 +418,75 @@ func (x *Policy) GetCheckedCondition() *v1alpha1.CheckedExpr { return nil } +// SourcedMetadata enables matching against metadata from different sources in the request processing +// pipeline. It extends the base MetadataMatcher functionality by allowing specification of where the +// metadata should be sourced from, rather than only matching against dynamic metadata. +// +// The matcher can be configured to look up metadata from: +// * Dynamic metadata: Runtime metadata added by filters during request processing +// * Route metadata: Static metadata configured on the route entry +type SourcedMetadata struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Metadata matcher configuration that defines what metadata to match against. This includes the filter name, + // metadata key path, and expected value. + MetadataMatcher *v3.MetadataMatcher `protobuf:"bytes,1,opt,name=metadata_matcher,json=metadataMatcher,proto3" json:"metadata_matcher,omitempty"` + // Specifies which metadata source should be used for matching. If not set, + // defaults to DYNAMIC (dynamic metadata). Set to ROUTE to match against + // static metadata configured on the route entry. + MetadataSource MetadataSource `protobuf:"varint,2,opt,name=metadata_source,json=metadataSource,proto3,enum=envoy.config.rbac.v3.MetadataSource" json:"metadata_source,omitempty"` +} + +func (x *SourcedMetadata) Reset() { + *x = SourcedMetadata{} + if protoimpl.UnsafeEnabled { + mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *SourcedMetadata) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*SourcedMetadata) ProtoMessage() {} + +func (x *SourcedMetadata) ProtoReflect() protoreflect.Message { + mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[2] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use SourcedMetadata.ProtoReflect.Descriptor instead. +func (*SourcedMetadata) Descriptor() ([]byte, []int) { + return file_envoy_config_rbac_v3_rbac_proto_rawDescGZIP(), []int{2} +} + +func (x *SourcedMetadata) GetMetadataMatcher() *v3.MetadataMatcher { + if x != nil { + return x.MetadataMatcher + } + return nil +} + +func (x *SourcedMetadata) GetMetadataSource() MetadataSource { + if x != nil { + return x.MetadataSource + } + return MetadataSource_DYNAMIC +} + // Permission defines an action (or actions) that a principal can take. -// [#next-free-field: 14] +// [#next-free-field: 15] type Permission struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -392,13 +507,14 @@ type Permission struct { // *Permission_RequestedServerName // *Permission_Matcher // *Permission_UriTemplate + // *Permission_SourcedMetadata Rule isPermission_Rule `protobuf_oneof:"rule"` } func (x *Permission) Reset() { *x = Permission{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[2] + mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[3] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -411,7 +527,7 @@ func (x *Permission) String() string { func (*Permission) ProtoMessage() {} func (x *Permission) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[2] + mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[3] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -424,7 +540,7 @@ func (x *Permission) ProtoReflect() protoreflect.Message { // Deprecated: Use Permission.ProtoReflect.Descriptor instead. func (*Permission) Descriptor() ([]byte, []int) { - return file_envoy_config_rbac_v3_rbac_proto_rawDescGZIP(), []int{2} + return file_envoy_config_rbac_v3_rbac_proto_rawDescGZIP(), []int{3} } func (m *Permission) GetRule() isPermission_Rule { @@ -455,14 +571,14 @@ func (x *Permission) GetAny() bool { return false } -func (x *Permission) GetHeader() *v3.HeaderMatcher { +func (x *Permission) GetHeader() *v31.HeaderMatcher { if x, ok := x.GetRule().(*Permission_Header); ok { return x.Header } return nil } -func (x *Permission) GetUrlPath() *v31.PathMatcher { +func (x *Permission) GetUrlPath() *v3.PathMatcher { if x, ok := x.GetRule().(*Permission_UrlPath); ok { return x.UrlPath } @@ -490,7 +606,8 @@ func (x *Permission) GetDestinationPortRange() *v33.Int32Range { return nil } -func (x *Permission) GetMetadata() *v31.MetadataMatcher { +// Deprecated: Marked as deprecated in envoy/config/rbac/v3/rbac.proto. +func (x *Permission) GetMetadata() *v3.MetadataMatcher { if x, ok := x.GetRule().(*Permission_Metadata); ok { return x.Metadata } @@ -504,7 +621,7 @@ func (x *Permission) GetNotRule() *Permission { return nil } -func (x *Permission) GetRequestedServerName() *v31.StringMatcher { +func (x *Permission) GetRequestedServerName() *v3.StringMatcher { if x, ok := x.GetRule().(*Permission_RequestedServerName); ok { return x.RequestedServerName } @@ -525,6 +642,13 @@ func (x *Permission) GetUriTemplate() *v32.TypedExtensionConfig { return nil } +func (x *Permission) GetSourcedMetadata() *SourcedMetadata { + if x, ok := x.GetRule().(*Permission_SourcedMetadata); ok { + return x.SourcedMetadata + } + return nil +} + type isPermission_Rule interface { isPermission_Rule() } @@ -549,12 +673,12 @@ type Permission_Header struct { // available for HTTP request. // Note: the pseudo-header :path includes the query and fragment string. Use the “url_path“ // field if you want to match the URL path without the query and fragment string. - Header *v3.HeaderMatcher `protobuf:"bytes,4,opt,name=header,proto3,oneof"` + Header *v31.HeaderMatcher `protobuf:"bytes,4,opt,name=header,proto3,oneof"` } type Permission_UrlPath struct { // A URL path on the incoming HTTP request. Only available for HTTP. - UrlPath *v31.PathMatcher `protobuf:"bytes,10,opt,name=url_path,json=urlPath,proto3,oneof"` + UrlPath *v3.PathMatcher `protobuf:"bytes,10,opt,name=url_path,json=urlPath,proto3,oneof"` } type Permission_DestinationIp struct { @@ -573,8 +697,11 @@ type Permission_DestinationPortRange struct { } type Permission_Metadata struct { - // Metadata that describes additional information about the action. - Metadata *v31.MetadataMatcher `protobuf:"bytes,7,opt,name=metadata,proto3,oneof"` + // Metadata that describes additional information about the action. This field is deprecated; please use + // :ref:`sourced_metadata` instead. + // + // Deprecated: Marked as deprecated in envoy/config/rbac/v3/rbac.proto. + Metadata *v3.MetadataMatcher `protobuf:"bytes,7,opt,name=metadata,proto3,oneof"` } type Permission_NotRule struct { @@ -605,7 +732,7 @@ type Permission_RequestedServerName struct { // // Please refer to :ref:`this FAQ entry ` to learn to // setup SNI. - RequestedServerName *v31.StringMatcher `protobuf:"bytes,9,opt,name=requested_server_name,json=requestedServerName,proto3,oneof"` + RequestedServerName *v3.StringMatcher `protobuf:"bytes,9,opt,name=requested_server_name,json=requestedServerName,proto3,oneof"` } type Permission_Matcher struct { @@ -620,6 +747,12 @@ type Permission_UriTemplate struct { UriTemplate *v32.TypedExtensionConfig `protobuf:"bytes,13,opt,name=uri_template,json=uriTemplate,proto3,oneof"` } +type Permission_SourcedMetadata struct { + // Matches against metadata from either dynamic state or route configuration. Preferred over the + // “metadata“ field as it provides more flexibility in metadata source selection. + SourcedMetadata *SourcedMetadata `protobuf:"bytes,14,opt,name=sourced_metadata,json=sourcedMetadata,proto3,oneof"` +} + func (*Permission_AndRules) isPermission_Rule() {} func (*Permission_OrRules) isPermission_Rule() {} @@ -646,9 +779,11 @@ func (*Permission_Matcher) isPermission_Rule() {} func (*Permission_UriTemplate) isPermission_Rule() {} +func (*Permission_SourcedMetadata) isPermission_Rule() {} + // Principal defines an identity or a group of identities for a downstream // subject. -// [#next-free-field: 13] +// [#next-free-field: 14] type Principal struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -668,13 +803,14 @@ type Principal struct { // *Principal_Metadata // *Principal_FilterState // *Principal_NotId + // *Principal_SourcedMetadata Identifier isPrincipal_Identifier `protobuf_oneof:"identifier"` } func (x *Principal) Reset() { *x = Principal{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[3] + mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[4] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -687,7 +823,7 @@ func (x *Principal) String() string { func (*Principal) ProtoMessage() {} func (x *Principal) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[3] + mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[4] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -700,7 +836,7 @@ func (x *Principal) ProtoReflect() protoreflect.Message { // Deprecated: Use Principal.ProtoReflect.Descriptor instead. func (*Principal) Descriptor() ([]byte, []int) { - return file_envoy_config_rbac_v3_rbac_proto_rawDescGZIP(), []int{3} + return file_envoy_config_rbac_v3_rbac_proto_rawDescGZIP(), []int{4} } func (m *Principal) GetIdentifier() isPrincipal_Identifier { @@ -760,28 +896,29 @@ func (x *Principal) GetRemoteIp() *v32.CidrRange { return nil } -func (x *Principal) GetHeader() *v3.HeaderMatcher { +func (x *Principal) GetHeader() *v31.HeaderMatcher { if x, ok := x.GetIdentifier().(*Principal_Header); ok { return x.Header } return nil } -func (x *Principal) GetUrlPath() *v31.PathMatcher { +func (x *Principal) GetUrlPath() *v3.PathMatcher { if x, ok := x.GetIdentifier().(*Principal_UrlPath); ok { return x.UrlPath } return nil } -func (x *Principal) GetMetadata() *v31.MetadataMatcher { +// Deprecated: Marked as deprecated in envoy/config/rbac/v3/rbac.proto. +func (x *Principal) GetMetadata() *v3.MetadataMatcher { if x, ok := x.GetIdentifier().(*Principal_Metadata); ok { return x.Metadata } return nil } -func (x *Principal) GetFilterState() *v31.FilterStateMatcher { +func (x *Principal) GetFilterState() *v3.FilterStateMatcher { if x, ok := x.GetIdentifier().(*Principal_FilterState); ok { return x.FilterState } @@ -795,6 +932,13 @@ func (x *Principal) GetNotId() *Principal { return nil } +func (x *Principal) GetSourcedMetadata() *SourcedMetadata { + if x, ok := x.GetIdentifier().(*Principal_SourcedMetadata); ok { + return x.SourcedMetadata + } + return nil +} + type isPrincipal_Identifier interface { isPrincipal_Identifier() } @@ -858,22 +1002,25 @@ type Principal_Header struct { // request. Only available for HTTP request. Note: the pseudo-header :path // includes the query and fragment string. Use the “url_path“ field if you // want to match the URL path without the query and fragment string. - Header *v3.HeaderMatcher `protobuf:"bytes,6,opt,name=header,proto3,oneof"` + Header *v31.HeaderMatcher `protobuf:"bytes,6,opt,name=header,proto3,oneof"` } type Principal_UrlPath struct { // A URL path on the incoming HTTP request. Only available for HTTP. - UrlPath *v31.PathMatcher `protobuf:"bytes,9,opt,name=url_path,json=urlPath,proto3,oneof"` + UrlPath *v3.PathMatcher `protobuf:"bytes,9,opt,name=url_path,json=urlPath,proto3,oneof"` } type Principal_Metadata struct { - // Metadata that describes additional information about the principal. - Metadata *v31.MetadataMatcher `protobuf:"bytes,7,opt,name=metadata,proto3,oneof"` + // Metadata that describes additional information about the principal. This field is deprecated; please use + // :ref:`sourced_metadata` instead. + // + // Deprecated: Marked as deprecated in envoy/config/rbac/v3/rbac.proto. + Metadata *v3.MetadataMatcher `protobuf:"bytes,7,opt,name=metadata,proto3,oneof"` } type Principal_FilterState struct { // Identifies the principal using a filter state object. - FilterState *v31.FilterStateMatcher `protobuf:"bytes,12,opt,name=filter_state,json=filterState,proto3,oneof"` + FilterState *v3.FilterStateMatcher `protobuf:"bytes,12,opt,name=filter_state,json=filterState,proto3,oneof"` } type Principal_NotId struct { @@ -883,6 +1030,12 @@ type Principal_NotId struct { NotId *Principal `protobuf:"bytes,8,opt,name=not_id,json=notId,proto3,oneof"` } +type Principal_SourcedMetadata struct { + // Matches against metadata from either dynamic state or route configuration. Preferred over the + // “metadata“ field as it provides more flexibility in metadata source selection. + SourcedMetadata *SourcedMetadata `protobuf:"bytes,13,opt,name=sourced_metadata,json=sourcedMetadata,proto3,oneof"` +} + func (*Principal_AndIds) isPrincipal_Identifier() {} func (*Principal_OrIds) isPrincipal_Identifier() {} @@ -907,6 +1060,8 @@ func (*Principal_FilterState) isPrincipal_Identifier() {} func (*Principal_NotId) isPrincipal_Identifier() {} +func (*Principal_SourcedMetadata) isPrincipal_Identifier() {} + // Action defines the result of allowance or denial when a request matches the matcher. type Action struct { state protoimpl.MessageState @@ -938,7 +1093,7 @@ type Action struct { func (x *Action) Reset() { *x = Action{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[4] + mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[5] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -951,7 +1106,7 @@ func (x *Action) String() string { func (*Action) ProtoMessage() {} func (x *Action) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[4] + mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[5] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -964,7 +1119,7 @@ func (x *Action) ProtoReflect() protoreflect.Message { // Deprecated: Use Action.ProtoReflect.Descriptor instead. func (*Action) Descriptor() ([]byte, []int) { - return file_envoy_config_rbac_v3_rbac_proto_rawDescGZIP(), []int{4} + return file_envoy_config_rbac_v3_rbac_proto_rawDescGZIP(), []int{5} } func (x *Action) GetName() string { @@ -1000,7 +1155,7 @@ type RBAC_AuditLoggingOptions struct { func (x *RBAC_AuditLoggingOptions) Reset() { *x = RBAC_AuditLoggingOptions{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[5] + mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[6] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -1013,7 +1168,7 @@ func (x *RBAC_AuditLoggingOptions) String() string { func (*RBAC_AuditLoggingOptions) ProtoMessage() {} func (x *RBAC_AuditLoggingOptions) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[5] + mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[6] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1060,7 +1215,7 @@ type RBAC_AuditLoggingOptions_AuditLoggerConfig struct { func (x *RBAC_AuditLoggingOptions_AuditLoggerConfig) Reset() { *x = RBAC_AuditLoggingOptions_AuditLoggerConfig{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[7] + mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[8] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -1073,7 +1228,7 @@ func (x *RBAC_AuditLoggingOptions_AuditLoggerConfig) String() string { func (*RBAC_AuditLoggingOptions_AuditLoggerConfig) ProtoMessage() {} func (x *RBAC_AuditLoggingOptions_AuditLoggerConfig) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[7] + mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[8] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1116,7 +1271,7 @@ type Permission_Set struct { func (x *Permission_Set) Reset() { *x = Permission_Set{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[8] + mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[9] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -1129,7 +1284,7 @@ func (x *Permission_Set) String() string { func (*Permission_Set) ProtoMessage() {} func (x *Permission_Set) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[8] + mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[9] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1142,7 +1297,7 @@ func (x *Permission_Set) ProtoReflect() protoreflect.Message { // Deprecated: Use Permission_Set.ProtoReflect.Descriptor instead. func (*Permission_Set) Descriptor() ([]byte, []int) { - return file_envoy_config_rbac_v3_rbac_proto_rawDescGZIP(), []int{2, 0} + return file_envoy_config_rbac_v3_rbac_proto_rawDescGZIP(), []int{3, 0} } func (x *Permission_Set) GetRules() []*Permission { @@ -1165,7 +1320,7 @@ type Principal_Set struct { func (x *Principal_Set) Reset() { *x = Principal_Set{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[9] + mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[10] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -1178,7 +1333,7 @@ func (x *Principal_Set) String() string { func (*Principal_Set) ProtoMessage() {} func (x *Principal_Set) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[9] + mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[10] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1191,7 +1346,7 @@ func (x *Principal_Set) ProtoReflect() protoreflect.Message { // Deprecated: Use Principal_Set.ProtoReflect.Descriptor instead. func (*Principal_Set) Descriptor() ([]byte, []int) { - return file_envoy_config_rbac_v3_rbac_proto_rawDescGZIP(), []int{3, 0} + return file_envoy_config_rbac_v3_rbac_proto_rawDescGZIP(), []int{4, 0} } func (x *Principal_Set) GetIds() []*Principal { @@ -1210,13 +1365,13 @@ type Principal_Authenticated struct { // The name of the principal. If set, The URI SAN or DNS SAN in that order // is used from the certificate, otherwise the subject field is used. If // unset, it applies to any user that is authenticated. - PrincipalName *v31.StringMatcher `protobuf:"bytes,2,opt,name=principal_name,json=principalName,proto3" json:"principal_name,omitempty"` + PrincipalName *v3.StringMatcher `protobuf:"bytes,2,opt,name=principal_name,json=principalName,proto3" json:"principal_name,omitempty"` } func (x *Principal_Authenticated) Reset() { *x = Principal_Authenticated{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[10] + mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[11] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -1229,7 +1384,7 @@ func (x *Principal_Authenticated) String() string { func (*Principal_Authenticated) ProtoMessage() {} func (x *Principal_Authenticated) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[10] + mi := &file_envoy_config_rbac_v3_rbac_proto_msgTypes[11] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1242,10 +1397,10 @@ func (x *Principal_Authenticated) ProtoReflect() protoreflect.Message { // Deprecated: Use Principal_Authenticated.ProtoReflect.Descriptor instead. func (*Principal_Authenticated) Descriptor() ([]byte, []int) { - return file_envoy_config_rbac_v3_rbac_proto_rawDescGZIP(), []int{3, 1} + return file_envoy_config_rbac_v3_rbac_proto_rawDescGZIP(), []int{4, 1} } -func (x *Principal_Authenticated) GetPrincipalName() *v31.StringMatcher { +func (x *Principal_Authenticated) GetPrincipalName() *v3.StringMatcher { if x != nil { return x.PrincipalName } @@ -1371,159 +1526,187 @@ var file_envoy_config_rbac_v3_rbac_proto_rawDesc = []byte{ 0x69, 0x65, 0x72, 0x52, 0x10, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x64, 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x22, 0x9a, 0xc5, 0x88, 0x1e, 0x1d, 0x0a, 0x1b, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, - 0x76, 0x32, 0x2e, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x22, 0xab, 0x08, 0x0a, 0x0a, 0x50, 0x65, - 0x72, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x43, 0x0a, 0x09, 0x61, 0x6e, 0x64, 0x5f, - 0x72, 0x75, 0x6c, 0x65, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x65, 0x6e, - 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, - 0x76, 0x33, 0x2e, 0x50, 0x65, 0x72, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x65, - 0x74, 0x48, 0x00, 0x52, 0x08, 0x61, 0x6e, 0x64, 0x52, 0x75, 0x6c, 0x65, 0x73, 0x12, 0x41, 0x0a, - 0x08, 0x6f, 0x72, 0x5f, 0x72, 0x75, 0x6c, 0x65, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x24, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, - 0x62, 0x61, 0x63, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x65, 0x72, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6f, - 0x6e, 0x2e, 0x53, 0x65, 0x74, 0x48, 0x00, 0x52, 0x07, 0x6f, 0x72, 0x52, 0x75, 0x6c, 0x65, 0x73, - 0x12, 0x1b, 0x0a, 0x03, 0x61, 0x6e, 0x79, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x42, 0x07, 0xfa, - 0x42, 0x04, 0x6a, 0x02, 0x08, 0x01, 0x48, 0x00, 0x52, 0x03, 0x61, 0x6e, 0x79, 0x12, 0x3e, 0x0a, - 0x06, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, - 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x6f, 0x75, - 0x74, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x4d, 0x61, 0x74, 0x63, - 0x68, 0x65, 0x72, 0x48, 0x00, 0x52, 0x06, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x12, 0x3f, 0x0a, - 0x08, 0x75, 0x72, 0x6c, 0x5f, 0x70, 0x61, 0x74, 0x68, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x22, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x6d, 0x61, 0x74, - 0x63, 0x68, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, 0x74, 0x63, - 0x68, 0x65, 0x72, 0x48, 0x00, 0x52, 0x07, 0x75, 0x72, 0x6c, 0x50, 0x61, 0x74, 0x68, 0x12, 0x48, - 0x0a, 0x0e, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x69, 0x70, - 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, - 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x69, - 0x64, 0x72, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x48, 0x00, 0x52, 0x0d, 0x64, 0x65, 0x73, 0x74, 0x69, - 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x49, 0x70, 0x12, 0x36, 0x0a, 0x10, 0x64, 0x65, 0x73, 0x74, - 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x70, 0x6f, 0x72, 0x74, 0x18, 0x06, 0x20, 0x01, - 0x28, 0x0d, 0x42, 0x09, 0xfa, 0x42, 0x06, 0x2a, 0x04, 0x18, 0xff, 0xff, 0x03, 0x48, 0x00, 0x52, - 0x0f, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x6f, 0x72, 0x74, - 0x12, 0x51, 0x0a, 0x16, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, - 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x19, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x76, 0x33, - 0x2e, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x48, 0x00, 0x52, 0x14, 0x64, - 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x6f, 0x72, 0x74, 0x52, 0x61, - 0x6e, 0x67, 0x65, 0x12, 0x44, 0x0a, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x18, - 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x26, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, - 0x70, 0x65, 0x2e, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x65, - 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x48, 0x00, 0x52, - 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x12, 0x3d, 0x0a, 0x08, 0x6e, 0x6f, 0x74, - 0x5f, 0x72, 0x75, 0x6c, 0x65, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x65, 0x6e, - 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, - 0x76, 0x33, 0x2e, 0x50, 0x65, 0x72, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x48, 0x00, 0x52, - 0x07, 0x6e, 0x6f, 0x74, 0x52, 0x75, 0x6c, 0x65, 0x12, 0x5a, 0x0a, 0x15, 0x72, 0x65, 0x71, 0x75, - 0x65, 0x73, 0x74, 0x65, 0x64, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, 0x5f, 0x6e, 0x61, 0x6d, - 0x65, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, + 0x76, 0x32, 0x2e, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x22, 0xc7, 0x01, 0x0a, 0x0f, 0x53, 0x6f, + 0x75, 0x72, 0x63, 0x65, 0x64, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x12, 0x5b, 0x0a, + 0x10, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, + 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x26, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, - 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x48, 0x00, 0x52, - 0x13, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, 0x65, 0x72, - 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x46, 0x0a, 0x07, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x18, - 0x0c, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, - 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x79, 0x70, - 0x65, 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x48, 0x00, 0x52, 0x07, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x12, 0x4f, 0x0a, 0x0c, - 0x75, 0x72, 0x69, 0x5f, 0x74, 0x65, 0x6d, 0x70, 0x6c, 0x61, 0x74, 0x65, 0x18, 0x0d, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x79, 0x70, 0x65, 0x64, 0x45, - 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x48, 0x00, - 0x52, 0x0b, 0x75, 0x72, 0x69, 0x54, 0x65, 0x6d, 0x70, 0x6c, 0x61, 0x74, 0x65, 0x1a, 0x73, 0x0a, - 0x03, 0x53, 0x65, 0x74, 0x12, 0x40, 0x0a, 0x05, 0x72, 0x75, 0x6c, 0x65, 0x73, 0x18, 0x01, 0x20, - 0x03, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x65, 0x72, 0x6d, 0x69, - 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x92, 0x01, 0x02, 0x08, 0x01, 0x52, - 0x05, 0x72, 0x75, 0x6c, 0x65, 0x73, 0x3a, 0x2a, 0x9a, 0xc5, 0x88, 0x1e, 0x25, 0x0a, 0x23, 0x65, - 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, - 0x2e, 0x76, 0x32, 0x2e, 0x50, 0x65, 0x72, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x2e, 0x53, - 0x65, 0x74, 0x3a, 0x26, 0x9a, 0xc5, 0x88, 0x1e, 0x21, 0x0a, 0x1f, 0x65, 0x6e, 0x76, 0x6f, 0x79, - 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x32, 0x2e, - 0x50, 0x65, 0x72, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x42, 0x0b, 0x0a, 0x04, 0x72, 0x75, - 0x6c, 0x65, 0x12, 0x03, 0xf8, 0x42, 0x01, 0x22, 0xeb, 0x08, 0x0a, 0x09, 0x50, 0x72, 0x69, 0x6e, - 0x63, 0x69, 0x70, 0x61, 0x6c, 0x12, 0x3e, 0x0a, 0x07, 0x61, 0x6e, 0x64, 0x5f, 0x69, 0x64, 0x73, - 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x23, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, - 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x72, - 0x69, 0x6e, 0x63, 0x69, 0x70, 0x61, 0x6c, 0x2e, 0x53, 0x65, 0x74, 0x48, 0x00, 0x52, 0x06, 0x61, - 0x6e, 0x64, 0x49, 0x64, 0x73, 0x12, 0x3c, 0x0a, 0x06, 0x6f, 0x72, 0x5f, 0x69, 0x64, 0x73, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x23, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, - 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x72, 0x69, - 0x6e, 0x63, 0x69, 0x70, 0x61, 0x6c, 0x2e, 0x53, 0x65, 0x74, 0x48, 0x00, 0x52, 0x05, 0x6f, 0x72, - 0x49, 0x64, 0x73, 0x12, 0x1b, 0x0a, 0x03, 0x61, 0x6e, 0x79, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, - 0x42, 0x07, 0xfa, 0x42, 0x04, 0x6a, 0x02, 0x08, 0x01, 0x48, 0x00, 0x52, 0x03, 0x61, 0x6e, 0x79, - 0x12, 0x55, 0x0a, 0x0d, 0x61, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x65, - 0x64, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2d, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, - 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x33, 0x2e, 0x50, - 0x72, 0x69, 0x6e, 0x63, 0x69, 0x70, 0x61, 0x6c, 0x2e, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, - 0x69, 0x63, 0x61, 0x74, 0x65, 0x64, 0x48, 0x00, 0x52, 0x0d, 0x61, 0x75, 0x74, 0x68, 0x65, 0x6e, - 0x74, 0x69, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x4b, 0x0a, 0x09, 0x73, 0x6f, 0x75, 0x72, 0x63, - 0x65, 0x5f, 0x69, 0x70, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x65, 0x6e, 0x76, - 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, - 0x33, 0x2e, 0x43, 0x69, 0x64, 0x72, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x42, 0x0b, 0x92, 0xc7, 0x86, - 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x48, 0x00, 0x52, 0x08, 0x73, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x49, 0x70, 0x12, 0x4b, 0x0a, 0x10, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x5f, 0x72, - 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x5f, 0x69, 0x70, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f, - 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, - 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x69, 0x64, 0x72, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x48, - 0x00, 0x52, 0x0e, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x52, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x49, - 0x70, 0x12, 0x3e, 0x0a, 0x09, 0x72, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x5f, 0x69, 0x70, 0x18, 0x0b, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x69, 0x64, 0x72, - 0x52, 0x61, 0x6e, 0x67, 0x65, 0x48, 0x00, 0x52, 0x08, 0x72, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x49, - 0x70, 0x12, 0x3e, 0x0a, 0x06, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x18, 0x06, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x24, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, - 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x48, 0x00, 0x52, 0x06, 0x68, 0x65, 0x61, 0x64, 0x65, - 0x72, 0x12, 0x3f, 0x0a, 0x08, 0x75, 0x72, 0x6c, 0x5f, 0x70, 0x61, 0x74, 0x68, 0x18, 0x09, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, - 0x2e, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x61, 0x74, 0x68, - 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x48, 0x00, 0x52, 0x07, 0x75, 0x72, 0x6c, 0x50, 0x61, - 0x74, 0x68, 0x12, 0x44, 0x0a, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x18, 0x07, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x26, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, - 0x65, 0x2e, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x65, 0x74, - 0x61, 0x64, 0x61, 0x74, 0x61, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x48, 0x00, 0x52, 0x08, - 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x12, 0x4e, 0x0a, 0x0c, 0x66, 0x69, 0x6c, 0x74, - 0x65, 0x72, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x65, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x29, + 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x42, + 0x08, 0xfa, 0x42, 0x05, 0x8a, 0x01, 0x02, 0x10, 0x01, 0x52, 0x0f, 0x6d, 0x65, 0x74, 0x61, 0x64, + 0x61, 0x74, 0x61, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x12, 0x57, 0x0a, 0x0f, 0x6d, 0x65, + 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x5f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x18, 0x02, 0x20, + 0x01, 0x28, 0x0e, 0x32, 0x24, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, + 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x65, 0x74, 0x61, 0x64, + 0x61, 0x74, 0x61, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x82, 0x01, + 0x02, 0x10, 0x01, 0x52, 0x0e, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x53, 0x6f, 0x75, + 0x72, 0x63, 0x65, 0x22, 0x8c, 0x09, 0x0a, 0x0a, 0x50, 0x65, 0x72, 0x6d, 0x69, 0x73, 0x73, 0x69, + 0x6f, 0x6e, 0x12, 0x43, 0x0a, 0x09, 0x61, 0x6e, 0x64, 0x5f, 0x72, 0x75, 0x6c, 0x65, 0x73, 0x18, + 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, + 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x65, 0x72, + 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x65, 0x74, 0x48, 0x00, 0x52, 0x08, 0x61, + 0x6e, 0x64, 0x52, 0x75, 0x6c, 0x65, 0x73, 0x12, 0x41, 0x0a, 0x08, 0x6f, 0x72, 0x5f, 0x72, 0x75, + 0x6c, 0x65, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x65, 0x6e, 0x76, 0x6f, + 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x33, + 0x2e, 0x50, 0x65, 0x72, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x65, 0x74, 0x48, + 0x00, 0x52, 0x07, 0x6f, 0x72, 0x52, 0x75, 0x6c, 0x65, 0x73, 0x12, 0x1b, 0x0a, 0x03, 0x61, 0x6e, + 0x79, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x6a, 0x02, 0x08, 0x01, + 0x48, 0x00, 0x52, 0x03, 0x61, 0x6e, 0x79, 0x12, 0x3e, 0x0a, 0x06, 0x68, 0x65, 0x61, 0x64, 0x65, + 0x72, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, + 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x76, 0x33, 0x2e, + 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x48, 0x00, 0x52, + 0x06, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x12, 0x3f, 0x0a, 0x08, 0x75, 0x72, 0x6c, 0x5f, 0x70, + 0x61, 0x74, 0x68, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x65, 0x6e, 0x76, 0x6f, + 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x2e, 0x76, + 0x33, 0x2e, 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x48, 0x00, 0x52, + 0x07, 0x75, 0x72, 0x6c, 0x50, 0x61, 0x74, 0x68, 0x12, 0x48, 0x0a, 0x0e, 0x64, 0x65, 0x73, 0x74, + 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x69, 0x70, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x1f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, + 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x69, 0x64, 0x72, 0x52, 0x61, 0x6e, 0x67, + 0x65, 0x48, 0x00, 0x52, 0x0d, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x49, 0x70, 0x12, 0x36, 0x0a, 0x10, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x5f, 0x70, 0x6f, 0x72, 0x74, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0d, 0x42, 0x09, 0xfa, 0x42, + 0x06, 0x2a, 0x04, 0x18, 0xff, 0xff, 0x03, 0x48, 0x00, 0x52, 0x0f, 0x64, 0x65, 0x73, 0x74, 0x69, + 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x6f, 0x72, 0x74, 0x12, 0x51, 0x0a, 0x16, 0x64, 0x65, + 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x72, + 0x61, 0x6e, 0x67, 0x65, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x65, 0x6e, 0x76, + 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x49, 0x6e, 0x74, 0x33, 0x32, + 0x52, 0x61, 0x6e, 0x67, 0x65, 0x48, 0x00, 0x52, 0x14, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x6f, 0x72, 0x74, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x51, 0x0a, + 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x26, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x6d, 0x61, 0x74, + 0x63, 0x68, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, + 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, + 0x2e, 0x30, 0x18, 0x01, 0x48, 0x00, 0x52, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, + 0x12, 0x3d, 0x0a, 0x08, 0x6e, 0x6f, 0x74, 0x5f, 0x72, 0x75, 0x6c, 0x65, 0x18, 0x08, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, + 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x65, 0x72, 0x6d, 0x69, 0x73, + 0x73, 0x69, 0x6f, 0x6e, 0x48, 0x00, 0x52, 0x07, 0x6e, 0x6f, 0x74, 0x52, 0x75, 0x6c, 0x65, 0x12, + 0x5a, 0x0a, 0x15, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x65, 0x64, 0x5f, 0x73, 0x65, 0x72, + 0x76, 0x65, 0x72, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x6d, 0x61, 0x74, 0x63, - 0x68, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x53, 0x74, 0x61, - 0x74, 0x65, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x48, 0x00, 0x52, 0x0b, 0x66, 0x69, 0x6c, - 0x74, 0x65, 0x72, 0x53, 0x74, 0x61, 0x74, 0x65, 0x12, 0x38, 0x0a, 0x06, 0x6e, 0x6f, 0x74, 0x5f, - 0x69, 0x64, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, - 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x33, 0x2e, - 0x50, 0x72, 0x69, 0x6e, 0x63, 0x69, 0x70, 0x61, 0x6c, 0x48, 0x00, 0x52, 0x05, 0x6e, 0x6f, 0x74, - 0x49, 0x64, 0x1a, 0x6d, 0x0a, 0x03, 0x53, 0x65, 0x74, 0x12, 0x3b, 0x0a, 0x03, 0x69, 0x64, 0x73, - 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, - 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x72, - 0x69, 0x6e, 0x63, 0x69, 0x70, 0x61, 0x6c, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x92, 0x01, 0x02, 0x08, - 0x01, 0x52, 0x03, 0x69, 0x64, 0x73, 0x3a, 0x29, 0x9a, 0xc5, 0x88, 0x1e, 0x24, 0x0a, 0x22, 0x65, - 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, - 0x2e, 0x76, 0x32, 0x2e, 0x50, 0x72, 0x69, 0x6e, 0x63, 0x69, 0x70, 0x61, 0x6c, 0x2e, 0x53, 0x65, - 0x74, 0x1a, 0x97, 0x01, 0x0a, 0x0d, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, - 0x74, 0x65, 0x64, 0x12, 0x4b, 0x0a, 0x0e, 0x70, 0x72, 0x69, 0x6e, 0x63, 0x69, 0x70, 0x61, 0x6c, - 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x65, 0x6e, - 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, - 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, - 0x72, 0x52, 0x0d, 0x70, 0x72, 0x69, 0x6e, 0x63, 0x69, 0x70, 0x61, 0x6c, 0x4e, 0x61, 0x6d, 0x65, - 0x3a, 0x33, 0x9a, 0xc5, 0x88, 0x1e, 0x2e, 0x0a, 0x2c, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, - 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x32, 0x2e, 0x50, 0x72, - 0x69, 0x6e, 0x63, 0x69, 0x70, 0x61, 0x6c, 0x2e, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, - 0x63, 0x61, 0x74, 0x65, 0x64, 0x4a, 0x04, 0x08, 0x01, 0x10, 0x02, 0x3a, 0x25, 0x9a, 0xc5, 0x88, - 0x1e, 0x20, 0x0a, 0x1e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x32, 0x2e, 0x50, 0x72, 0x69, 0x6e, 0x63, 0x69, 0x70, - 0x61, 0x6c, 0x42, 0x11, 0x0a, 0x0a, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x65, 0x72, - 0x12, 0x03, 0xf8, 0x42, 0x01, 0x22, 0x60, 0x0a, 0x06, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, - 0x1b, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, - 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x39, 0x0a, 0x06, - 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x21, 0x2e, 0x65, - 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, - 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x42, 0x41, 0x43, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x52, - 0x06, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x7d, 0xba, 0x80, 0xc8, 0xd1, 0x06, 0x02, 0x10, - 0x02, 0x0a, 0x22, 0x69, 0x6f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, + 0x68, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x4d, 0x61, 0x74, + 0x63, 0x68, 0x65, 0x72, 0x48, 0x00, 0x52, 0x13, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x65, + 0x64, 0x53, 0x65, 0x72, 0x76, 0x65, 0x72, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x46, 0x0a, 0x07, 0x6d, + 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x65, + 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, + 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x79, 0x70, 0x65, 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, + 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x48, 0x00, 0x52, 0x07, 0x6d, 0x61, 0x74, 0x63, + 0x68, 0x65, 0x72, 0x12, 0x4f, 0x0a, 0x0c, 0x75, 0x72, 0x69, 0x5f, 0x74, 0x65, 0x6d, 0x70, 0x6c, + 0x61, 0x74, 0x65, 0x18, 0x0d, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, + 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, + 0x2e, 0x54, 0x79, 0x70, 0x65, 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x43, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x48, 0x00, 0x52, 0x0b, 0x75, 0x72, 0x69, 0x54, 0x65, 0x6d, 0x70, + 0x6c, 0x61, 0x74, 0x65, 0x12, 0x52, 0x0a, 0x10, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x64, 0x5f, + 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x18, 0x0e, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x25, + 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x62, + 0x61, 0x63, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x64, 0x4d, 0x65, 0x74, + 0x61, 0x64, 0x61, 0x74, 0x61, 0x48, 0x00, 0x52, 0x0f, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x64, + 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x1a, 0x73, 0x0a, 0x03, 0x53, 0x65, 0x74, 0x12, + 0x40, 0x0a, 0x05, 0x72, 0x75, 0x6c, 0x65, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x62, - 0x61, 0x63, 0x2e, 0x76, 0x33, 0x42, 0x09, 0x52, 0x62, 0x61, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, - 0x50, 0x01, 0x5a, 0x42, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x65, - 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2f, 0x67, 0x6f, 0x2d, 0x63, 0x6f, 0x6e, - 0x74, 0x72, 0x6f, 0x6c, 0x2d, 0x70, 0x6c, 0x61, 0x6e, 0x65, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, - 0x2f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2f, 0x72, 0x62, 0x61, 0x63, 0x2f, 0x76, 0x33, 0x3b, - 0x72, 0x62, 0x61, 0x63, 0x76, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x61, 0x63, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x65, 0x72, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, + 0x42, 0x08, 0xfa, 0x42, 0x05, 0x92, 0x01, 0x02, 0x08, 0x01, 0x52, 0x05, 0x72, 0x75, 0x6c, 0x65, + 0x73, 0x3a, 0x2a, 0x9a, 0xc5, 0x88, 0x1e, 0x25, 0x0a, 0x23, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, + 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x32, 0x2e, 0x50, + 0x65, 0x72, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x65, 0x74, 0x3a, 0x26, 0x9a, + 0xc5, 0x88, 0x1e, 0x21, 0x0a, 0x1f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, + 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x32, 0x2e, 0x50, 0x65, 0x72, 0x6d, 0x69, + 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x42, 0x0b, 0x0a, 0x04, 0x72, 0x75, 0x6c, 0x65, 0x12, 0x03, 0xf8, + 0x42, 0x01, 0x22, 0xcc, 0x09, 0x0a, 0x09, 0x50, 0x72, 0x69, 0x6e, 0x63, 0x69, 0x70, 0x61, 0x6c, + 0x12, 0x3e, 0x0a, 0x07, 0x61, 0x6e, 0x64, 0x5f, 0x69, 0x64, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x23, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, + 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x72, 0x69, 0x6e, 0x63, 0x69, 0x70, + 0x61, 0x6c, 0x2e, 0x53, 0x65, 0x74, 0x48, 0x00, 0x52, 0x06, 0x61, 0x6e, 0x64, 0x49, 0x64, 0x73, + 0x12, 0x3c, 0x0a, 0x06, 0x6f, 0x72, 0x5f, 0x69, 0x64, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x23, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, + 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x72, 0x69, 0x6e, 0x63, 0x69, 0x70, 0x61, + 0x6c, 0x2e, 0x53, 0x65, 0x74, 0x48, 0x00, 0x52, 0x05, 0x6f, 0x72, 0x49, 0x64, 0x73, 0x12, 0x1b, + 0x0a, 0x03, 0x61, 0x6e, 0x79, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x42, 0x07, 0xfa, 0x42, 0x04, + 0x6a, 0x02, 0x08, 0x01, 0x48, 0x00, 0x52, 0x03, 0x61, 0x6e, 0x79, 0x12, 0x55, 0x0a, 0x0d, 0x61, + 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x04, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x2d, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, + 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x72, 0x69, 0x6e, 0x63, 0x69, + 0x70, 0x61, 0x6c, 0x2e, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x65, + 0x64, 0x48, 0x00, 0x52, 0x0d, 0x61, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, + 0x65, 0x64, 0x12, 0x4b, 0x0a, 0x09, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x69, 0x70, 0x18, + 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, + 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x69, 0x64, + 0x72, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, + 0x30, 0x18, 0x01, 0x48, 0x00, 0x52, 0x08, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x49, 0x70, 0x12, + 0x4b, 0x0a, 0x10, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x5f, 0x72, 0x65, 0x6d, 0x6f, 0x74, 0x65, + 0x5f, 0x69, 0x70, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, + 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, + 0x2e, 0x43, 0x69, 0x64, 0x72, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x48, 0x00, 0x52, 0x0e, 0x64, 0x69, + 0x72, 0x65, 0x63, 0x74, 0x52, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x49, 0x70, 0x12, 0x3e, 0x0a, 0x09, + 0x72, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x5f, 0x69, 0x70, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x1f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, + 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x69, 0x64, 0x72, 0x52, 0x61, 0x6e, 0x67, 0x65, + 0x48, 0x00, 0x52, 0x08, 0x72, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x49, 0x70, 0x12, 0x3e, 0x0a, 0x06, + 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x65, + 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x6f, 0x75, 0x74, + 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x4d, 0x61, 0x74, 0x63, 0x68, + 0x65, 0x72, 0x48, 0x00, 0x52, 0x06, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x12, 0x3f, 0x0a, 0x08, + 0x75, 0x72, 0x6c, 0x5f, 0x70, 0x61, 0x74, 0x68, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, + 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x6d, 0x61, 0x74, 0x63, + 0x68, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x61, 0x74, 0x68, 0x4d, 0x61, 0x74, 0x63, 0x68, + 0x65, 0x72, 0x48, 0x00, 0x52, 0x07, 0x75, 0x72, 0x6c, 0x50, 0x61, 0x74, 0x68, 0x12, 0x51, 0x0a, + 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x26, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x6d, 0x61, 0x74, + 0x63, 0x68, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, + 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, + 0x2e, 0x30, 0x18, 0x01, 0x48, 0x00, 0x52, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, + 0x12, 0x4e, 0x0a, 0x0c, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x65, + 0x18, 0x0c, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x29, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, + 0x79, 0x70, 0x65, 0x2e, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x46, + 0x69, 0x6c, 0x74, 0x65, 0x72, 0x53, 0x74, 0x61, 0x74, 0x65, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, + 0x72, 0x48, 0x00, 0x52, 0x0b, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x53, 0x74, 0x61, 0x74, 0x65, + 0x12, 0x38, 0x0a, 0x06, 0x6e, 0x6f, 0x74, 0x5f, 0x69, 0x64, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x1f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, + 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x72, 0x69, 0x6e, 0x63, 0x69, 0x70, 0x61, + 0x6c, 0x48, 0x00, 0x52, 0x05, 0x6e, 0x6f, 0x74, 0x49, 0x64, 0x12, 0x52, 0x0a, 0x10, 0x73, 0x6f, + 0x75, 0x72, 0x63, 0x65, 0x64, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x18, 0x0d, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x6f, 0x75, 0x72, + 0x63, 0x65, 0x64, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x48, 0x00, 0x52, 0x0f, 0x73, + 0x6f, 0x75, 0x72, 0x63, 0x65, 0x64, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x1a, 0x6d, + 0x0a, 0x03, 0x53, 0x65, 0x74, 0x12, 0x3b, 0x0a, 0x03, 0x69, 0x64, 0x73, 0x18, 0x01, 0x20, 0x03, + 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, + 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x33, 0x2e, 0x50, 0x72, 0x69, 0x6e, 0x63, 0x69, + 0x70, 0x61, 0x6c, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x92, 0x01, 0x02, 0x08, 0x01, 0x52, 0x03, 0x69, + 0x64, 0x73, 0x3a, 0x29, 0x9a, 0xc5, 0x88, 0x1e, 0x24, 0x0a, 0x22, 0x65, 0x6e, 0x76, 0x6f, 0x79, + 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x32, 0x2e, + 0x50, 0x72, 0x69, 0x6e, 0x63, 0x69, 0x70, 0x61, 0x6c, 0x2e, 0x53, 0x65, 0x74, 0x1a, 0x97, 0x01, + 0x0a, 0x0d, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, + 0x4b, 0x0a, 0x0e, 0x70, 0x72, 0x69, 0x6e, 0x63, 0x69, 0x70, 0x61, 0x6c, 0x5f, 0x6e, 0x61, 0x6d, + 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, + 0x74, 0x79, 0x70, 0x65, 0x2e, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, + 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x52, 0x0d, 0x70, + 0x72, 0x69, 0x6e, 0x63, 0x69, 0x70, 0x61, 0x6c, 0x4e, 0x61, 0x6d, 0x65, 0x3a, 0x33, 0x9a, 0xc5, + 0x88, 0x1e, 0x2e, 0x0a, 0x2c, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, + 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x32, 0x2e, 0x50, 0x72, 0x69, 0x6e, 0x63, 0x69, + 0x70, 0x61, 0x6c, 0x2e, 0x41, 0x75, 0x74, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x63, 0x61, 0x74, 0x65, + 0x64, 0x4a, 0x04, 0x08, 0x01, 0x10, 0x02, 0x3a, 0x25, 0x9a, 0xc5, 0x88, 0x1e, 0x20, 0x0a, 0x1e, + 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, + 0x63, 0x2e, 0x76, 0x32, 0x2e, 0x50, 0x72, 0x69, 0x6e, 0x63, 0x69, 0x70, 0x61, 0x6c, 0x42, 0x11, + 0x0a, 0x0a, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x65, 0x72, 0x12, 0x03, 0xf8, 0x42, + 0x01, 0x22, 0x60, 0x0a, 0x06, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1b, 0x0a, 0x04, 0x6e, + 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, + 0x10, 0x01, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x39, 0x0a, 0x06, 0x61, 0x63, 0x74, 0x69, + 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x21, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, + 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x33, 0x2e, + 0x52, 0x42, 0x41, 0x43, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x06, 0x61, 0x63, 0x74, + 0x69, 0x6f, 0x6e, 0x2a, 0x28, 0x0a, 0x0e, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x53, + 0x6f, 0x75, 0x72, 0x63, 0x65, 0x12, 0x0b, 0x0a, 0x07, 0x44, 0x59, 0x4e, 0x41, 0x4d, 0x49, 0x43, + 0x10, 0x00, 0x12, 0x09, 0x0a, 0x05, 0x52, 0x4f, 0x55, 0x54, 0x45, 0x10, 0x01, 0x42, 0x7d, 0xba, + 0x80, 0xc8, 0xd1, 0x06, 0x02, 0x10, 0x02, 0x0a, 0x22, 0x69, 0x6f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, + 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x2e, 0x72, 0x62, 0x61, 0x63, 0x2e, 0x76, 0x33, 0x42, 0x09, 0x52, 0x62, 0x61, + 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x42, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, + 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2f, + 0x67, 0x6f, 0x2d, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x2d, 0x70, 0x6c, 0x61, 0x6e, 0x65, + 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2f, 0x72, 0x62, + 0x61, 0x63, 0x2f, 0x76, 0x33, 0x3b, 0x72, 0x62, 0x61, 0x63, 0x76, 0x33, 0x62, 0x06, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x33, } var ( @@ -1538,76 +1721,82 @@ func file_envoy_config_rbac_v3_rbac_proto_rawDescGZIP() []byte { return file_envoy_config_rbac_v3_rbac_proto_rawDescData } -var file_envoy_config_rbac_v3_rbac_proto_enumTypes = make([]protoimpl.EnumInfo, 2) -var file_envoy_config_rbac_v3_rbac_proto_msgTypes = make([]protoimpl.MessageInfo, 11) +var file_envoy_config_rbac_v3_rbac_proto_enumTypes = make([]protoimpl.EnumInfo, 3) +var file_envoy_config_rbac_v3_rbac_proto_msgTypes = make([]protoimpl.MessageInfo, 12) var file_envoy_config_rbac_v3_rbac_proto_goTypes = []interface{}{ - (RBAC_Action)(0), // 0: envoy.config.rbac.v3.RBAC.Action - (RBAC_AuditLoggingOptions_AuditCondition)(0), // 1: envoy.config.rbac.v3.RBAC.AuditLoggingOptions.AuditCondition - (*RBAC)(nil), // 2: envoy.config.rbac.v3.RBAC - (*Policy)(nil), // 3: envoy.config.rbac.v3.Policy - (*Permission)(nil), // 4: envoy.config.rbac.v3.Permission - (*Principal)(nil), // 5: envoy.config.rbac.v3.Principal - (*Action)(nil), // 6: envoy.config.rbac.v3.Action - (*RBAC_AuditLoggingOptions)(nil), // 7: envoy.config.rbac.v3.RBAC.AuditLoggingOptions - nil, // 8: envoy.config.rbac.v3.RBAC.PoliciesEntry - (*RBAC_AuditLoggingOptions_AuditLoggerConfig)(nil), // 9: envoy.config.rbac.v3.RBAC.AuditLoggingOptions.AuditLoggerConfig - (*Permission_Set)(nil), // 10: envoy.config.rbac.v3.Permission.Set - (*Principal_Set)(nil), // 11: envoy.config.rbac.v3.Principal.Set - (*Principal_Authenticated)(nil), // 12: envoy.config.rbac.v3.Principal.Authenticated - (*v1alpha1.Expr)(nil), // 13: google.api.expr.v1alpha1.Expr - (*v1alpha1.CheckedExpr)(nil), // 14: google.api.expr.v1alpha1.CheckedExpr - (*v3.HeaderMatcher)(nil), // 15: envoy.config.route.v3.HeaderMatcher - (*v31.PathMatcher)(nil), // 16: envoy.type.matcher.v3.PathMatcher - (*v32.CidrRange)(nil), // 17: envoy.config.core.v3.CidrRange - (*v33.Int32Range)(nil), // 18: envoy.type.v3.Int32Range - (*v31.MetadataMatcher)(nil), // 19: envoy.type.matcher.v3.MetadataMatcher - (*v31.StringMatcher)(nil), // 20: envoy.type.matcher.v3.StringMatcher - (*v32.TypedExtensionConfig)(nil), // 21: envoy.config.core.v3.TypedExtensionConfig - (*v31.FilterStateMatcher)(nil), // 22: envoy.type.matcher.v3.FilterStateMatcher + (MetadataSource)(0), // 0: envoy.config.rbac.v3.MetadataSource + (RBAC_Action)(0), // 1: envoy.config.rbac.v3.RBAC.Action + (RBAC_AuditLoggingOptions_AuditCondition)(0), // 2: envoy.config.rbac.v3.RBAC.AuditLoggingOptions.AuditCondition + (*RBAC)(nil), // 3: envoy.config.rbac.v3.RBAC + (*Policy)(nil), // 4: envoy.config.rbac.v3.Policy + (*SourcedMetadata)(nil), // 5: envoy.config.rbac.v3.SourcedMetadata + (*Permission)(nil), // 6: envoy.config.rbac.v3.Permission + (*Principal)(nil), // 7: envoy.config.rbac.v3.Principal + (*Action)(nil), // 8: envoy.config.rbac.v3.Action + (*RBAC_AuditLoggingOptions)(nil), // 9: envoy.config.rbac.v3.RBAC.AuditLoggingOptions + nil, // 10: envoy.config.rbac.v3.RBAC.PoliciesEntry + (*RBAC_AuditLoggingOptions_AuditLoggerConfig)(nil), // 11: envoy.config.rbac.v3.RBAC.AuditLoggingOptions.AuditLoggerConfig + (*Permission_Set)(nil), // 12: envoy.config.rbac.v3.Permission.Set + (*Principal_Set)(nil), // 13: envoy.config.rbac.v3.Principal.Set + (*Principal_Authenticated)(nil), // 14: envoy.config.rbac.v3.Principal.Authenticated + (*v1alpha1.Expr)(nil), // 15: google.api.expr.v1alpha1.Expr + (*v1alpha1.CheckedExpr)(nil), // 16: google.api.expr.v1alpha1.CheckedExpr + (*v3.MetadataMatcher)(nil), // 17: envoy.type.matcher.v3.MetadataMatcher + (*v31.HeaderMatcher)(nil), // 18: envoy.config.route.v3.HeaderMatcher + (*v3.PathMatcher)(nil), // 19: envoy.type.matcher.v3.PathMatcher + (*v32.CidrRange)(nil), // 20: envoy.config.core.v3.CidrRange + (*v33.Int32Range)(nil), // 21: envoy.type.v3.Int32Range + (*v3.StringMatcher)(nil), // 22: envoy.type.matcher.v3.StringMatcher + (*v32.TypedExtensionConfig)(nil), // 23: envoy.config.core.v3.TypedExtensionConfig + (*v3.FilterStateMatcher)(nil), // 24: envoy.type.matcher.v3.FilterStateMatcher } var file_envoy_config_rbac_v3_rbac_proto_depIdxs = []int32{ - 0, // 0: envoy.config.rbac.v3.RBAC.action:type_name -> envoy.config.rbac.v3.RBAC.Action - 8, // 1: envoy.config.rbac.v3.RBAC.policies:type_name -> envoy.config.rbac.v3.RBAC.PoliciesEntry - 7, // 2: envoy.config.rbac.v3.RBAC.audit_logging_options:type_name -> envoy.config.rbac.v3.RBAC.AuditLoggingOptions - 4, // 3: envoy.config.rbac.v3.Policy.permissions:type_name -> envoy.config.rbac.v3.Permission - 5, // 4: envoy.config.rbac.v3.Policy.principals:type_name -> envoy.config.rbac.v3.Principal - 13, // 5: envoy.config.rbac.v3.Policy.condition:type_name -> google.api.expr.v1alpha1.Expr - 14, // 6: envoy.config.rbac.v3.Policy.checked_condition:type_name -> google.api.expr.v1alpha1.CheckedExpr - 10, // 7: envoy.config.rbac.v3.Permission.and_rules:type_name -> envoy.config.rbac.v3.Permission.Set - 10, // 8: envoy.config.rbac.v3.Permission.or_rules:type_name -> envoy.config.rbac.v3.Permission.Set - 15, // 9: envoy.config.rbac.v3.Permission.header:type_name -> envoy.config.route.v3.HeaderMatcher - 16, // 10: envoy.config.rbac.v3.Permission.url_path:type_name -> envoy.type.matcher.v3.PathMatcher - 17, // 11: envoy.config.rbac.v3.Permission.destination_ip:type_name -> envoy.config.core.v3.CidrRange - 18, // 12: envoy.config.rbac.v3.Permission.destination_port_range:type_name -> envoy.type.v3.Int32Range - 19, // 13: envoy.config.rbac.v3.Permission.metadata:type_name -> envoy.type.matcher.v3.MetadataMatcher - 4, // 14: envoy.config.rbac.v3.Permission.not_rule:type_name -> envoy.config.rbac.v3.Permission - 20, // 15: envoy.config.rbac.v3.Permission.requested_server_name:type_name -> envoy.type.matcher.v3.StringMatcher - 21, // 16: envoy.config.rbac.v3.Permission.matcher:type_name -> envoy.config.core.v3.TypedExtensionConfig - 21, // 17: envoy.config.rbac.v3.Permission.uri_template:type_name -> envoy.config.core.v3.TypedExtensionConfig - 11, // 18: envoy.config.rbac.v3.Principal.and_ids:type_name -> envoy.config.rbac.v3.Principal.Set - 11, // 19: envoy.config.rbac.v3.Principal.or_ids:type_name -> envoy.config.rbac.v3.Principal.Set - 12, // 20: envoy.config.rbac.v3.Principal.authenticated:type_name -> envoy.config.rbac.v3.Principal.Authenticated - 17, // 21: envoy.config.rbac.v3.Principal.source_ip:type_name -> envoy.config.core.v3.CidrRange - 17, // 22: envoy.config.rbac.v3.Principal.direct_remote_ip:type_name -> envoy.config.core.v3.CidrRange - 17, // 23: envoy.config.rbac.v3.Principal.remote_ip:type_name -> envoy.config.core.v3.CidrRange - 15, // 24: envoy.config.rbac.v3.Principal.header:type_name -> envoy.config.route.v3.HeaderMatcher - 16, // 25: envoy.config.rbac.v3.Principal.url_path:type_name -> envoy.type.matcher.v3.PathMatcher - 19, // 26: envoy.config.rbac.v3.Principal.metadata:type_name -> envoy.type.matcher.v3.MetadataMatcher - 22, // 27: envoy.config.rbac.v3.Principal.filter_state:type_name -> envoy.type.matcher.v3.FilterStateMatcher - 5, // 28: envoy.config.rbac.v3.Principal.not_id:type_name -> envoy.config.rbac.v3.Principal - 0, // 29: envoy.config.rbac.v3.Action.action:type_name -> envoy.config.rbac.v3.RBAC.Action - 1, // 30: envoy.config.rbac.v3.RBAC.AuditLoggingOptions.audit_condition:type_name -> envoy.config.rbac.v3.RBAC.AuditLoggingOptions.AuditCondition - 9, // 31: envoy.config.rbac.v3.RBAC.AuditLoggingOptions.logger_configs:type_name -> envoy.config.rbac.v3.RBAC.AuditLoggingOptions.AuditLoggerConfig - 3, // 32: envoy.config.rbac.v3.RBAC.PoliciesEntry.value:type_name -> envoy.config.rbac.v3.Policy - 21, // 33: envoy.config.rbac.v3.RBAC.AuditLoggingOptions.AuditLoggerConfig.audit_logger:type_name -> envoy.config.core.v3.TypedExtensionConfig - 4, // 34: envoy.config.rbac.v3.Permission.Set.rules:type_name -> envoy.config.rbac.v3.Permission - 5, // 35: envoy.config.rbac.v3.Principal.Set.ids:type_name -> envoy.config.rbac.v3.Principal - 20, // 36: envoy.config.rbac.v3.Principal.Authenticated.principal_name:type_name -> envoy.type.matcher.v3.StringMatcher - 37, // [37:37] is the sub-list for method output_type - 37, // [37:37] is the sub-list for method input_type - 37, // [37:37] is the sub-list for extension type_name - 37, // [37:37] is the sub-list for extension extendee - 0, // [0:37] is the sub-list for field type_name + 1, // 0: envoy.config.rbac.v3.RBAC.action:type_name -> envoy.config.rbac.v3.RBAC.Action + 10, // 1: envoy.config.rbac.v3.RBAC.policies:type_name -> envoy.config.rbac.v3.RBAC.PoliciesEntry + 9, // 2: envoy.config.rbac.v3.RBAC.audit_logging_options:type_name -> envoy.config.rbac.v3.RBAC.AuditLoggingOptions + 6, // 3: envoy.config.rbac.v3.Policy.permissions:type_name -> envoy.config.rbac.v3.Permission + 7, // 4: envoy.config.rbac.v3.Policy.principals:type_name -> envoy.config.rbac.v3.Principal + 15, // 5: envoy.config.rbac.v3.Policy.condition:type_name -> google.api.expr.v1alpha1.Expr + 16, // 6: envoy.config.rbac.v3.Policy.checked_condition:type_name -> google.api.expr.v1alpha1.CheckedExpr + 17, // 7: envoy.config.rbac.v3.SourcedMetadata.metadata_matcher:type_name -> envoy.type.matcher.v3.MetadataMatcher + 0, // 8: envoy.config.rbac.v3.SourcedMetadata.metadata_source:type_name -> envoy.config.rbac.v3.MetadataSource + 12, // 9: envoy.config.rbac.v3.Permission.and_rules:type_name -> envoy.config.rbac.v3.Permission.Set + 12, // 10: envoy.config.rbac.v3.Permission.or_rules:type_name -> envoy.config.rbac.v3.Permission.Set + 18, // 11: envoy.config.rbac.v3.Permission.header:type_name -> envoy.config.route.v3.HeaderMatcher + 19, // 12: envoy.config.rbac.v3.Permission.url_path:type_name -> envoy.type.matcher.v3.PathMatcher + 20, // 13: envoy.config.rbac.v3.Permission.destination_ip:type_name -> envoy.config.core.v3.CidrRange + 21, // 14: envoy.config.rbac.v3.Permission.destination_port_range:type_name -> envoy.type.v3.Int32Range + 17, // 15: envoy.config.rbac.v3.Permission.metadata:type_name -> envoy.type.matcher.v3.MetadataMatcher + 6, // 16: envoy.config.rbac.v3.Permission.not_rule:type_name -> envoy.config.rbac.v3.Permission + 22, // 17: envoy.config.rbac.v3.Permission.requested_server_name:type_name -> envoy.type.matcher.v3.StringMatcher + 23, // 18: envoy.config.rbac.v3.Permission.matcher:type_name -> envoy.config.core.v3.TypedExtensionConfig + 23, // 19: envoy.config.rbac.v3.Permission.uri_template:type_name -> envoy.config.core.v3.TypedExtensionConfig + 5, // 20: envoy.config.rbac.v3.Permission.sourced_metadata:type_name -> envoy.config.rbac.v3.SourcedMetadata + 13, // 21: envoy.config.rbac.v3.Principal.and_ids:type_name -> envoy.config.rbac.v3.Principal.Set + 13, // 22: envoy.config.rbac.v3.Principal.or_ids:type_name -> envoy.config.rbac.v3.Principal.Set + 14, // 23: envoy.config.rbac.v3.Principal.authenticated:type_name -> envoy.config.rbac.v3.Principal.Authenticated + 20, // 24: envoy.config.rbac.v3.Principal.source_ip:type_name -> envoy.config.core.v3.CidrRange + 20, // 25: envoy.config.rbac.v3.Principal.direct_remote_ip:type_name -> envoy.config.core.v3.CidrRange + 20, // 26: envoy.config.rbac.v3.Principal.remote_ip:type_name -> envoy.config.core.v3.CidrRange + 18, // 27: envoy.config.rbac.v3.Principal.header:type_name -> envoy.config.route.v3.HeaderMatcher + 19, // 28: envoy.config.rbac.v3.Principal.url_path:type_name -> envoy.type.matcher.v3.PathMatcher + 17, // 29: envoy.config.rbac.v3.Principal.metadata:type_name -> envoy.type.matcher.v3.MetadataMatcher + 24, // 30: envoy.config.rbac.v3.Principal.filter_state:type_name -> envoy.type.matcher.v3.FilterStateMatcher + 7, // 31: envoy.config.rbac.v3.Principal.not_id:type_name -> envoy.config.rbac.v3.Principal + 5, // 32: envoy.config.rbac.v3.Principal.sourced_metadata:type_name -> envoy.config.rbac.v3.SourcedMetadata + 1, // 33: envoy.config.rbac.v3.Action.action:type_name -> envoy.config.rbac.v3.RBAC.Action + 2, // 34: envoy.config.rbac.v3.RBAC.AuditLoggingOptions.audit_condition:type_name -> envoy.config.rbac.v3.RBAC.AuditLoggingOptions.AuditCondition + 11, // 35: envoy.config.rbac.v3.RBAC.AuditLoggingOptions.logger_configs:type_name -> envoy.config.rbac.v3.RBAC.AuditLoggingOptions.AuditLoggerConfig + 4, // 36: envoy.config.rbac.v3.RBAC.PoliciesEntry.value:type_name -> envoy.config.rbac.v3.Policy + 23, // 37: envoy.config.rbac.v3.RBAC.AuditLoggingOptions.AuditLoggerConfig.audit_logger:type_name -> envoy.config.core.v3.TypedExtensionConfig + 6, // 38: envoy.config.rbac.v3.Permission.Set.rules:type_name -> envoy.config.rbac.v3.Permission + 7, // 39: envoy.config.rbac.v3.Principal.Set.ids:type_name -> envoy.config.rbac.v3.Principal + 22, // 40: envoy.config.rbac.v3.Principal.Authenticated.principal_name:type_name -> envoy.type.matcher.v3.StringMatcher + 41, // [41:41] is the sub-list for method output_type + 41, // [41:41] is the sub-list for method input_type + 41, // [41:41] is the sub-list for extension type_name + 41, // [41:41] is the sub-list for extension extendee + 0, // [0:41] is the sub-list for field type_name } func init() { file_envoy_config_rbac_v3_rbac_proto_init() } @@ -1641,7 +1830,7 @@ func file_envoy_config_rbac_v3_rbac_proto_init() { } } file_envoy_config_rbac_v3_rbac_proto_msgTypes[2].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*Permission); i { + switch v := v.(*SourcedMetadata); i { case 0: return &v.state case 1: @@ -1653,7 +1842,7 @@ func file_envoy_config_rbac_v3_rbac_proto_init() { } } file_envoy_config_rbac_v3_rbac_proto_msgTypes[3].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*Principal); i { + switch v := v.(*Permission); i { case 0: return &v.state case 1: @@ -1665,7 +1854,7 @@ func file_envoy_config_rbac_v3_rbac_proto_init() { } } file_envoy_config_rbac_v3_rbac_proto_msgTypes[4].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*Action); i { + switch v := v.(*Principal); i { case 0: return &v.state case 1: @@ -1677,6 +1866,18 @@ func file_envoy_config_rbac_v3_rbac_proto_init() { } } file_envoy_config_rbac_v3_rbac_proto_msgTypes[5].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*Action); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_envoy_config_rbac_v3_rbac_proto_msgTypes[6].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*RBAC_AuditLoggingOptions); i { case 0: return &v.state @@ -1688,7 +1889,7 @@ func file_envoy_config_rbac_v3_rbac_proto_init() { return nil } } - file_envoy_config_rbac_v3_rbac_proto_msgTypes[7].Exporter = func(v interface{}, i int) interface{} { + file_envoy_config_rbac_v3_rbac_proto_msgTypes[8].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*RBAC_AuditLoggingOptions_AuditLoggerConfig); i { case 0: return &v.state @@ -1700,7 +1901,7 @@ func file_envoy_config_rbac_v3_rbac_proto_init() { return nil } } - file_envoy_config_rbac_v3_rbac_proto_msgTypes[8].Exporter = func(v interface{}, i int) interface{} { + file_envoy_config_rbac_v3_rbac_proto_msgTypes[9].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*Permission_Set); i { case 0: return &v.state @@ -1712,7 +1913,7 @@ func file_envoy_config_rbac_v3_rbac_proto_init() { return nil } } - file_envoy_config_rbac_v3_rbac_proto_msgTypes[9].Exporter = func(v interface{}, i int) interface{} { + file_envoy_config_rbac_v3_rbac_proto_msgTypes[10].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*Principal_Set); i { case 0: return &v.state @@ -1724,7 +1925,7 @@ func file_envoy_config_rbac_v3_rbac_proto_init() { return nil } } - file_envoy_config_rbac_v3_rbac_proto_msgTypes[10].Exporter = func(v interface{}, i int) interface{} { + file_envoy_config_rbac_v3_rbac_proto_msgTypes[11].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*Principal_Authenticated); i { case 0: return &v.state @@ -1737,7 +1938,7 @@ func file_envoy_config_rbac_v3_rbac_proto_init() { } } } - file_envoy_config_rbac_v3_rbac_proto_msgTypes[2].OneofWrappers = []interface{}{ + file_envoy_config_rbac_v3_rbac_proto_msgTypes[3].OneofWrappers = []interface{}{ (*Permission_AndRules)(nil), (*Permission_OrRules)(nil), (*Permission_Any)(nil), @@ -1751,8 +1952,9 @@ func file_envoy_config_rbac_v3_rbac_proto_init() { (*Permission_RequestedServerName)(nil), (*Permission_Matcher)(nil), (*Permission_UriTemplate)(nil), + (*Permission_SourcedMetadata)(nil), } - file_envoy_config_rbac_v3_rbac_proto_msgTypes[3].OneofWrappers = []interface{}{ + file_envoy_config_rbac_v3_rbac_proto_msgTypes[4].OneofWrappers = []interface{}{ (*Principal_AndIds)(nil), (*Principal_OrIds)(nil), (*Principal_Any)(nil), @@ -1765,14 +1967,15 @@ func file_envoy_config_rbac_v3_rbac_proto_init() { (*Principal_Metadata)(nil), (*Principal_FilterState)(nil), (*Principal_NotId)(nil), + (*Principal_SourcedMetadata)(nil), } type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ GoPackagePath: reflect.TypeOf(x{}).PkgPath(), RawDescriptor: file_envoy_config_rbac_v3_rbac_proto_rawDesc, - NumEnums: 2, - NumMessages: 11, + NumEnums: 3, + NumMessages: 12, NumExtensions: 0, NumServices: 0, }, diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/rbac/v3/rbac.pb.validate.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/rbac/v3/rbac.pb.validate.go index f80fd60974a00..b05cba27a43c4 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/rbac/v3/rbac.pb.validate.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/rbac/v3/rbac.pb.validate.go @@ -466,6 +466,157 @@ var _ interface { ErrorName() string } = PolicyValidationError{} +// Validate checks the field values on SourcedMetadata with the rules defined +// in the proto definition for this message. If any rules are violated, the +// first error encountered is returned, or nil if there are no violations. +func (m *SourcedMetadata) Validate() error { + return m.validate(false) +} + +// ValidateAll checks the field values on SourcedMetadata with the rules +// defined in the proto definition for this message. If any rules are +// violated, the result is a list of violation errors wrapped in +// SourcedMetadataMultiError, or nil if none found. +func (m *SourcedMetadata) ValidateAll() error { + return m.validate(true) +} + +func (m *SourcedMetadata) validate(all bool) error { + if m == nil { + return nil + } + + var errors []error + + if m.GetMetadataMatcher() == nil { + err := SourcedMetadataValidationError{ + field: "MetadataMatcher", + reason: "value is required", + } + if !all { + return err + } + errors = append(errors, err) + } + + if all { + switch v := interface{}(m.GetMetadataMatcher()).(type) { + case interface{ ValidateAll() error }: + if err := v.ValidateAll(); err != nil { + errors = append(errors, SourcedMetadataValidationError{ + field: "MetadataMatcher", + reason: "embedded message failed validation", + cause: err, + }) + } + case interface{ Validate() error }: + if err := v.Validate(); err != nil { + errors = append(errors, SourcedMetadataValidationError{ + field: "MetadataMatcher", + reason: "embedded message failed validation", + cause: err, + }) + } + } + } else if v, ok := interface{}(m.GetMetadataMatcher()).(interface{ Validate() error }); ok { + if err := v.Validate(); err != nil { + return SourcedMetadataValidationError{ + field: "MetadataMatcher", + reason: "embedded message failed validation", + cause: err, + } + } + } + + if _, ok := MetadataSource_name[int32(m.GetMetadataSource())]; !ok { + err := SourcedMetadataValidationError{ + field: "MetadataSource", + reason: "value must be one of the defined enum values", + } + if !all { + return err + } + errors = append(errors, err) + } + + if len(errors) > 0 { + return SourcedMetadataMultiError(errors) + } + + return nil +} + +// SourcedMetadataMultiError is an error wrapping multiple validation errors +// returned by SourcedMetadata.ValidateAll() if the designated constraints +// aren't met. +type SourcedMetadataMultiError []error + +// Error returns a concatenation of all the error messages it wraps. +func (m SourcedMetadataMultiError) Error() string { + var msgs []string + for _, err := range m { + msgs = append(msgs, err.Error()) + } + return strings.Join(msgs, "; ") +} + +// AllErrors returns a list of validation violation errors. +func (m SourcedMetadataMultiError) AllErrors() []error { return m } + +// SourcedMetadataValidationError is the validation error returned by +// SourcedMetadata.Validate if the designated constraints aren't met. +type SourcedMetadataValidationError struct { + field string + reason string + cause error + key bool +} + +// Field function returns field value. +func (e SourcedMetadataValidationError) Field() string { return e.field } + +// Reason function returns reason value. +func (e SourcedMetadataValidationError) Reason() string { return e.reason } + +// Cause function returns cause value. +func (e SourcedMetadataValidationError) Cause() error { return e.cause } + +// Key function returns key value. +func (e SourcedMetadataValidationError) Key() bool { return e.key } + +// ErrorName returns error name. +func (e SourcedMetadataValidationError) ErrorName() string { return "SourcedMetadataValidationError" } + +// Error satisfies the builtin error interface +func (e SourcedMetadataValidationError) Error() string { + cause := "" + if e.cause != nil { + cause = fmt.Sprintf(" | caused by: %v", e.cause) + } + + key := "" + if e.key { + key = "key for " + } + + return fmt.Sprintf( + "invalid %sSourcedMetadata.%s: %s%s", + key, + e.field, + e.reason, + cause) +} + +var _ error = SourcedMetadataValidationError{} + +var _ interface { + Field() string + Reason() string + Key() bool + Cause() error + ErrorName() string +} = SourcedMetadataValidationError{} + // Validate checks the field values on Permission with the rules defined in the // proto definition for this message. If any rules are violated, the first // error encountered is returned, or nil if there are no violations. @@ -1000,6 +1151,48 @@ func (m *Permission) validate(all bool) error { } } + case *Permission_SourcedMetadata: + if v == nil { + err := PermissionValidationError{ + field: "Rule", + reason: "oneof value cannot be a typed-nil", + } + if !all { + return err + } + errors = append(errors, err) + } + oneofRulePresent = true + + if all { + switch v := interface{}(m.GetSourcedMetadata()).(type) { + case interface{ ValidateAll() error }: + if err := v.ValidateAll(); err != nil { + errors = append(errors, PermissionValidationError{ + field: "SourcedMetadata", + reason: "embedded message failed validation", + cause: err, + }) + } + case interface{ Validate() error }: + if err := v.Validate(); err != nil { + errors = append(errors, PermissionValidationError{ + field: "SourcedMetadata", + reason: "embedded message failed validation", + cause: err, + }) + } + } + } else if v, ok := interface{}(m.GetSourcedMetadata()).(interface{ Validate() error }); ok { + if err := v.Validate(); err != nil { + return PermissionValidationError{ + field: "SourcedMetadata", + reason: "embedded message failed validation", + cause: err, + } + } + } + default: _ = v // ensures v is used } @@ -1601,6 +1794,48 @@ func (m *Principal) validate(all bool) error { } } + case *Principal_SourcedMetadata: + if v == nil { + err := PrincipalValidationError{ + field: "Identifier", + reason: "oneof value cannot be a typed-nil", + } + if !all { + return err + } + errors = append(errors, err) + } + oneofIdentifierPresent = true + + if all { + switch v := interface{}(m.GetSourcedMetadata()).(type) { + case interface{ ValidateAll() error }: + if err := v.ValidateAll(); err != nil { + errors = append(errors, PrincipalValidationError{ + field: "SourcedMetadata", + reason: "embedded message failed validation", + cause: err, + }) + } + case interface{ Validate() error }: + if err := v.Validate(); err != nil { + errors = append(errors, PrincipalValidationError{ + field: "SourcedMetadata", + reason: "embedded message failed validation", + cause: err, + }) + } + } + } else if v, ok := interface{}(m.GetSourcedMetadata()).(interface{ Validate() error }); ok { + if err := v.Validate(); err != nil { + return PrincipalValidationError{ + field: "SourcedMetadata", + reason: "embedded message failed validation", + cause: err, + } + } + } + default: _ = v // ensures v is used } diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/rbac/v3/rbac_vtproto.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/rbac/v3/rbac_vtproto.pb.go index 940a9b37eb387..75a6de9af7889 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/rbac/v3/rbac_vtproto.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/rbac/v3/rbac_vtproto.pb.go @@ -305,6 +305,66 @@ func (m *Policy) MarshalToSizedBufferVTStrict(dAtA []byte) (int, error) { return len(dAtA) - i, nil } +func (m *SourcedMetadata) MarshalVTStrict() (dAtA []byte, err error) { + if m == nil { + return nil, nil + } + size := m.SizeVT() + dAtA = make([]byte, size) + n, err := m.MarshalToSizedBufferVTStrict(dAtA[:size]) + if err != nil { + return nil, err + } + return dAtA[:n], nil +} + +func (m *SourcedMetadata) MarshalToVTStrict(dAtA []byte) (int, error) { + size := m.SizeVT() + return m.MarshalToSizedBufferVTStrict(dAtA[:size]) +} + +func (m *SourcedMetadata) MarshalToSizedBufferVTStrict(dAtA []byte) (int, error) { + if m == nil { + return 0, nil + } + i := len(dAtA) + _ = i + var l int + _ = l + if m.unknownFields != nil { + i -= len(m.unknownFields) + copy(dAtA[i:], m.unknownFields) + } + if m.MetadataSource != 0 { + i = protohelpers.EncodeVarint(dAtA, i, uint64(m.MetadataSource)) + i-- + dAtA[i] = 0x10 + } + if m.MetadataMatcher != nil { + if vtmsg, ok := interface{}(m.MetadataMatcher).(interface { + MarshalToSizedBufferVTStrict([]byte) (int, error) + }); ok { + size, err := vtmsg.MarshalToSizedBufferVTStrict(dAtA[:i]) + if err != nil { + return 0, err + } + i -= size + i = protohelpers.EncodeVarint(dAtA, i, uint64(size)) + } else { + encoded, err := proto.Marshal(m.MetadataMatcher) + if err != nil { + return 0, err + } + i -= len(encoded) + copy(dAtA[i:], encoded) + i = protohelpers.EncodeVarint(dAtA, i, uint64(len(encoded))) + } + i-- + dAtA[i] = 0xa + } + return len(dAtA) - i, nil +} + func (m *Permission_Set) MarshalVTStrict() (dAtA []byte, err error) { if m == nil { return nil, nil @@ -380,6 +440,13 @@ func (m *Permission) MarshalToSizedBufferVTStrict(dAtA []byte) (int, error) { i -= len(m.unknownFields) copy(dAtA[i:], m.unknownFields) } + if msg, ok := m.Rule.(*Permission_SourcedMetadata); ok { + size, err := msg.MarshalToSizedBufferVTStrict(dAtA[:i]) + if err != nil { + return 0, err + } + i -= size + } if msg, ok := m.Rule.(*Permission_UriTemplate); ok { size, err := msg.MarshalToSizedBufferVTStrict(dAtA[:i]) if err != nil { @@ -852,6 +919,29 @@ func (m *Permission_UriTemplate) MarshalToSizedBufferVTStrict(dAtA []byte) (int, } return len(dAtA) - i, nil } +func (m *Permission_SourcedMetadata) MarshalToVTStrict(dAtA []byte) (int, error) { + size := m.SizeVT() + return m.MarshalToSizedBufferVTStrict(dAtA[:size]) +} + +func (m *Permission_SourcedMetadata) MarshalToSizedBufferVTStrict(dAtA []byte) (int, error) { + i := len(dAtA) + if m.SourcedMetadata != nil { + size, err := m.SourcedMetadata.MarshalToSizedBufferVTStrict(dAtA[:i]) + if err != nil { + return 0, err + } + i -= size + i = protohelpers.EncodeVarint(dAtA, i, uint64(size)) + i-- + dAtA[i] = 0x72 + } else { + i = protohelpers.EncodeVarint(dAtA, i, 0) + i-- + dAtA[i] = 0x72 + } + return len(dAtA) - i, nil +} func (m *Principal_Set) MarshalVTStrict() (dAtA []byte, err error) { if m == nil { return nil, nil @@ -982,6 +1072,13 @@ func (m *Principal) MarshalToSizedBufferVTStrict(dAtA []byte) (int, error) { i -= len(m.unknownFields) copy(dAtA[i:], m.unknownFields) } + if msg, ok := m.Identifier.(*Principal_SourcedMetadata); ok { + size, err := msg.MarshalToSizedBufferVTStrict(dAtA[:i]) + if err != nil { + return 0, err + } + i -= size + } if msg, ok := m.Identifier.(*Principal_FilterState); ok { size, err := msg.MarshalToSizedBufferVTStrict(dAtA[:i]) if err != nil { @@ -1423,6 +1520,29 @@ func (m *Principal_FilterState) MarshalToSizedBufferVTStrict(dAtA []byte) (int, } return len(dAtA) - i, nil } +func (m *Principal_SourcedMetadata) MarshalToVTStrict(dAtA []byte) (int, error) { + size := m.SizeVT() + return m.MarshalToSizedBufferVTStrict(dAtA[:size]) +} + +func (m *Principal_SourcedMetadata) MarshalToSizedBufferVTStrict(dAtA []byte) (int, error) { + i := len(dAtA) + if m.SourcedMetadata != nil { + size, err := m.SourcedMetadata.MarshalToSizedBufferVTStrict(dAtA[:i]) + if err != nil { + return 0, err + } + i -= size + i = protohelpers.EncodeVarint(dAtA, i, uint64(size)) + i-- + dAtA[i] = 0x6a + } else { + i = protohelpers.EncodeVarint(dAtA, i, 0) + i-- + dAtA[i] = 0x6a + } + return len(dAtA) - i, nil +} func (m *Action) MarshalVTStrict() (dAtA []byte, err error) { if m == nil { return nil, nil @@ -1582,6 +1702,29 @@ func (m *Policy) SizeVT() (n int) { return n } +func (m *SourcedMetadata) SizeVT() (n int) { + if m == nil { + return 0 + } + var l int + _ = l + if m.MetadataMatcher != nil { + if size, ok := interface{}(m.MetadataMatcher).(interface { + SizeVT() int + }); ok { + l = size.SizeVT() + } else { + l = proto.Size(m.MetadataMatcher) + } + n += 1 + l + protohelpers.SizeOfVarint(uint64(l)) + } + if m.MetadataSource != 0 { + n += 1 + protohelpers.SizeOfVarint(uint64(m.MetadataSource)) + } + n += len(m.unknownFields) + return n +} + func (m *Permission_Set) SizeVT() (n int) { if m == nil { return 0 @@ -1831,6 +1974,20 @@ func (m *Permission_UriTemplate) SizeVT() (n int) { } return n } +func (m *Permission_SourcedMetadata) SizeVT() (n int) { + if m == nil { + return 0 + } + var l int + _ = l + if m.SourcedMetadata != nil { + l = m.SourcedMetadata.SizeVT() + n += 1 + l + protohelpers.SizeOfVarint(uint64(l)) + } else { + n += 2 + } + return n +} func (m *Principal_Set) SizeVT() (n int) { if m == nil { return 0 @@ -2085,6 +2242,20 @@ func (m *Principal_FilterState) SizeVT() (n int) { } return n } +func (m *Principal_SourcedMetadata) SizeVT() (n int) { + if m == nil { + return 0 + } + var l int + _ = l + if m.SourcedMetadata != nil { + l = m.SourcedMetadata.SizeVT() + n += 1 + l + protohelpers.SizeOfVarint(uint64(l)) + } else { + n += 2 + } + return n +} func (m *Action) SizeVT() (n int) { if m == nil { return 0 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/route/v3/route.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/route/v3/route.pb.go index a3410659573ff..50214ef473a10 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/route/v3/route.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/route/v3/route.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/route/v3/route.proto package routev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/route/v3/route_components.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/route/v3/route_components.pb.go index 300c39a1289bc..36f69c9fa187e 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/route/v3/route_components.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/route/v3/route_components.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/route/v3/route_components.proto package routev3 @@ -3253,6 +3253,7 @@ func (x *VirtualCluster) GetName() string { // Global rate limiting :ref:`architecture overview `. // Also applies to Local rate limiting :ref:`using descriptors `. +// [#next-free-field: 7] type RateLimit struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -3265,8 +3266,20 @@ type RateLimit struct { // .. note:: // // The filter supports a range of 0 - 10 inclusively for stage numbers. + // + // .. note:: + // + // This is not supported if the rate limit action is configured in the ``typed_per_filter_config`` like + // :ref:`VirtualHost.typed_per_filter_config` or + // :ref:`Route.typed_per_filter_config`, etc. Stage *wrapperspb.UInt32Value `protobuf:"bytes,1,opt,name=stage,proto3" json:"stage,omitempty"` // The key to be set in runtime to disable this rate limit configuration. + // + // .. note:: + // + // This is not supported if the rate limit action is configured in the ``typed_per_filter_config`` like + // :ref:`VirtualHost.typed_per_filter_config` or + // :ref:`Route.typed_per_filter_config`, etc. DisableKey string `protobuf:"bytes,2,opt,name=disable_key,json=disableKey,proto3" json:"disable_key,omitempty"` // A list of actions that are to be applied for this rate limit configuration. // Order matters as the actions are processed sequentially and the descriptor @@ -3279,7 +3292,38 @@ type RateLimit struct { // rate limit configuration. If the override value is invalid or cannot be resolved // from metadata, no override is provided. See :ref:`rate limit override // ` for more information. + // + // .. note:: + // + // This is not supported if the rate limit action is configured in the ``typed_per_filter_config`` like + // :ref:`VirtualHost.typed_per_filter_config` or + // :ref:`Route.typed_per_filter_config`, etc. Limit *RateLimit_Override `protobuf:"bytes,4,opt,name=limit,proto3" json:"limit,omitempty"` + // An optional hits addend to be appended to the descriptor produced by this rate limit + // configuration. + // + // .. note:: + // + // This is only supported if the rate limit action is configured in the ``typed_per_filter_config`` like + // :ref:`VirtualHost.typed_per_filter_config` or + // :ref:`Route.typed_per_filter_config`, etc. + HitsAddend *RateLimit_HitsAddend `protobuf:"bytes,5,opt,name=hits_addend,json=hitsAddend,proto3" json:"hits_addend,omitempty"` + // If true, the rate limit request will be applied when the stream completes. The default value is false. + // This is useful when the rate limit budget needs to reflect the response context that is not available + // on the request path. + // + // For example, let's say the upstream service calculates the usage statistics and returns them in the response body + // and we want to utilize these numbers to apply the rate limit action for the subsequent requests. + // Combined with another filter that can set the desired addend based on the response (e.g. Lua filter), + // this can be used to subtract the usage statistics from the rate limit budget. + // + // A rate limit applied on the stream completion is "fire-and-forget" by nature, and rate limit is not enforced by this config. + // In other words, the current request won't be blocked when this is true, but the budget will be updated for the subsequent + // requests based on the action with this field set to true. Users should ensure that the rate limit is enforced by the actions + // applied on the request path, i.e. the ones with this field set to false. + // + // Currently, this is only supported by the HTTP global rate filter. + ApplyOnStreamDone bool `protobuf:"varint,6,opt,name=apply_on_stream_done,json=applyOnStreamDone,proto3" json:"apply_on_stream_done,omitempty"` } func (x *RateLimit) Reset() { @@ -3342,6 +3386,20 @@ func (x *RateLimit) GetLimit() *RateLimit_Override { return nil } +func (x *RateLimit) GetHitsAddend() *RateLimit_HitsAddend { + if x != nil { + return x.HitsAddend + } + return nil +} + +func (x *RateLimit) GetApplyOnStreamDone() bool { + if x != nil { + return x.ApplyOnStreamDone + } + return false +} + // .. attention:: // // Internally, Envoy always uses the HTTP/2 ``:authority`` header to represent the HTTP/1 ``Host`` @@ -5824,6 +5882,82 @@ type RateLimit_Override_DynamicMetadata_ struct { func (*RateLimit_Override_DynamicMetadata_) isRateLimit_Override_OverrideSpecifier() {} +type RateLimit_HitsAddend struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Fixed number of hits to add to the rate limit descriptor. + // + // One of the “number“ or “format“ fields should be set but not both. + Number *wrapperspb.UInt64Value `protobuf:"bytes,1,opt,name=number,proto3" json:"number,omitempty"` + // Substitution format string to extract the number of hits to add to the rate limit descriptor. + // The same :ref:`format specifier ` as used for + // :ref:`HTTP access logging ` applies here. + // + // .. note:: + // + // The format string must contains only single valid substitution field. If the format string + // not meets the requirement, the configuration will be rejected. + // + // The substitution field should generates a non-negative number or string representation of + // a non-negative number. The value of the non-negative number should be less than or equal + // to 1000000000 like the ``number`` field. If the output of the substitution field not meet + // the requirement, this will be treated as an error and the current descriptor will be ignored. + // + // For example, the “%BYTES_RECEIVED%“ format string will be replaced with the number of bytes + // received in the request. + // + // One of the “number“ or “format“ fields should be set but not both. + Format string `protobuf:"bytes,2,opt,name=format,proto3" json:"format,omitempty"` +} + +func (x *RateLimit_HitsAddend) Reset() { + *x = RateLimit_HitsAddend{} + if protoimpl.UnsafeEnabled { + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[47] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *RateLimit_HitsAddend) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*RateLimit_HitsAddend) ProtoMessage() {} + +func (x *RateLimit_HitsAddend) ProtoReflect() protoreflect.Message { + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[47] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use RateLimit_HitsAddend.ProtoReflect.Descriptor instead. +func (*RateLimit_HitsAddend) Descriptor() ([]byte, []int) { + return file_envoy_config_route_v3_route_components_proto_rawDescGZIP(), []int{17, 2} +} + +func (x *RateLimit_HitsAddend) GetNumber() *wrapperspb.UInt64Value { + if x != nil { + return x.Number + } + return nil +} + +func (x *RateLimit_HitsAddend) GetFormat() string { + if x != nil { + return x.Format + } + return "" +} + // The following descriptor entry is appended to the descriptor: // // .. code-block:: cpp @@ -5840,7 +5974,7 @@ type RateLimit_Action_SourceCluster struct { func (x *RateLimit_Action_SourceCluster) Reset() { *x = RateLimit_Action_SourceCluster{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[47] + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[48] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5853,7 +5987,7 @@ func (x *RateLimit_Action_SourceCluster) String() string { func (*RateLimit_Action_SourceCluster) ProtoMessage() {} func (x *RateLimit_Action_SourceCluster) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[47] + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[48] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5894,7 +6028,7 @@ type RateLimit_Action_DestinationCluster struct { func (x *RateLimit_Action_DestinationCluster) Reset() { *x = RateLimit_Action_DestinationCluster{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[48] + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[49] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5907,7 +6041,7 @@ func (x *RateLimit_Action_DestinationCluster) String() string { func (*RateLimit_Action_DestinationCluster) ProtoMessage() {} func (x *RateLimit_Action_DestinationCluster) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[48] + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[49] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5949,7 +6083,7 @@ type RateLimit_Action_RequestHeaders struct { func (x *RateLimit_Action_RequestHeaders) Reset() { *x = RateLimit_Action_RequestHeaders{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[49] + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[50] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5962,7 +6096,7 @@ func (x *RateLimit_Action_RequestHeaders) String() string { func (*RateLimit_Action_RequestHeaders) ProtoMessage() {} func (x *RateLimit_Action_RequestHeaders) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[49] + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[50] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -6014,7 +6148,7 @@ type RateLimit_Action_RemoteAddress struct { func (x *RateLimit_Action_RemoteAddress) Reset() { *x = RateLimit_Action_RemoteAddress{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[50] + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[51] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -6027,7 +6161,7 @@ func (x *RateLimit_Action_RemoteAddress) String() string { func (*RateLimit_Action_RemoteAddress) ProtoMessage() {} func (x *RateLimit_Action_RemoteAddress) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[50] + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[51] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -6071,7 +6205,7 @@ type RateLimit_Action_MaskedRemoteAddress struct { func (x *RateLimit_Action_MaskedRemoteAddress) Reset() { *x = RateLimit_Action_MaskedRemoteAddress{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[51] + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[52] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -6084,7 +6218,7 @@ func (x *RateLimit_Action_MaskedRemoteAddress) String() string { func (*RateLimit_Action_MaskedRemoteAddress) ProtoMessage() {} func (x *RateLimit_Action_MaskedRemoteAddress) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[51] + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[52] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -6134,7 +6268,7 @@ type RateLimit_Action_GenericKey struct { func (x *RateLimit_Action_GenericKey) Reset() { *x = RateLimit_Action_GenericKey{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[52] + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[53] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -6147,7 +6281,7 @@ func (x *RateLimit_Action_GenericKey) String() string { func (*RateLimit_Action_GenericKey) ProtoMessage() {} func (x *RateLimit_Action_GenericKey) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[52] + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[53] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -6207,7 +6341,7 @@ type RateLimit_Action_HeaderValueMatch struct { func (x *RateLimit_Action_HeaderValueMatch) Reset() { *x = RateLimit_Action_HeaderValueMatch{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[53] + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[54] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -6220,7 +6354,7 @@ func (x *RateLimit_Action_HeaderValueMatch) String() string { func (*RateLimit_Action_HeaderValueMatch) ProtoMessage() {} func (x *RateLimit_Action_HeaderValueMatch) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[53] + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[54] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -6292,7 +6426,7 @@ type RateLimit_Action_DynamicMetaData struct { func (x *RateLimit_Action_DynamicMetaData) Reset() { *x = RateLimit_Action_DynamicMetaData{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[54] + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[55] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -6305,7 +6439,7 @@ func (x *RateLimit_Action_DynamicMetaData) String() string { func (*RateLimit_Action_DynamicMetaData) ProtoMessage() {} func (x *RateLimit_Action_DynamicMetaData) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[54] + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[55] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -6374,7 +6508,7 @@ type RateLimit_Action_MetaData struct { func (x *RateLimit_Action_MetaData) Reset() { *x = RateLimit_Action_MetaData{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[55] + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[56] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -6387,7 +6521,7 @@ func (x *RateLimit_Action_MetaData) String() string { func (*RateLimit_Action_MetaData) ProtoMessage() {} func (x *RateLimit_Action_MetaData) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[55] + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[56] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -6468,7 +6602,7 @@ type RateLimit_Action_QueryParameterValueMatch struct { func (x *RateLimit_Action_QueryParameterValueMatch) Reset() { *x = RateLimit_Action_QueryParameterValueMatch{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[56] + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[57] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -6481,7 +6615,7 @@ func (x *RateLimit_Action_QueryParameterValueMatch) String() string { func (*RateLimit_Action_QueryParameterValueMatch) ProtoMessage() {} func (x *RateLimit_Action_QueryParameterValueMatch) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[56] + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[57] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -6541,7 +6675,7 @@ type RateLimit_Override_DynamicMetadata struct { func (x *RateLimit_Override_DynamicMetadata) Reset() { *x = RateLimit_Override_DynamicMetadata{} if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[57] + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[58] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -6554,7 +6688,7 @@ func (x *RateLimit_Override_DynamicMetadata) String() string { func (*RateLimit_Override_DynamicMetadata) ProtoMessage() {} func (x *RateLimit_Override_DynamicMetadata) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[57] + mi := &file_envoy_config_route_v3_route_components_proto_msgTypes[58] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -7694,7 +7828,7 @@ var file_envoy_config_route_v3_route_components_proto_rawDesc = []byte{ 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x56, 0x69, 0x72, 0x74, 0x75, 0x61, 0x6c, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x4a, 0x04, 0x08, 0x01, 0x10, 0x02, 0x4a, 0x04, 0x08, 0x03, 0x10, 0x04, 0x52, 0x07, 0x70, 0x61, 0x74, 0x74, 0x65, 0x72, 0x6e, 0x52, 0x06, - 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x22, 0xc9, 0x1c, 0x0a, 0x09, 0x52, 0x61, 0x74, 0x65, 0x4c, + 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x22, 0xc1, 0x1e, 0x0a, 0x09, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x12, 0x3b, 0x0a, 0x05, 0x73, 0x74, 0x61, 0x67, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, @@ -7710,326 +7844,342 @@ var file_envoy_config_route_v3_route_components_proto_rawDesc = []byte{ 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x4f, 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, 0x65, 0x52, 0x05, 0x6c, 0x69, 0x6d, 0x69, 0x74, - 0x1a, 0xb5, 0x18, 0x0a, 0x06, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x5e, 0x0a, 0x0e, 0x73, - 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x35, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x61, 0x74, 0x65, - 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x6f, 0x75, - 0x72, 0x63, 0x65, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x48, 0x00, 0x52, 0x0d, 0x73, 0x6f, - 0x75, 0x72, 0x63, 0x65, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x12, 0x6d, 0x0a, 0x13, 0x64, - 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x6c, 0x75, 0x73, 0x74, - 0x65, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x3a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, - 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x76, 0x33, - 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, - 0x6e, 0x2e, 0x44, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6c, 0x75, - 0x73, 0x74, 0x65, 0x72, 0x48, 0x00, 0x52, 0x12, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x12, 0x61, 0x0a, 0x0f, 0x72, 0x65, - 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x18, 0x03, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x36, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x61, 0x74, 0x65, - 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x52, 0x65, 0x71, - 0x75, 0x65, 0x73, 0x74, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x48, 0x00, 0x52, 0x0e, 0x72, - 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x12, 0x5e, 0x0a, - 0x0e, 0x72, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x5f, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x18, - 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x35, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, + 0x12, 0x4c, 0x0a, 0x0b, 0x68, 0x69, 0x74, 0x73, 0x5f, 0x61, 0x64, 0x64, 0x65, 0x6e, 0x64, 0x18, + 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2b, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x61, - 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x52, - 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x48, 0x00, 0x52, 0x0d, - 0x72, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x12, 0x55, 0x0a, - 0x0b, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x05, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x32, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, + 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x48, 0x69, 0x74, 0x73, 0x41, 0x64, 0x64, 0x65, + 0x6e, 0x64, 0x52, 0x0a, 0x68, 0x69, 0x74, 0x73, 0x41, 0x64, 0x64, 0x65, 0x6e, 0x64, 0x12, 0x2f, + 0x0a, 0x14, 0x61, 0x70, 0x70, 0x6c, 0x79, 0x5f, 0x6f, 0x6e, 0x5f, 0x73, 0x74, 0x72, 0x65, 0x61, + 0x6d, 0x5f, 0x64, 0x6f, 0x6e, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x08, 0x52, 0x11, 0x61, 0x70, + 0x70, 0x6c, 0x79, 0x4f, 0x6e, 0x53, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x44, 0x6f, 0x6e, 0x65, 0x1a, + 0xb5, 0x18, 0x0a, 0x06, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x5e, 0x0a, 0x0e, 0x73, 0x6f, + 0x75, 0x72, 0x63, 0x65, 0x5f, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x18, 0x01, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x35, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, - 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x47, 0x65, 0x6e, 0x65, - 0x72, 0x69, 0x63, 0x4b, 0x65, 0x79, 0x48, 0x00, 0x52, 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x69, - 0x63, 0x4b, 0x65, 0x79, 0x12, 0x68, 0x0a, 0x12, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x5f, 0x76, - 0x61, 0x6c, 0x75, 0x65, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x38, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, - 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, - 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, - 0x56, 0x61, 0x6c, 0x75, 0x65, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x48, 0x00, 0x52, 0x10, 0x68, 0x65, - 0x61, 0x64, 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x77, - 0x0a, 0x10, 0x64, 0x79, 0x6e, 0x61, 0x6d, 0x69, 0x63, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, - 0x74, 0x61, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x37, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, + 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x6f, 0x75, 0x72, + 0x63, 0x65, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x48, 0x00, 0x52, 0x0d, 0x73, 0x6f, 0x75, + 0x72, 0x63, 0x65, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x12, 0x6d, 0x0a, 0x13, 0x64, 0x65, + 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, + 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x3a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, + 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x76, 0x33, 0x2e, + 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, + 0x2e, 0x44, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6c, 0x75, 0x73, + 0x74, 0x65, 0x72, 0x48, 0x00, 0x52, 0x12, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x12, 0x61, 0x0a, 0x0f, 0x72, 0x65, 0x71, + 0x75, 0x65, 0x73, 0x74, 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x18, 0x03, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x36, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, + 0x67, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, + 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x52, 0x65, 0x71, 0x75, + 0x65, 0x73, 0x74, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x48, 0x00, 0x52, 0x0e, 0x72, 0x65, + 0x71, 0x75, 0x65, 0x73, 0x74, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x12, 0x5e, 0x0a, 0x0e, + 0x72, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x5f, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x18, 0x04, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x35, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x61, 0x74, + 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x52, 0x65, + 0x6d, 0x6f, 0x74, 0x65, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x48, 0x00, 0x52, 0x0d, 0x72, + 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x12, 0x55, 0x0a, 0x0b, + 0x67, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x05, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x32, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, + 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, + 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x47, 0x65, 0x6e, 0x65, 0x72, + 0x69, 0x63, 0x4b, 0x65, 0x79, 0x48, 0x00, 0x52, 0x0a, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, + 0x4b, 0x65, 0x79, 0x12, 0x68, 0x0a, 0x12, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x5f, 0x76, 0x61, + 0x6c, 0x75, 0x65, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x38, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, + 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, + 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x56, + 0x61, 0x6c, 0x75, 0x65, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x48, 0x00, 0x52, 0x10, 0x68, 0x65, 0x61, + 0x64, 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x77, 0x0a, + 0x10, 0x64, 0x79, 0x6e, 0x61, 0x6d, 0x69, 0x63, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, + 0x61, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x37, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, + 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x76, 0x33, 0x2e, + 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, + 0x2e, 0x44, 0x79, 0x6e, 0x61, 0x6d, 0x69, 0x63, 0x4d, 0x65, 0x74, 0x61, 0x44, 0x61, 0x74, 0x61, + 0x42, 0x11, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0xb8, 0xee, 0xf2, 0xd2, 0x05, + 0x01, 0x18, 0x01, 0x48, 0x00, 0x52, 0x0f, 0x64, 0x79, 0x6e, 0x61, 0x6d, 0x69, 0x63, 0x4d, 0x65, + 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x12, 0x4e, 0x0a, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, + 0x74, 0x61, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x30, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, - 0x6e, 0x2e, 0x44, 0x79, 0x6e, 0x61, 0x6d, 0x69, 0x63, 0x4d, 0x65, 0x74, 0x61, 0x44, 0x61, 0x74, - 0x61, 0x42, 0x11, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0xb8, 0xee, 0xf2, 0xd2, - 0x05, 0x01, 0x18, 0x01, 0x48, 0x00, 0x52, 0x0f, 0x64, 0x79, 0x6e, 0x61, 0x6d, 0x69, 0x63, 0x4d, - 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x12, 0x4e, 0x0a, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, - 0x61, 0x74, 0x61, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x30, 0x2e, 0x65, 0x6e, 0x76, 0x6f, - 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x76, - 0x33, 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, - 0x6f, 0x6e, 0x2e, 0x4d, 0x65, 0x74, 0x61, 0x44, 0x61, 0x74, 0x61, 0x48, 0x00, 0x52, 0x08, 0x6d, - 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x12, 0x4a, 0x0a, 0x09, 0x65, 0x78, 0x74, 0x65, 0x6e, - 0x73, 0x69, 0x6f, 0x6e, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x65, 0x6e, 0x76, - 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, - 0x33, 0x2e, 0x54, 0x79, 0x70, 0x65, 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, - 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x48, 0x00, 0x52, 0x09, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, - 0x69, 0x6f, 0x6e, 0x12, 0x71, 0x0a, 0x15, 0x6d, 0x61, 0x73, 0x6b, 0x65, 0x64, 0x5f, 0x72, 0x65, - 0x6d, 0x6f, 0x74, 0x65, 0x5f, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x18, 0x0a, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x3b, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, - 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4d, 0x61, 0x73, 0x6b, - 0x65, 0x64, 0x52, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x48, - 0x00, 0x52, 0x13, 0x6d, 0x61, 0x73, 0x6b, 0x65, 0x64, 0x52, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x41, - 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x12, 0x81, 0x01, 0x0a, 0x1b, 0x71, 0x75, 0x65, 0x72, 0x79, - 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, - 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x40, 0x2e, 0x65, - 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x6f, 0x75, 0x74, - 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x41, - 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x51, 0x75, 0x65, 0x72, 0x79, 0x50, 0x61, 0x72, 0x61, 0x6d, - 0x65, 0x74, 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x48, 0x00, - 0x52, 0x18, 0x71, 0x75, 0x65, 0x72, 0x79, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, - 0x56, 0x61, 0x6c, 0x75, 0x65, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x1a, 0x49, 0x0a, 0x0d, 0x53, 0x6f, - 0x75, 0x72, 0x63, 0x65, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x3a, 0x38, 0x9a, 0xc5, 0x88, - 0x1e, 0x33, 0x0a, 0x31, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, - 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, - 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x43, 0x6c, - 0x75, 0x73, 0x74, 0x65, 0x72, 0x1a, 0x53, 0x0a, 0x12, 0x44, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x3a, 0x3d, 0x9a, 0xc5, 0x88, - 0x1e, 0x38, 0x0a, 0x36, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, - 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, - 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x44, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x1a, 0xd1, 0x01, 0x0a, 0x0e, 0x52, - 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x12, 0x2e, 0x0a, - 0x0b, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, - 0x28, 0x09, 0x42, 0x0d, 0xfa, 0x42, 0x0a, 0x72, 0x08, 0x10, 0x01, 0xc8, 0x01, 0x00, 0xc0, 0x01, - 0x01, 0x52, 0x0a, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x2e, 0x0a, - 0x0e, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x5f, 0x6b, 0x65, 0x79, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x0d, - 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x4b, 0x65, 0x79, 0x12, 0x24, 0x0a, - 0x0e, 0x73, 0x6b, 0x69, 0x70, 0x5f, 0x69, 0x66, 0x5f, 0x61, 0x62, 0x73, 0x65, 0x6e, 0x74, 0x18, - 0x03, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0c, 0x73, 0x6b, 0x69, 0x70, 0x49, 0x66, 0x41, 0x62, 0x73, - 0x65, 0x6e, 0x74, 0x3a, 0x39, 0x9a, 0xc5, 0x88, 0x1e, 0x34, 0x0a, 0x32, 0x65, 0x6e, 0x76, 0x6f, + 0x6e, 0x2e, 0x4d, 0x65, 0x74, 0x61, 0x44, 0x61, 0x74, 0x61, 0x48, 0x00, 0x52, 0x08, 0x6d, 0x65, + 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x12, 0x4a, 0x0a, 0x09, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, + 0x69, 0x6f, 0x6e, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, + 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, + 0x2e, 0x54, 0x79, 0x70, 0x65, 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x43, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x48, 0x00, 0x52, 0x09, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, + 0x6f, 0x6e, 0x12, 0x71, 0x0a, 0x15, 0x6d, 0x61, 0x73, 0x6b, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x6d, + 0x6f, 0x74, 0x65, 0x5f, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x18, 0x0a, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x3b, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, + 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, + 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4d, 0x61, 0x73, 0x6b, 0x65, + 0x64, 0x52, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x48, 0x00, + 0x52, 0x13, 0x6d, 0x61, 0x73, 0x6b, 0x65, 0x64, 0x52, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x41, 0x64, + 0x64, 0x72, 0x65, 0x73, 0x73, 0x12, 0x81, 0x01, 0x0a, 0x1b, 0x71, 0x75, 0x65, 0x72, 0x79, 0x5f, + 0x70, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x5f, + 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x40, 0x2e, 0x65, 0x6e, + 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, + 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, + 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x51, 0x75, 0x65, 0x72, 0x79, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, + 0x74, 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x48, 0x00, 0x52, + 0x18, 0x71, 0x75, 0x65, 0x72, 0x79, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x56, + 0x61, 0x6c, 0x75, 0x65, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x1a, 0x49, 0x0a, 0x0d, 0x53, 0x6f, 0x75, + 0x72, 0x63, 0x65, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x3a, 0x38, 0x9a, 0xc5, 0x88, 0x1e, + 0x33, 0x0a, 0x31, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, + 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x2e, + 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x43, 0x6c, 0x75, + 0x73, 0x74, 0x65, 0x72, 0x1a, 0x53, 0x0a, 0x12, 0x44, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x3a, 0x3d, 0x9a, 0xc5, 0x88, 0x1e, + 0x38, 0x0a, 0x36, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, + 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x2e, + 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x44, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x43, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x1a, 0xd1, 0x01, 0x0a, 0x0e, 0x52, 0x65, + 0x71, 0x75, 0x65, 0x73, 0x74, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x12, 0x2e, 0x0a, 0x0b, + 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x09, 0x42, 0x0d, 0xfa, 0x42, 0x0a, 0x72, 0x08, 0x10, 0x01, 0xc8, 0x01, 0x00, 0xc0, 0x01, 0x01, + 0x52, 0x0a, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x2e, 0x0a, 0x0e, + 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x02, + 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x0d, 0x64, + 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x4b, 0x65, 0x79, 0x12, 0x24, 0x0a, 0x0e, + 0x73, 0x6b, 0x69, 0x70, 0x5f, 0x69, 0x66, 0x5f, 0x61, 0x62, 0x73, 0x65, 0x6e, 0x74, 0x18, 0x03, + 0x20, 0x01, 0x28, 0x08, 0x52, 0x0c, 0x73, 0x6b, 0x69, 0x70, 0x49, 0x66, 0x41, 0x62, 0x73, 0x65, + 0x6e, 0x74, 0x3a, 0x39, 0x9a, 0xc5, 0x88, 0x1e, 0x34, 0x0a, 0x32, 0x65, 0x6e, 0x76, 0x6f, 0x79, + 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x52, 0x61, + 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x52, + 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x1a, 0x49, 0x0a, + 0x0d, 0x52, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x3a, 0x38, + 0x9a, 0xc5, 0x88, 0x1e, 0x33, 0x0a, 0x31, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, + 0x2e, 0x76, 0x32, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, + 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x52, 0x65, 0x6d, 0x6f, 0x74, + 0x65, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x1a, 0xbe, 0x01, 0x0a, 0x13, 0x4d, 0x61, 0x73, + 0x6b, 0x65, 0x64, 0x52, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, + 0x12, 0x52, 0x0a, 0x12, 0x76, 0x34, 0x5f, 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x5f, 0x6d, 0x61, + 0x73, 0x6b, 0x5f, 0x6c, 0x65, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, + 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x2a, + 0x02, 0x18, 0x20, 0x52, 0x0f, 0x76, 0x34, 0x50, 0x72, 0x65, 0x66, 0x69, 0x78, 0x4d, 0x61, 0x73, + 0x6b, 0x4c, 0x65, 0x6e, 0x12, 0x53, 0x0a, 0x12, 0x76, 0x36, 0x5f, 0x70, 0x72, 0x65, 0x66, 0x69, + 0x78, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x5f, 0x6c, 0x65, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, + 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x08, + 0xfa, 0x42, 0x05, 0x2a, 0x03, 0x18, 0x80, 0x01, 0x52, 0x0f, 0x76, 0x36, 0x50, 0x72, 0x65, 0x66, + 0x69, 0x78, 0x4d, 0x61, 0x73, 0x6b, 0x4c, 0x65, 0x6e, 0x1a, 0x9e, 0x01, 0x0a, 0x0a, 0x47, 0x65, + 0x6e, 0x65, 0x72, 0x69, 0x63, 0x4b, 0x65, 0x79, 0x12, 0x32, 0x0a, 0x10, 0x64, 0x65, 0x73, 0x63, + 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x01, 0x20, 0x01, + 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x0f, 0x64, 0x65, 0x73, + 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x25, 0x0a, 0x0e, + 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x02, + 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, + 0x4b, 0x65, 0x79, 0x3a, 0x35, 0x9a, 0xc5, 0x88, 0x1e, 0x30, 0x0a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, - 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x1a, 0x49, - 0x0a, 0x0d, 0x52, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x3a, - 0x38, 0x9a, 0xc5, 0x88, 0x1e, 0x33, 0x0a, 0x31, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, - 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, - 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x52, 0x65, 0x6d, 0x6f, - 0x74, 0x65, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x1a, 0xbe, 0x01, 0x0a, 0x13, 0x4d, 0x61, - 0x73, 0x6b, 0x65, 0x64, 0x52, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, - 0x73, 0x12, 0x52, 0x0a, 0x12, 0x76, 0x34, 0x5f, 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x5f, 0x6d, - 0x61, 0x73, 0x6b, 0x5f, 0x6c, 0x65, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, - 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x07, 0xfa, 0x42, 0x04, - 0x2a, 0x02, 0x18, 0x20, 0x52, 0x0f, 0x76, 0x34, 0x50, 0x72, 0x65, 0x66, 0x69, 0x78, 0x4d, 0x61, - 0x73, 0x6b, 0x4c, 0x65, 0x6e, 0x12, 0x53, 0x0a, 0x12, 0x76, 0x36, 0x5f, 0x70, 0x72, 0x65, 0x66, - 0x69, 0x78, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x5f, 0x6c, 0x65, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, - 0x08, 0xfa, 0x42, 0x05, 0x2a, 0x03, 0x18, 0x80, 0x01, 0x52, 0x0f, 0x76, 0x36, 0x50, 0x72, 0x65, - 0x66, 0x69, 0x78, 0x4d, 0x61, 0x73, 0x6b, 0x4c, 0x65, 0x6e, 0x1a, 0x9e, 0x01, 0x0a, 0x0a, 0x47, - 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x4b, 0x65, 0x79, 0x12, 0x32, 0x0a, 0x10, 0x64, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x0f, 0x64, 0x65, - 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x25, 0x0a, - 0x0e, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x5f, 0x6b, 0x65, 0x79, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, - 0x72, 0x4b, 0x65, 0x79, 0x3a, 0x35, 0x9a, 0xc5, 0x88, 0x1e, 0x30, 0x0a, 0x2e, 0x65, 0x6e, 0x76, - 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, - 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, - 0x2e, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x4b, 0x65, 0x79, 0x1a, 0xb3, 0x02, 0x0a, 0x10, - 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x4d, 0x61, 0x74, 0x63, 0x68, - 0x12, 0x25, 0x0a, 0x0e, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x5f, 0x6b, - 0x65, 0x79, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, - 0x70, 0x74, 0x6f, 0x72, 0x4b, 0x65, 0x79, 0x12, 0x32, 0x0a, 0x10, 0x64, 0x65, 0x73, 0x63, 0x72, - 0x69, 0x70, 0x74, 0x6f, 0x72, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, - 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x0f, 0x64, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x3d, 0x0a, 0x0c, 0x65, - 0x78, 0x70, 0x65, 0x63, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x0b, 0x65, - 0x78, 0x70, 0x65, 0x63, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x48, 0x0a, 0x07, 0x68, 0x65, - 0x61, 0x64, 0x65, 0x72, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x65, 0x6e, - 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, - 0x2e, 0x76, 0x33, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, - 0x72, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x92, 0x01, 0x02, 0x08, 0x01, 0x52, 0x07, 0x68, 0x65, 0x61, - 0x64, 0x65, 0x72, 0x73, 0x3a, 0x3b, 0x9a, 0xc5, 0x88, 0x1e, 0x36, 0x0a, 0x34, 0x65, 0x6e, 0x76, - 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, - 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, - 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x4d, 0x61, 0x74, 0x63, - 0x68, 0x1a, 0xb8, 0x01, 0x0a, 0x0f, 0x44, 0x79, 0x6e, 0x61, 0x6d, 0x69, 0x63, 0x4d, 0x65, 0x74, - 0x61, 0x44, 0x61, 0x74, 0x61, 0x12, 0x2e, 0x0a, 0x0e, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, - 0x74, 0x6f, 0x72, 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, - 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x0d, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, - 0x6f, 0x72, 0x4b, 0x65, 0x79, 0x12, 0x50, 0x0a, 0x0c, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, - 0x61, 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x23, 0x2e, 0x65, 0x6e, - 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, - 0x61, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x4b, 0x65, 0x79, - 0x42, 0x08, 0xfa, 0x42, 0x05, 0x8a, 0x01, 0x02, 0x10, 0x01, 0x52, 0x0b, 0x6d, 0x65, 0x74, 0x61, - 0x64, 0x61, 0x74, 0x61, 0x4b, 0x65, 0x79, 0x12, 0x23, 0x0a, 0x0d, 0x64, 0x65, 0x66, 0x61, 0x75, - 0x6c, 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, - 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x1a, 0xda, 0x02, 0x0a, - 0x08, 0x4d, 0x65, 0x74, 0x61, 0x44, 0x61, 0x74, 0x61, 0x12, 0x2e, 0x0a, 0x0e, 0x64, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, - 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x0d, 0x64, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x4b, 0x65, 0x79, 0x12, 0x50, 0x0a, 0x0c, 0x6d, 0x65, 0x74, - 0x61, 0x64, 0x61, 0x74, 0x61, 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x23, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x6d, 0x65, 0x74, - 0x61, 0x64, 0x61, 0x74, 0x61, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, - 0x61, 0x4b, 0x65, 0x79, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x8a, 0x01, 0x02, 0x10, 0x01, 0x52, 0x0b, - 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x4b, 0x65, 0x79, 0x12, 0x23, 0x0a, 0x0d, 0x64, - 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x03, 0x20, 0x01, - 0x28, 0x09, 0x52, 0x0c, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x56, 0x61, 0x6c, 0x75, 0x65, - 0x12, 0x59, 0x0a, 0x06, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0e, - 0x32, 0x37, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, - 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, - 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4d, 0x65, 0x74, 0x61, 0x44, 0x61, - 0x74, 0x61, 0x2e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x82, 0x01, - 0x02, 0x10, 0x01, 0x52, 0x06, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x12, 0x24, 0x0a, 0x0e, 0x73, - 0x6b, 0x69, 0x70, 0x5f, 0x69, 0x66, 0x5f, 0x61, 0x62, 0x73, 0x65, 0x6e, 0x74, 0x18, 0x05, 0x20, - 0x01, 0x28, 0x08, 0x52, 0x0c, 0x73, 0x6b, 0x69, 0x70, 0x49, 0x66, 0x41, 0x62, 0x73, 0x65, 0x6e, - 0x74, 0x22, 0x26, 0x0a, 0x06, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x12, 0x0b, 0x0a, 0x07, 0x44, - 0x59, 0x4e, 0x41, 0x4d, 0x49, 0x43, 0x10, 0x00, 0x12, 0x0f, 0x0a, 0x0b, 0x52, 0x4f, 0x55, 0x54, - 0x45, 0x5f, 0x45, 0x4e, 0x54, 0x52, 0x59, 0x10, 0x01, 0x1a, 0x97, 0x02, 0x0a, 0x18, 0x51, 0x75, - 0x65, 0x72, 0x79, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, - 0x65, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x25, 0x0a, 0x0e, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, - 0x70, 0x74, 0x6f, 0x72, 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, - 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x4b, 0x65, 0x79, 0x12, 0x32, 0x0a, - 0x10, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x5f, 0x76, 0x61, 0x6c, 0x75, - 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, - 0x52, 0x0f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x56, 0x61, 0x6c, 0x75, - 0x65, 0x12, 0x3d, 0x0a, 0x0c, 0x65, 0x78, 0x70, 0x65, 0x63, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, - 0x68, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, - 0x6c, 0x75, 0x65, 0x52, 0x0b, 0x65, 0x78, 0x70, 0x65, 0x63, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, - 0x12, 0x61, 0x0a, 0x10, 0x71, 0x75, 0x65, 0x72, 0x79, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x65, - 0x74, 0x65, 0x72, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x65, 0x6e, 0x76, + 0x47, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x4b, 0x65, 0x79, 0x1a, 0xb3, 0x02, 0x0a, 0x10, 0x48, + 0x65, 0x61, 0x64, 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, + 0x25, 0x0a, 0x0e, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x5f, 0x6b, 0x65, + 0x79, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x4b, 0x65, 0x79, 0x12, 0x32, 0x0a, 0x10, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, + 0x70, 0x74, 0x6f, 0x72, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, + 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x0f, 0x64, 0x65, 0x73, 0x63, 0x72, + 0x69, 0x70, 0x74, 0x6f, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x3d, 0x0a, 0x0c, 0x65, 0x78, + 0x70, 0x65, 0x63, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, + 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x0b, 0x65, 0x78, + 0x70, 0x65, 0x63, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x48, 0x0a, 0x07, 0x68, 0x65, 0x61, + 0x64, 0x65, 0x72, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, - 0x76, 0x33, 0x2e, 0x51, 0x75, 0x65, 0x72, 0x79, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, - 0x72, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x92, 0x01, 0x02, - 0x08, 0x01, 0x52, 0x0f, 0x71, 0x75, 0x65, 0x72, 0x79, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, - 0x65, 0x72, 0x73, 0x3a, 0x2a, 0x9a, 0xc5, 0x88, 0x1e, 0x25, 0x0a, 0x23, 0x65, 0x6e, 0x76, 0x6f, + 0x76, 0x33, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, + 0x42, 0x08, 0xfa, 0x42, 0x05, 0x92, 0x01, 0x02, 0x08, 0x01, 0x52, 0x07, 0x68, 0x65, 0x61, 0x64, + 0x65, 0x72, 0x73, 0x3a, 0x3b, 0x9a, 0xc5, 0x88, 0x1e, 0x36, 0x0a, 0x34, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x52, - 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x42, - 0x17, 0x0a, 0x10, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x73, 0x70, 0x65, 0x63, 0x69, 0x66, - 0x69, 0x65, 0x72, 0x12, 0x03, 0xf8, 0x42, 0x01, 0x1a, 0xf2, 0x01, 0x0a, 0x08, 0x4f, 0x76, 0x65, - 0x72, 0x72, 0x69, 0x64, 0x65, 0x12, 0x66, 0x0a, 0x10, 0x64, 0x79, 0x6e, 0x61, 0x6d, 0x69, 0x63, - 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x39, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, + 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, + 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x4d, 0x61, 0x74, 0x63, 0x68, + 0x1a, 0xb8, 0x01, 0x0a, 0x0f, 0x44, 0x79, 0x6e, 0x61, 0x6d, 0x69, 0x63, 0x4d, 0x65, 0x74, 0x61, + 0x44, 0x61, 0x74, 0x61, 0x12, 0x2e, 0x0a, 0x0e, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, + 0x6f, 0x72, 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, + 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x0d, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, + 0x72, 0x4b, 0x65, 0x79, 0x12, 0x50, 0x0a, 0x0c, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, + 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x23, 0x2e, 0x65, 0x6e, 0x76, + 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, + 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x4b, 0x65, 0x79, 0x42, + 0x08, 0xfa, 0x42, 0x05, 0x8a, 0x01, 0x02, 0x10, 0x01, 0x52, 0x0b, 0x6d, 0x65, 0x74, 0x61, 0x64, + 0x61, 0x74, 0x61, 0x4b, 0x65, 0x79, 0x12, 0x23, 0x0a, 0x0d, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, + 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x64, + 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x1a, 0xda, 0x02, 0x0a, 0x08, + 0x4d, 0x65, 0x74, 0x61, 0x44, 0x61, 0x74, 0x61, 0x12, 0x2e, 0x0a, 0x0e, 0x64, 0x65, 0x73, 0x63, + 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, + 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x0d, 0x64, 0x65, 0x73, 0x63, 0x72, + 0x69, 0x70, 0x74, 0x6f, 0x72, 0x4b, 0x65, 0x79, 0x12, 0x50, 0x0a, 0x0c, 0x6d, 0x65, 0x74, 0x61, + 0x64, 0x61, 0x74, 0x61, 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x23, + 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x6d, 0x65, 0x74, 0x61, + 0x64, 0x61, 0x74, 0x61, 0x2e, 0x76, 0x33, 0x2e, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, + 0x4b, 0x65, 0x79, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x8a, 0x01, 0x02, 0x10, 0x01, 0x52, 0x0b, 0x6d, + 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x4b, 0x65, 0x79, 0x12, 0x23, 0x0a, 0x0d, 0x64, 0x65, + 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x0c, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, + 0x59, 0x0a, 0x06, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0e, 0x32, + 0x37, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, - 0x74, 0x2e, 0x4f, 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, 0x65, 0x2e, 0x44, 0x79, 0x6e, 0x61, 0x6d, - 0x69, 0x63, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x48, 0x00, 0x52, 0x0f, 0x64, 0x79, - 0x6e, 0x61, 0x6d, 0x69, 0x63, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x1a, 0x63, 0x0a, - 0x0f, 0x44, 0x79, 0x6e, 0x61, 0x6d, 0x69, 0x63, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, - 0x12, 0x50, 0x0a, 0x0c, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x5f, 0x6b, 0x65, 0x79, - 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x23, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, - 0x79, 0x70, 0x65, 0x2e, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x2e, 0x76, 0x33, 0x2e, - 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x4b, 0x65, 0x79, 0x42, 0x08, 0xfa, 0x42, 0x05, - 0x8a, 0x01, 0x02, 0x10, 0x01, 0x52, 0x0b, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x4b, - 0x65, 0x79, 0x42, 0x19, 0x0a, 0x12, 0x6f, 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, 0x65, 0x5f, 0x73, - 0x70, 0x65, 0x63, 0x69, 0x66, 0x69, 0x65, 0x72, 0x12, 0x03, 0xf8, 0x42, 0x01, 0x3a, 0x23, 0x9a, - 0xc5, 0x88, 0x1e, 0x1e, 0x0a, 0x1c, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, - 0x76, 0x32, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, - 0x69, 0x74, 0x22, 0xe6, 0x05, 0x0a, 0x0d, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x4d, 0x61, 0x74, - 0x63, 0x68, 0x65, 0x72, 0x12, 0x21, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, - 0x28, 0x09, 0x42, 0x0d, 0xfa, 0x42, 0x0a, 0x72, 0x08, 0x10, 0x01, 0xc8, 0x01, 0x00, 0xc0, 0x01, - 0x01, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x2e, 0x0a, 0x0b, 0x65, 0x78, 0x61, 0x63, 0x74, - 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x42, 0x0b, 0x92, 0xc7, - 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x48, 0x00, 0x52, 0x0a, 0x65, 0x78, 0x61, - 0x63, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x5c, 0x0a, 0x10, 0x73, 0x61, 0x66, 0x65, 0x5f, - 0x72, 0x65, 0x67, 0x65, 0x78, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x0b, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x23, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x6d, - 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x65, 0x67, 0x65, 0x78, 0x4d, - 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, - 0x30, 0x18, 0x01, 0x48, 0x00, 0x52, 0x0e, 0x73, 0x61, 0x66, 0x65, 0x52, 0x65, 0x67, 0x65, 0x78, - 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x3c, 0x0a, 0x0b, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x5f, 0x6d, - 0x61, 0x74, 0x63, 0x68, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x65, 0x6e, 0x76, - 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x49, 0x6e, 0x74, 0x36, 0x34, - 0x52, 0x61, 0x6e, 0x67, 0x65, 0x48, 0x00, 0x52, 0x0a, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x4d, 0x61, - 0x74, 0x63, 0x68, 0x12, 0x25, 0x0a, 0x0d, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x5f, 0x6d, - 0x61, 0x74, 0x63, 0x68, 0x18, 0x07, 0x20, 0x01, 0x28, 0x08, 0x48, 0x00, 0x52, 0x0c, 0x70, 0x72, - 0x65, 0x73, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x37, 0x0a, 0x0c, 0x70, 0x72, - 0x65, 0x66, 0x69, 0x78, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x09, 0x20, 0x01, 0x28, 0x09, - 0x42, 0x12, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, - 0x2e, 0x30, 0x18, 0x01, 0x48, 0x00, 0x52, 0x0b, 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x4d, 0x61, - 0x74, 0x63, 0x68, 0x12, 0x37, 0x0a, 0x0c, 0x73, 0x75, 0x66, 0x66, 0x69, 0x78, 0x5f, 0x6d, 0x61, - 0x74, 0x63, 0x68, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x09, 0x42, 0x12, 0xfa, 0x42, 0x04, 0x72, 0x02, - 0x10, 0x01, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x48, 0x00, 0x52, - 0x0b, 0x73, 0x75, 0x66, 0x66, 0x69, 0x78, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x3b, 0x0a, 0x0e, - 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x73, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x0c, - 0x20, 0x01, 0x28, 0x09, 0x42, 0x12, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x92, 0xc7, 0x86, - 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x48, 0x00, 0x52, 0x0d, 0x63, 0x6f, 0x6e, 0x74, - 0x61, 0x69, 0x6e, 0x73, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x49, 0x0a, 0x0c, 0x73, 0x74, 0x72, - 0x69, 0x6e, 0x67, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x0d, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x24, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x6d, 0x61, 0x74, - 0x63, 0x68, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x4d, 0x61, - 0x74, 0x63, 0x68, 0x65, 0x72, 0x48, 0x00, 0x52, 0x0b, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x4d, - 0x61, 0x74, 0x63, 0x68, 0x12, 0x21, 0x0a, 0x0c, 0x69, 0x6e, 0x76, 0x65, 0x72, 0x74, 0x5f, 0x6d, - 0x61, 0x74, 0x63, 0x68, 0x18, 0x08, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0b, 0x69, 0x6e, 0x76, 0x65, - 0x72, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x40, 0x0a, 0x1d, 0x74, 0x72, 0x65, 0x61, 0x74, - 0x5f, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x5f, - 0x61, 0x73, 0x5f, 0x65, 0x6d, 0x70, 0x74, 0x79, 0x18, 0x0e, 0x20, 0x01, 0x28, 0x08, 0x52, 0x19, - 0x74, 0x72, 0x65, 0x61, 0x74, 0x4d, 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x48, 0x65, 0x61, 0x64, - 0x65, 0x72, 0x41, 0x73, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x3a, 0x27, 0x9a, 0xc5, 0x88, 0x1e, 0x22, - 0x0a, 0x20, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x72, - 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x4d, 0x61, 0x74, 0x63, 0x68, - 0x65, 0x72, 0x42, 0x18, 0x0a, 0x16, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x5f, 0x6d, 0x61, 0x74, - 0x63, 0x68, 0x5f, 0x73, 0x70, 0x65, 0x63, 0x69, 0x66, 0x69, 0x65, 0x72, 0x4a, 0x04, 0x08, 0x02, - 0x10, 0x03, 0x4a, 0x04, 0x08, 0x03, 0x10, 0x04, 0x4a, 0x04, 0x08, 0x05, 0x10, 0x06, 0x52, 0x0b, - 0x72, 0x65, 0x67, 0x65, 0x78, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x22, 0xa1, 0x02, 0x0a, 0x15, - 0x51, 0x75, 0x65, 0x72, 0x79, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x4d, 0x61, - 0x74, 0x63, 0x68, 0x65, 0x72, 0x12, 0x1e, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x09, 0x42, 0x0a, 0xfa, 0x42, 0x07, 0x72, 0x05, 0x10, 0x01, 0x28, 0x80, 0x08, 0x52, - 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x53, 0x0a, 0x0c, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x5f, - 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x65, 0x6e, - 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, - 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, - 0x72, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x8a, 0x01, 0x02, 0x10, 0x01, 0x48, 0x00, 0x52, 0x0b, 0x73, - 0x74, 0x72, 0x69, 0x6e, 0x67, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x25, 0x0a, 0x0d, 0x70, 0x72, - 0x65, 0x73, 0x65, 0x6e, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x06, 0x20, 0x01, 0x28, - 0x08, 0x48, 0x00, 0x52, 0x0c, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, - 0x68, 0x3a, 0x2f, 0x9a, 0xc5, 0x88, 0x1e, 0x2a, 0x0a, 0x28, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, - 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x51, 0x75, 0x65, - 0x72, 0x79, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x4d, 0x61, 0x74, 0x63, 0x68, - 0x65, 0x72, 0x42, 0x21, 0x0a, 0x1f, 0x71, 0x75, 0x65, 0x72, 0x79, 0x5f, 0x70, 0x61, 0x72, 0x61, - 0x6d, 0x65, 0x74, 0x65, 0x72, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x5f, 0x73, 0x70, 0x65, 0x63, - 0x69, 0x66, 0x69, 0x65, 0x72, 0x4a, 0x04, 0x08, 0x03, 0x10, 0x04, 0x4a, 0x04, 0x08, 0x04, 0x10, - 0x05, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x05, 0x72, 0x65, 0x67, 0x65, 0x78, 0x22, - 0x86, 0x03, 0x0a, 0x16, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x52, 0x65, 0x64, 0x69, - 0x72, 0x65, 0x63, 0x74, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x52, 0x0a, 0x16, 0x6d, 0x61, - 0x78, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x5f, 0x72, 0x65, 0x64, 0x69, 0x72, - 0x65, 0x63, 0x74, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, + 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4d, 0x65, 0x74, 0x61, 0x44, 0x61, 0x74, + 0x61, 0x2e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x82, 0x01, 0x02, + 0x10, 0x01, 0x52, 0x06, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x12, 0x24, 0x0a, 0x0e, 0x73, 0x6b, + 0x69, 0x70, 0x5f, 0x69, 0x66, 0x5f, 0x61, 0x62, 0x73, 0x65, 0x6e, 0x74, 0x18, 0x05, 0x20, 0x01, + 0x28, 0x08, 0x52, 0x0c, 0x73, 0x6b, 0x69, 0x70, 0x49, 0x66, 0x41, 0x62, 0x73, 0x65, 0x6e, 0x74, + 0x22, 0x26, 0x0a, 0x06, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x12, 0x0b, 0x0a, 0x07, 0x44, 0x59, + 0x4e, 0x41, 0x4d, 0x49, 0x43, 0x10, 0x00, 0x12, 0x0f, 0x0a, 0x0b, 0x52, 0x4f, 0x55, 0x54, 0x45, + 0x5f, 0x45, 0x4e, 0x54, 0x52, 0x59, 0x10, 0x01, 0x1a, 0x97, 0x02, 0x0a, 0x18, 0x51, 0x75, 0x65, + 0x72, 0x79, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, + 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x25, 0x0a, 0x0e, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x5f, 0x6b, 0x65, 0x79, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x64, + 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x4b, 0x65, 0x79, 0x12, 0x32, 0x0a, 0x10, + 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, + 0x0f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, + 0x12, 0x3d, 0x0a, 0x0c, 0x65, 0x78, 0x70, 0x65, 0x63, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, + 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, + 0x75, 0x65, 0x52, 0x0b, 0x65, 0x78, 0x70, 0x65, 0x63, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, + 0x61, 0x0a, 0x10, 0x71, 0x75, 0x65, 0x72, 0x79, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, + 0x65, 0x72, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x65, 0x6e, 0x76, 0x6f, + 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x76, + 0x33, 0x2e, 0x51, 0x75, 0x65, 0x72, 0x79, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, + 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x92, 0x01, 0x02, 0x08, + 0x01, 0x52, 0x0f, 0x71, 0x75, 0x65, 0x72, 0x79, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, + 0x72, 0x73, 0x3a, 0x2a, 0x9a, 0xc5, 0x88, 0x1e, 0x25, 0x0a, 0x23, 0x65, 0x6e, 0x76, 0x6f, 0x79, + 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x52, 0x61, + 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x2e, 0x41, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x17, + 0x0a, 0x10, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x73, 0x70, 0x65, 0x63, 0x69, 0x66, 0x69, + 0x65, 0x72, 0x12, 0x03, 0xf8, 0x42, 0x01, 0x1a, 0xf2, 0x01, 0x0a, 0x08, 0x4f, 0x76, 0x65, 0x72, + 0x72, 0x69, 0x64, 0x65, 0x12, 0x66, 0x0a, 0x10, 0x64, 0x79, 0x6e, 0x61, 0x6d, 0x69, 0x63, 0x5f, + 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x39, + 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x6f, + 0x75, 0x74, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, + 0x2e, 0x4f, 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, 0x65, 0x2e, 0x44, 0x79, 0x6e, 0x61, 0x6d, 0x69, + 0x63, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x48, 0x00, 0x52, 0x0f, 0x64, 0x79, 0x6e, + 0x61, 0x6d, 0x69, 0x63, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x1a, 0x63, 0x0a, 0x0f, + 0x44, 0x79, 0x6e, 0x61, 0x6d, 0x69, 0x63, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x12, + 0x50, 0x0a, 0x0c, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x5f, 0x6b, 0x65, 0x79, 0x18, + 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x23, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, + 0x70, 0x65, 0x2e, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x2e, 0x76, 0x33, 0x2e, 0x4d, + 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x4b, 0x65, 0x79, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x8a, + 0x01, 0x02, 0x10, 0x01, 0x52, 0x0b, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x4b, 0x65, + 0x79, 0x42, 0x19, 0x0a, 0x12, 0x6f, 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, 0x65, 0x5f, 0x73, 0x70, + 0x65, 0x63, 0x69, 0x66, 0x69, 0x65, 0x72, 0x12, 0x03, 0xf8, 0x42, 0x01, 0x1a, 0x77, 0x0a, 0x0a, + 0x48, 0x69, 0x74, 0x73, 0x41, 0x64, 0x64, 0x65, 0x6e, 0x64, 0x12, 0x41, 0x0a, 0x06, 0x6e, 0x75, + 0x6d, 0x62, 0x65, 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, - 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x14, 0x6d, 0x61, 0x78, 0x49, 0x6e, 0x74, - 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x52, 0x65, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x73, 0x12, 0x40, - 0x0a, 0x17, 0x72, 0x65, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x5f, 0x72, 0x65, 0x73, 0x70, 0x6f, - 0x6e, 0x73, 0x65, 0x5f, 0x63, 0x6f, 0x64, 0x65, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0d, 0x42, - 0x08, 0xfa, 0x42, 0x05, 0x92, 0x01, 0x02, 0x10, 0x05, 0x52, 0x15, 0x72, 0x65, 0x64, 0x69, 0x72, - 0x65, 0x63, 0x74, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x43, 0x6f, 0x64, 0x65, 0x73, - 0x12, 0x4a, 0x0a, 0x0a, 0x70, 0x72, 0x65, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x73, 0x18, 0x03, - 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x79, 0x70, 0x65, - 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x52, 0x0a, 0x70, 0x72, 0x65, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x73, 0x12, 0x3d, 0x0a, 0x1b, - 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x5f, 0x63, 0x72, 0x6f, 0x73, 0x73, 0x5f, 0x73, 0x63, 0x68, 0x65, - 0x6d, 0x65, 0x5f, 0x72, 0x65, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x18, 0x04, 0x20, 0x01, 0x28, - 0x08, 0x52, 0x18, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x43, 0x72, 0x6f, 0x73, 0x73, 0x53, 0x63, 0x68, - 0x65, 0x6d, 0x65, 0x52, 0x65, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x12, 0x4b, 0x0a, 0x18, 0x72, - 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x5f, - 0x74, 0x6f, 0x5f, 0x63, 0x6f, 0x70, 0x79, 0x18, 0x05, 0x20, 0x03, 0x28, 0x09, 0x42, 0x12, 0xfa, - 0x42, 0x0f, 0x92, 0x01, 0x0c, 0x18, 0x01, 0x22, 0x08, 0x72, 0x06, 0xc8, 0x01, 0x00, 0xc0, 0x01, - 0x01, 0x52, 0x15, 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x48, 0x65, 0x61, 0x64, 0x65, - 0x72, 0x73, 0x54, 0x6f, 0x43, 0x6f, 0x70, 0x79, 0x22, 0x79, 0x0a, 0x0c, 0x46, 0x69, 0x6c, 0x74, - 0x65, 0x72, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x2c, 0x0a, 0x06, 0x63, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x14, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x41, 0x6e, 0x79, 0x52, 0x06, - 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x1f, 0x0a, 0x0b, 0x69, 0x73, 0x5f, 0x6f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0a, 0x69, 0x73, 0x4f, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x12, 0x1a, 0x0a, 0x08, 0x64, 0x69, 0x73, 0x61, 0x62, - 0x6c, 0x65, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x52, 0x08, 0x64, 0x69, 0x73, 0x61, 0x62, - 0x6c, 0x65, 0x64, 0x42, 0x8b, 0x01, 0xba, 0x80, 0xc8, 0xd1, 0x06, 0x02, 0x10, 0x02, 0x0a, 0x23, - 0x69, 0x6f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2e, 0x65, 0x6e, - 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, - 0x2e, 0x76, 0x33, 0x42, 0x14, 0x52, 0x6f, 0x75, 0x74, 0x65, 0x43, 0x6f, 0x6d, 0x70, 0x6f, 0x6e, - 0x65, 0x6e, 0x74, 0x73, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x44, 0x67, 0x69, 0x74, - 0x68, 0x75, 0x62, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, - 0x78, 0x79, 0x2f, 0x67, 0x6f, 0x2d, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x2d, 0x70, 0x6c, - 0x61, 0x6e, 0x65, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x2f, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2f, 0x76, 0x33, 0x3b, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x76, - 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x74, 0x36, 0x34, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x0b, 0xfa, 0x42, 0x08, 0x32, 0x06, 0x18, + 0x80, 0x94, 0xeb, 0xdc, 0x03, 0x52, 0x06, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x12, 0x26, 0x0a, + 0x06, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x0e, 0xfa, + 0x42, 0x0b, 0x72, 0x09, 0x3a, 0x01, 0x25, 0x42, 0x01, 0x25, 0xd0, 0x01, 0x01, 0x52, 0x06, 0x66, + 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x3a, 0x23, 0x9a, 0xc5, 0x88, 0x1e, 0x1e, 0x0a, 0x1c, 0x65, 0x6e, + 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, + 0x2e, 0x52, 0x61, 0x74, 0x65, 0x4c, 0x69, 0x6d, 0x69, 0x74, 0x22, 0xe6, 0x05, 0x0a, 0x0d, 0x48, + 0x65, 0x61, 0x64, 0x65, 0x72, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x12, 0x21, 0x0a, 0x04, + 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x0d, 0xfa, 0x42, 0x0a, 0x72, + 0x08, 0x10, 0x01, 0xc8, 0x01, 0x00, 0xc0, 0x01, 0x01, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, + 0x2e, 0x0a, 0x0b, 0x65, 0x78, 0x61, 0x63, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x04, + 0x20, 0x01, 0x28, 0x09, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, + 0x01, 0x48, 0x00, 0x52, 0x0a, 0x65, 0x78, 0x61, 0x63, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, + 0x5c, 0x0a, 0x10, 0x73, 0x61, 0x66, 0x65, 0x5f, 0x72, 0x65, 0x67, 0x65, 0x78, 0x5f, 0x6d, 0x61, + 0x74, 0x63, 0x68, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x23, 0x2e, 0x65, 0x6e, 0x76, 0x6f, + 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x2e, 0x76, + 0x33, 0x2e, 0x52, 0x65, 0x67, 0x65, 0x78, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x42, 0x0b, + 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x48, 0x00, 0x52, 0x0e, 0x73, + 0x61, 0x66, 0x65, 0x52, 0x65, 0x67, 0x65, 0x78, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x3c, 0x0a, + 0x0b, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x06, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x2e, + 0x76, 0x33, 0x2e, 0x49, 0x6e, 0x74, 0x36, 0x34, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x48, 0x00, 0x52, + 0x0a, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x25, 0x0a, 0x0d, 0x70, + 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x07, 0x20, 0x01, + 0x28, 0x08, 0x48, 0x00, 0x52, 0x0c, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, + 0x63, 0x68, 0x12, 0x37, 0x0a, 0x0c, 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x5f, 0x6d, 0x61, 0x74, + 0x63, 0x68, 0x18, 0x09, 0x20, 0x01, 0x28, 0x09, 0x42, 0x12, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, + 0x01, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x48, 0x00, 0x52, 0x0b, + 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x37, 0x0a, 0x0c, 0x73, + 0x75, 0x66, 0x66, 0x69, 0x78, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x0a, 0x20, 0x01, 0x28, + 0x09, 0x42, 0x12, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, + 0x33, 0x2e, 0x30, 0x18, 0x01, 0x48, 0x00, 0x52, 0x0b, 0x73, 0x75, 0x66, 0x66, 0x69, 0x78, 0x4d, + 0x61, 0x74, 0x63, 0x68, 0x12, 0x3b, 0x0a, 0x0e, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x73, + 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x09, 0x42, 0x12, 0xfa, 0x42, + 0x04, 0x72, 0x02, 0x10, 0x01, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, + 0x48, 0x00, 0x52, 0x0d, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x73, 0x4d, 0x61, 0x74, 0x63, + 0x68, 0x12, 0x49, 0x0a, 0x0c, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x5f, 0x6d, 0x61, 0x74, 0x63, + 0x68, 0x18, 0x0d, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, + 0x74, 0x79, 0x70, 0x65, 0x2e, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, + 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x48, 0x00, 0x52, + 0x0b, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x21, 0x0a, 0x0c, + 0x69, 0x6e, 0x76, 0x65, 0x72, 0x74, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x08, 0x20, 0x01, + 0x28, 0x08, 0x52, 0x0b, 0x69, 0x6e, 0x76, 0x65, 0x72, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x12, + 0x40, 0x0a, 0x1d, 0x74, 0x72, 0x65, 0x61, 0x74, 0x5f, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, + 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x5f, 0x61, 0x73, 0x5f, 0x65, 0x6d, 0x70, 0x74, 0x79, + 0x18, 0x0e, 0x20, 0x01, 0x28, 0x08, 0x52, 0x19, 0x74, 0x72, 0x65, 0x61, 0x74, 0x4d, 0x69, 0x73, + 0x73, 0x69, 0x6e, 0x67, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x41, 0x73, 0x45, 0x6d, 0x70, 0x74, + 0x79, 0x3a, 0x27, 0x9a, 0xc5, 0x88, 0x1e, 0x22, 0x0a, 0x20, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, + 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x48, 0x65, 0x61, + 0x64, 0x65, 0x72, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x42, 0x18, 0x0a, 0x16, 0x68, 0x65, + 0x61, 0x64, 0x65, 0x72, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x5f, 0x73, 0x70, 0x65, 0x63, 0x69, + 0x66, 0x69, 0x65, 0x72, 0x4a, 0x04, 0x08, 0x02, 0x10, 0x03, 0x4a, 0x04, 0x08, 0x03, 0x10, 0x04, + 0x4a, 0x04, 0x08, 0x05, 0x10, 0x06, 0x52, 0x0b, 0x72, 0x65, 0x67, 0x65, 0x78, 0x5f, 0x6d, 0x61, + 0x74, 0x63, 0x68, 0x22, 0xa1, 0x02, 0x0a, 0x15, 0x51, 0x75, 0x65, 0x72, 0x79, 0x50, 0x61, 0x72, + 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x12, 0x1e, 0x0a, + 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x0a, 0xfa, 0x42, 0x07, + 0x72, 0x05, 0x10, 0x01, 0x28, 0x80, 0x08, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x53, 0x0a, + 0x0c, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x5f, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x05, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x74, 0x79, 0x70, 0x65, + 0x2e, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x74, 0x72, 0x69, + 0x6e, 0x67, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x8a, 0x01, + 0x02, 0x10, 0x01, 0x48, 0x00, 0x52, 0x0b, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x4d, 0x61, 0x74, + 0x63, 0x68, 0x12, 0x25, 0x0a, 0x0d, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x5f, 0x6d, 0x61, + 0x74, 0x63, 0x68, 0x18, 0x06, 0x20, 0x01, 0x28, 0x08, 0x48, 0x00, 0x52, 0x0c, 0x70, 0x72, 0x65, + 0x73, 0x65, 0x6e, 0x74, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x3a, 0x2f, 0x9a, 0xc5, 0x88, 0x1e, 0x2a, + 0x0a, 0x28, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x72, + 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x51, 0x75, 0x65, 0x72, 0x79, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, + 0x74, 0x65, 0x72, 0x4d, 0x61, 0x74, 0x63, 0x68, 0x65, 0x72, 0x42, 0x21, 0x0a, 0x1f, 0x71, 0x75, + 0x65, 0x72, 0x79, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x5f, 0x6d, 0x61, + 0x74, 0x63, 0x68, 0x5f, 0x73, 0x70, 0x65, 0x63, 0x69, 0x66, 0x69, 0x65, 0x72, 0x4a, 0x04, 0x08, + 0x03, 0x10, 0x04, 0x4a, 0x04, 0x08, 0x04, 0x10, 0x05, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, + 0x52, 0x05, 0x72, 0x65, 0x67, 0x65, 0x78, 0x22, 0x86, 0x03, 0x0a, 0x16, 0x49, 0x6e, 0x74, 0x65, + 0x72, 0x6e, 0x61, 0x6c, 0x52, 0x65, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x50, 0x6f, 0x6c, 0x69, + 0x63, 0x79, 0x12, 0x52, 0x0a, 0x16, 0x6d, 0x61, 0x78, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, + 0x61, 0x6c, 0x5f, 0x72, 0x65, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x73, 0x18, 0x01, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, + 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, + 0x52, 0x14, 0x6d, 0x61, 0x78, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x52, 0x65, 0x64, + 0x69, 0x72, 0x65, 0x63, 0x74, 0x73, 0x12, 0x40, 0x0a, 0x17, 0x72, 0x65, 0x64, 0x69, 0x72, 0x65, + 0x63, 0x74, 0x5f, 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x5f, 0x63, 0x6f, 0x64, 0x65, + 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0d, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x92, 0x01, 0x02, 0x10, + 0x05, 0x52, 0x15, 0x72, 0x65, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x52, 0x65, 0x73, 0x70, 0x6f, + 0x6e, 0x73, 0x65, 0x43, 0x6f, 0x64, 0x65, 0x73, 0x12, 0x4a, 0x0a, 0x0a, 0x70, 0x72, 0x65, 0x64, + 0x69, 0x63, 0x61, 0x74, 0x65, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x65, + 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, + 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x79, 0x70, 0x65, 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, + 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x0a, 0x70, 0x72, 0x65, 0x64, 0x69, 0x63, + 0x61, 0x74, 0x65, 0x73, 0x12, 0x3d, 0x0a, 0x1b, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x5f, 0x63, 0x72, + 0x6f, 0x73, 0x73, 0x5f, 0x73, 0x63, 0x68, 0x65, 0x6d, 0x65, 0x5f, 0x72, 0x65, 0x64, 0x69, 0x72, + 0x65, 0x63, 0x74, 0x18, 0x04, 0x20, 0x01, 0x28, 0x08, 0x52, 0x18, 0x61, 0x6c, 0x6c, 0x6f, 0x77, + 0x43, 0x72, 0x6f, 0x73, 0x73, 0x53, 0x63, 0x68, 0x65, 0x6d, 0x65, 0x52, 0x65, 0x64, 0x69, 0x72, + 0x65, 0x63, 0x74, 0x12, 0x4b, 0x0a, 0x18, 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x5f, + 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x5f, 0x74, 0x6f, 0x5f, 0x63, 0x6f, 0x70, 0x79, 0x18, + 0x05, 0x20, 0x03, 0x28, 0x09, 0x42, 0x12, 0xfa, 0x42, 0x0f, 0x92, 0x01, 0x0c, 0x18, 0x01, 0x22, + 0x08, 0x72, 0x06, 0xc8, 0x01, 0x00, 0xc0, 0x01, 0x01, 0x52, 0x15, 0x72, 0x65, 0x73, 0x70, 0x6f, + 0x6e, 0x73, 0x65, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x54, 0x6f, 0x43, 0x6f, 0x70, 0x79, + 0x22, 0x79, 0x0a, 0x0c, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, + 0x12, 0x2c, 0x0a, 0x06, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x14, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, + 0x75, 0x66, 0x2e, 0x41, 0x6e, 0x79, 0x52, 0x06, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x1f, + 0x0a, 0x0b, 0x69, 0x73, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x18, 0x02, 0x20, + 0x01, 0x28, 0x08, 0x52, 0x0a, 0x69, 0x73, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x12, + 0x1a, 0x0a, 0x08, 0x64, 0x69, 0x73, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, + 0x08, 0x52, 0x08, 0x64, 0x69, 0x73, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x42, 0x8b, 0x01, 0xba, 0x80, + 0xc8, 0xd1, 0x06, 0x02, 0x10, 0x02, 0x0a, 0x23, 0x69, 0x6f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, + 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, + 0x69, 0x67, 0x2e, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x76, 0x33, 0x42, 0x14, 0x52, 0x6f, 0x75, + 0x74, 0x65, 0x43, 0x6f, 0x6d, 0x70, 0x6f, 0x6e, 0x65, 0x6e, 0x74, 0x73, 0x50, 0x72, 0x6f, 0x74, + 0x6f, 0x50, 0x01, 0x5a, 0x44, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, + 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2f, 0x67, 0x6f, 0x2d, 0x63, 0x6f, + 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x2d, 0x70, 0x6c, 0x61, 0x6e, 0x65, 0x2f, 0x65, 0x6e, 0x76, 0x6f, + 0x79, 0x2f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2f, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2f, 0x76, + 0x33, 0x3b, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x76, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x33, } var ( @@ -8045,7 +8195,7 @@ func file_envoy_config_route_v3_route_components_proto_rawDescGZIP() []byte { } var file_envoy_config_route_v3_route_components_proto_enumTypes = make([]protoimpl.EnumInfo, 6) -var file_envoy_config_route_v3_route_components_proto_msgTypes = make([]protoimpl.MessageInfo, 58) +var file_envoy_config_route_v3_route_components_proto_msgTypes = make([]protoimpl.MessageInfo, 59) var file_envoy_config_route_v3_route_components_proto_goTypes = []interface{}{ (VirtualHost_TlsRequirementType)(0), // 0: envoy.config.route.v3.VirtualHost.TlsRequirementType (RouteAction_ClusterNotFoundResponseCode)(0), // 1: envoy.config.route.v3.RouteAction.ClusterNotFoundResponseCode @@ -8100,55 +8250,57 @@ var file_envoy_config_route_v3_route_components_proto_goTypes = []interface{}{ (*RetryPolicy_RateLimitedRetryBackOff)(nil), // 50: envoy.config.route.v3.RetryPolicy.RateLimitedRetryBackOff (*RateLimit_Action)(nil), // 51: envoy.config.route.v3.RateLimit.Action (*RateLimit_Override)(nil), // 52: envoy.config.route.v3.RateLimit.Override - (*RateLimit_Action_SourceCluster)(nil), // 53: envoy.config.route.v3.RateLimit.Action.SourceCluster - (*RateLimit_Action_DestinationCluster)(nil), // 54: envoy.config.route.v3.RateLimit.Action.DestinationCluster - (*RateLimit_Action_RequestHeaders)(nil), // 55: envoy.config.route.v3.RateLimit.Action.RequestHeaders - (*RateLimit_Action_RemoteAddress)(nil), // 56: envoy.config.route.v3.RateLimit.Action.RemoteAddress - (*RateLimit_Action_MaskedRemoteAddress)(nil), // 57: envoy.config.route.v3.RateLimit.Action.MaskedRemoteAddress - (*RateLimit_Action_GenericKey)(nil), // 58: envoy.config.route.v3.RateLimit.Action.GenericKey - (*RateLimit_Action_HeaderValueMatch)(nil), // 59: envoy.config.route.v3.RateLimit.Action.HeaderValueMatch - (*RateLimit_Action_DynamicMetaData)(nil), // 60: envoy.config.route.v3.RateLimit.Action.DynamicMetaData - (*RateLimit_Action_MetaData)(nil), // 61: envoy.config.route.v3.RateLimit.Action.MetaData - (*RateLimit_Action_QueryParameterValueMatch)(nil), // 62: envoy.config.route.v3.RateLimit.Action.QueryParameterValueMatch - (*RateLimit_Override_DynamicMetadata)(nil), // 63: envoy.config.route.v3.RateLimit.Override.DynamicMetadata - (*v3.Matcher)(nil), // 64: xds.type.matcher.v3.Matcher - (*v31.HeaderValueOption)(nil), // 65: envoy.config.core.v3.HeaderValueOption - (*anypb.Any)(nil), // 66: google.protobuf.Any - (*wrapperspb.UInt32Value)(nil), // 67: google.protobuf.UInt32Value - (*v31.Metadata)(nil), // 68: envoy.config.core.v3.Metadata - (*v31.TypedExtensionConfig)(nil), // 69: envoy.config.core.v3.TypedExtensionConfig - (*v32.RegexMatcher)(nil), // 70: envoy.type.matcher.v3.RegexMatcher - (*wrapperspb.BoolValue)(nil), // 71: google.protobuf.BoolValue - (*v31.RuntimeFractionalPercent)(nil), // 72: envoy.config.core.v3.RuntimeFractionalPercent - (*v32.MetadataMatcher)(nil), // 73: envoy.type.matcher.v3.MetadataMatcher - (*v32.StringMatcher)(nil), // 74: envoy.type.matcher.v3.StringMatcher - (*v32.RegexMatchAndSubstitute)(nil), // 75: envoy.type.matcher.v3.RegexMatchAndSubstitute - (*durationpb.Duration)(nil), // 76: google.protobuf.Duration - (v31.RoutingPriority)(0), // 77: envoy.config.core.v3.RoutingPriority - (*v33.FractionalPercent)(nil), // 78: envoy.type.v3.FractionalPercent - (*v31.DataSource)(nil), // 79: envoy.config.core.v3.DataSource - (*v34.CustomTag)(nil), // 80: envoy.type.tracing.v3.CustomTag - (*v33.Int64Range)(nil), // 81: envoy.type.v3.Int64Range - (*v31.ProxyProtocolConfig)(nil), // 82: envoy.config.core.v3.ProxyProtocolConfig - (*v35.MetadataKey)(nil), // 83: envoy.type.metadata.v3.MetadataKey + (*RateLimit_HitsAddend)(nil), // 53: envoy.config.route.v3.RateLimit.HitsAddend + (*RateLimit_Action_SourceCluster)(nil), // 54: envoy.config.route.v3.RateLimit.Action.SourceCluster + (*RateLimit_Action_DestinationCluster)(nil), // 55: envoy.config.route.v3.RateLimit.Action.DestinationCluster + (*RateLimit_Action_RequestHeaders)(nil), // 56: envoy.config.route.v3.RateLimit.Action.RequestHeaders + (*RateLimit_Action_RemoteAddress)(nil), // 57: envoy.config.route.v3.RateLimit.Action.RemoteAddress + (*RateLimit_Action_MaskedRemoteAddress)(nil), // 58: envoy.config.route.v3.RateLimit.Action.MaskedRemoteAddress + (*RateLimit_Action_GenericKey)(nil), // 59: envoy.config.route.v3.RateLimit.Action.GenericKey + (*RateLimit_Action_HeaderValueMatch)(nil), // 60: envoy.config.route.v3.RateLimit.Action.HeaderValueMatch + (*RateLimit_Action_DynamicMetaData)(nil), // 61: envoy.config.route.v3.RateLimit.Action.DynamicMetaData + (*RateLimit_Action_MetaData)(nil), // 62: envoy.config.route.v3.RateLimit.Action.MetaData + (*RateLimit_Action_QueryParameterValueMatch)(nil), // 63: envoy.config.route.v3.RateLimit.Action.QueryParameterValueMatch + (*RateLimit_Override_DynamicMetadata)(nil), // 64: envoy.config.route.v3.RateLimit.Override.DynamicMetadata + (*v3.Matcher)(nil), // 65: xds.type.matcher.v3.Matcher + (*v31.HeaderValueOption)(nil), // 66: envoy.config.core.v3.HeaderValueOption + (*anypb.Any)(nil), // 67: google.protobuf.Any + (*wrapperspb.UInt32Value)(nil), // 68: google.protobuf.UInt32Value + (*v31.Metadata)(nil), // 69: envoy.config.core.v3.Metadata + (*v31.TypedExtensionConfig)(nil), // 70: envoy.config.core.v3.TypedExtensionConfig + (*v32.RegexMatcher)(nil), // 71: envoy.type.matcher.v3.RegexMatcher + (*wrapperspb.BoolValue)(nil), // 72: google.protobuf.BoolValue + (*v31.RuntimeFractionalPercent)(nil), // 73: envoy.config.core.v3.RuntimeFractionalPercent + (*v32.MetadataMatcher)(nil), // 74: envoy.type.matcher.v3.MetadataMatcher + (*v32.StringMatcher)(nil), // 75: envoy.type.matcher.v3.StringMatcher + (*v32.RegexMatchAndSubstitute)(nil), // 76: envoy.type.matcher.v3.RegexMatchAndSubstitute + (*durationpb.Duration)(nil), // 77: google.protobuf.Duration + (v31.RoutingPriority)(0), // 78: envoy.config.core.v3.RoutingPriority + (*v33.FractionalPercent)(nil), // 79: envoy.type.v3.FractionalPercent + (*v31.DataSource)(nil), // 80: envoy.config.core.v3.DataSource + (*v34.CustomTag)(nil), // 81: envoy.type.tracing.v3.CustomTag + (*v33.Int64Range)(nil), // 82: envoy.type.v3.Int64Range + (*v31.ProxyProtocolConfig)(nil), // 83: envoy.config.core.v3.ProxyProtocolConfig + (*wrapperspb.UInt64Value)(nil), // 84: google.protobuf.UInt64Value + (*v35.MetadataKey)(nil), // 85: envoy.type.metadata.v3.MetadataKey } var file_envoy_config_route_v3_route_components_proto_depIdxs = []int32{ 9, // 0: envoy.config.route.v3.VirtualHost.routes:type_name -> envoy.config.route.v3.Route - 64, // 1: envoy.config.route.v3.VirtualHost.matcher:type_name -> xds.type.matcher.v3.Matcher + 65, // 1: envoy.config.route.v3.VirtualHost.matcher:type_name -> xds.type.matcher.v3.Matcher 0, // 2: envoy.config.route.v3.VirtualHost.require_tls:type_name -> envoy.config.route.v3.VirtualHost.TlsRequirementType 22, // 3: envoy.config.route.v3.VirtualHost.virtual_clusters:type_name -> envoy.config.route.v3.VirtualCluster 23, // 4: envoy.config.route.v3.VirtualHost.rate_limits:type_name -> envoy.config.route.v3.RateLimit - 65, // 5: envoy.config.route.v3.VirtualHost.request_headers_to_add:type_name -> envoy.config.core.v3.HeaderValueOption - 65, // 6: envoy.config.route.v3.VirtualHost.response_headers_to_add:type_name -> envoy.config.core.v3.HeaderValueOption + 66, // 5: envoy.config.route.v3.VirtualHost.request_headers_to_add:type_name -> envoy.config.core.v3.HeaderValueOption + 66, // 6: envoy.config.route.v3.VirtualHost.response_headers_to_add:type_name -> envoy.config.core.v3.HeaderValueOption 13, // 7: envoy.config.route.v3.VirtualHost.cors:type_name -> envoy.config.route.v3.CorsPolicy 28, // 8: envoy.config.route.v3.VirtualHost.typed_per_filter_config:type_name -> envoy.config.route.v3.VirtualHost.TypedPerFilterConfigEntry 15, // 9: envoy.config.route.v3.VirtualHost.retry_policy:type_name -> envoy.config.route.v3.RetryPolicy - 66, // 10: envoy.config.route.v3.VirtualHost.retry_policy_typed_config:type_name -> google.protobuf.Any + 67, // 10: envoy.config.route.v3.VirtualHost.retry_policy_typed_config:type_name -> google.protobuf.Any 16, // 11: envoy.config.route.v3.VirtualHost.hedge_policy:type_name -> envoy.config.route.v3.HedgePolicy - 67, // 12: envoy.config.route.v3.VirtualHost.per_request_buffer_limit_bytes:type_name -> google.protobuf.UInt32Value + 68, // 12: envoy.config.route.v3.VirtualHost.per_request_buffer_limit_bytes:type_name -> google.protobuf.UInt32Value 35, // 13: envoy.config.route.v3.VirtualHost.request_mirror_policies:type_name -> envoy.config.route.v3.RouteAction.RequestMirrorPolicy - 68, // 14: envoy.config.route.v3.VirtualHost.metadata:type_name -> envoy.config.core.v3.Metadata - 66, // 15: envoy.config.route.v3.FilterAction.action:type_name -> google.protobuf.Any + 69, // 14: envoy.config.route.v3.VirtualHost.metadata:type_name -> envoy.config.core.v3.Metadata + 67, // 15: envoy.config.route.v3.FilterAction.action:type_name -> google.protobuf.Any 9, // 16: envoy.config.route.v3.RouteList.routes:type_name -> envoy.config.route.v3.Route 12, // 17: envoy.config.route.v3.Route.match:type_name -> envoy.config.route.v3.RouteMatch 14, // 18: envoy.config.route.v3.Route.route:type_name -> envoy.config.route.v3.RouteAction @@ -8156,150 +8308,152 @@ var file_envoy_config_route_v3_route_components_proto_depIdxs = []int32{ 18, // 20: envoy.config.route.v3.Route.direct_response:type_name -> envoy.config.route.v3.DirectResponseAction 7, // 21: envoy.config.route.v3.Route.filter_action:type_name -> envoy.config.route.v3.FilterAction 19, // 22: envoy.config.route.v3.Route.non_forwarding_action:type_name -> envoy.config.route.v3.NonForwardingAction - 68, // 23: envoy.config.route.v3.Route.metadata:type_name -> envoy.config.core.v3.Metadata + 69, // 23: envoy.config.route.v3.Route.metadata:type_name -> envoy.config.core.v3.Metadata 20, // 24: envoy.config.route.v3.Route.decorator:type_name -> envoy.config.route.v3.Decorator 29, // 25: envoy.config.route.v3.Route.typed_per_filter_config:type_name -> envoy.config.route.v3.Route.TypedPerFilterConfigEntry - 65, // 26: envoy.config.route.v3.Route.request_headers_to_add:type_name -> envoy.config.core.v3.HeaderValueOption - 65, // 27: envoy.config.route.v3.Route.response_headers_to_add:type_name -> envoy.config.core.v3.HeaderValueOption + 66, // 26: envoy.config.route.v3.Route.request_headers_to_add:type_name -> envoy.config.core.v3.HeaderValueOption + 66, // 27: envoy.config.route.v3.Route.response_headers_to_add:type_name -> envoy.config.core.v3.HeaderValueOption 21, // 28: envoy.config.route.v3.Route.tracing:type_name -> envoy.config.route.v3.Tracing - 67, // 29: envoy.config.route.v3.Route.per_request_buffer_limit_bytes:type_name -> google.protobuf.UInt32Value + 68, // 29: envoy.config.route.v3.Route.per_request_buffer_limit_bytes:type_name -> google.protobuf.UInt32Value 30, // 30: envoy.config.route.v3.WeightedCluster.clusters:type_name -> envoy.config.route.v3.WeightedCluster.ClusterWeight - 67, // 31: envoy.config.route.v3.WeightedCluster.total_weight:type_name -> google.protobuf.UInt32Value - 69, // 32: envoy.config.route.v3.ClusterSpecifierPlugin.extension:type_name -> envoy.config.core.v3.TypedExtensionConfig - 70, // 33: envoy.config.route.v3.RouteMatch.safe_regex:type_name -> envoy.type.matcher.v3.RegexMatcher + 68, // 31: envoy.config.route.v3.WeightedCluster.total_weight:type_name -> google.protobuf.UInt32Value + 70, // 32: envoy.config.route.v3.ClusterSpecifierPlugin.extension:type_name -> envoy.config.core.v3.TypedExtensionConfig + 71, // 33: envoy.config.route.v3.RouteMatch.safe_regex:type_name -> envoy.type.matcher.v3.RegexMatcher 34, // 34: envoy.config.route.v3.RouteMatch.connect_matcher:type_name -> envoy.config.route.v3.RouteMatch.ConnectMatcher - 69, // 35: envoy.config.route.v3.RouteMatch.path_match_policy:type_name -> envoy.config.core.v3.TypedExtensionConfig - 71, // 36: envoy.config.route.v3.RouteMatch.case_sensitive:type_name -> google.protobuf.BoolValue - 72, // 37: envoy.config.route.v3.RouteMatch.runtime_fraction:type_name -> envoy.config.core.v3.RuntimeFractionalPercent + 70, // 35: envoy.config.route.v3.RouteMatch.path_match_policy:type_name -> envoy.config.core.v3.TypedExtensionConfig + 72, // 36: envoy.config.route.v3.RouteMatch.case_sensitive:type_name -> google.protobuf.BoolValue + 73, // 37: envoy.config.route.v3.RouteMatch.runtime_fraction:type_name -> envoy.config.core.v3.RuntimeFractionalPercent 24, // 38: envoy.config.route.v3.RouteMatch.headers:type_name -> envoy.config.route.v3.HeaderMatcher 25, // 39: envoy.config.route.v3.RouteMatch.query_parameters:type_name -> envoy.config.route.v3.QueryParameterMatcher 32, // 40: envoy.config.route.v3.RouteMatch.grpc:type_name -> envoy.config.route.v3.RouteMatch.GrpcRouteMatchOptions 33, // 41: envoy.config.route.v3.RouteMatch.tls_context:type_name -> envoy.config.route.v3.RouteMatch.TlsContextMatchOptions - 73, // 42: envoy.config.route.v3.RouteMatch.dynamic_metadata:type_name -> envoy.type.matcher.v3.MetadataMatcher - 74, // 43: envoy.config.route.v3.CorsPolicy.allow_origin_string_match:type_name -> envoy.type.matcher.v3.StringMatcher - 71, // 44: envoy.config.route.v3.CorsPolicy.allow_credentials:type_name -> google.protobuf.BoolValue - 72, // 45: envoy.config.route.v3.CorsPolicy.filter_enabled:type_name -> envoy.config.core.v3.RuntimeFractionalPercent - 72, // 46: envoy.config.route.v3.CorsPolicy.shadow_enabled:type_name -> envoy.config.core.v3.RuntimeFractionalPercent - 71, // 47: envoy.config.route.v3.CorsPolicy.allow_private_network_access:type_name -> google.protobuf.BoolValue - 71, // 48: envoy.config.route.v3.CorsPolicy.forward_not_matching_preflights:type_name -> google.protobuf.BoolValue + 74, // 42: envoy.config.route.v3.RouteMatch.dynamic_metadata:type_name -> envoy.type.matcher.v3.MetadataMatcher + 75, // 43: envoy.config.route.v3.CorsPolicy.allow_origin_string_match:type_name -> envoy.type.matcher.v3.StringMatcher + 72, // 44: envoy.config.route.v3.CorsPolicy.allow_credentials:type_name -> google.protobuf.BoolValue + 73, // 45: envoy.config.route.v3.CorsPolicy.filter_enabled:type_name -> envoy.config.core.v3.RuntimeFractionalPercent + 73, // 46: envoy.config.route.v3.CorsPolicy.shadow_enabled:type_name -> envoy.config.core.v3.RuntimeFractionalPercent + 72, // 47: envoy.config.route.v3.CorsPolicy.allow_private_network_access:type_name -> google.protobuf.BoolValue + 72, // 48: envoy.config.route.v3.CorsPolicy.forward_not_matching_preflights:type_name -> google.protobuf.BoolValue 10, // 49: envoy.config.route.v3.RouteAction.weighted_clusters:type_name -> envoy.config.route.v3.WeightedCluster 11, // 50: envoy.config.route.v3.RouteAction.inline_cluster_specifier_plugin:type_name -> envoy.config.route.v3.ClusterSpecifierPlugin 1, // 51: envoy.config.route.v3.RouteAction.cluster_not_found_response_code:type_name -> envoy.config.route.v3.RouteAction.ClusterNotFoundResponseCode - 68, // 52: envoy.config.route.v3.RouteAction.metadata_match:type_name -> envoy.config.core.v3.Metadata - 75, // 53: envoy.config.route.v3.RouteAction.regex_rewrite:type_name -> envoy.type.matcher.v3.RegexMatchAndSubstitute - 69, // 54: envoy.config.route.v3.RouteAction.path_rewrite_policy:type_name -> envoy.config.core.v3.TypedExtensionConfig - 71, // 55: envoy.config.route.v3.RouteAction.auto_host_rewrite:type_name -> google.protobuf.BoolValue - 75, // 56: envoy.config.route.v3.RouteAction.host_rewrite_path_regex:type_name -> envoy.type.matcher.v3.RegexMatchAndSubstitute - 76, // 57: envoy.config.route.v3.RouteAction.timeout:type_name -> google.protobuf.Duration - 76, // 58: envoy.config.route.v3.RouteAction.idle_timeout:type_name -> google.protobuf.Duration - 69, // 59: envoy.config.route.v3.RouteAction.early_data_policy:type_name -> envoy.config.core.v3.TypedExtensionConfig + 69, // 52: envoy.config.route.v3.RouteAction.metadata_match:type_name -> envoy.config.core.v3.Metadata + 76, // 53: envoy.config.route.v3.RouteAction.regex_rewrite:type_name -> envoy.type.matcher.v3.RegexMatchAndSubstitute + 70, // 54: envoy.config.route.v3.RouteAction.path_rewrite_policy:type_name -> envoy.config.core.v3.TypedExtensionConfig + 72, // 55: envoy.config.route.v3.RouteAction.auto_host_rewrite:type_name -> google.protobuf.BoolValue + 76, // 56: envoy.config.route.v3.RouteAction.host_rewrite_path_regex:type_name -> envoy.type.matcher.v3.RegexMatchAndSubstitute + 77, // 57: envoy.config.route.v3.RouteAction.timeout:type_name -> google.protobuf.Duration + 77, // 58: envoy.config.route.v3.RouteAction.idle_timeout:type_name -> google.protobuf.Duration + 70, // 59: envoy.config.route.v3.RouteAction.early_data_policy:type_name -> envoy.config.core.v3.TypedExtensionConfig 15, // 60: envoy.config.route.v3.RouteAction.retry_policy:type_name -> envoy.config.route.v3.RetryPolicy - 66, // 61: envoy.config.route.v3.RouteAction.retry_policy_typed_config:type_name -> google.protobuf.Any + 67, // 61: envoy.config.route.v3.RouteAction.retry_policy_typed_config:type_name -> google.protobuf.Any 35, // 62: envoy.config.route.v3.RouteAction.request_mirror_policies:type_name -> envoy.config.route.v3.RouteAction.RequestMirrorPolicy - 77, // 63: envoy.config.route.v3.RouteAction.priority:type_name -> envoy.config.core.v3.RoutingPriority + 78, // 63: envoy.config.route.v3.RouteAction.priority:type_name -> envoy.config.core.v3.RoutingPriority 23, // 64: envoy.config.route.v3.RouteAction.rate_limits:type_name -> envoy.config.route.v3.RateLimit - 71, // 65: envoy.config.route.v3.RouteAction.include_vh_rate_limits:type_name -> google.protobuf.BoolValue + 72, // 65: envoy.config.route.v3.RouteAction.include_vh_rate_limits:type_name -> google.protobuf.BoolValue 36, // 66: envoy.config.route.v3.RouteAction.hash_policy:type_name -> envoy.config.route.v3.RouteAction.HashPolicy 13, // 67: envoy.config.route.v3.RouteAction.cors:type_name -> envoy.config.route.v3.CorsPolicy - 76, // 68: envoy.config.route.v3.RouteAction.max_grpc_timeout:type_name -> google.protobuf.Duration - 76, // 69: envoy.config.route.v3.RouteAction.grpc_timeout_offset:type_name -> google.protobuf.Duration + 77, // 68: envoy.config.route.v3.RouteAction.max_grpc_timeout:type_name -> google.protobuf.Duration + 77, // 69: envoy.config.route.v3.RouteAction.grpc_timeout_offset:type_name -> google.protobuf.Duration 37, // 70: envoy.config.route.v3.RouteAction.upgrade_configs:type_name -> envoy.config.route.v3.RouteAction.UpgradeConfig 26, // 71: envoy.config.route.v3.RouteAction.internal_redirect_policy:type_name -> envoy.config.route.v3.InternalRedirectPolicy 2, // 72: envoy.config.route.v3.RouteAction.internal_redirect_action:type_name -> envoy.config.route.v3.RouteAction.InternalRedirectAction - 67, // 73: envoy.config.route.v3.RouteAction.max_internal_redirects:type_name -> google.protobuf.UInt32Value + 68, // 73: envoy.config.route.v3.RouteAction.max_internal_redirects:type_name -> google.protobuf.UInt32Value 16, // 74: envoy.config.route.v3.RouteAction.hedge_policy:type_name -> envoy.config.route.v3.HedgePolicy 38, // 75: envoy.config.route.v3.RouteAction.max_stream_duration:type_name -> envoy.config.route.v3.RouteAction.MaxStreamDuration - 67, // 76: envoy.config.route.v3.RetryPolicy.num_retries:type_name -> google.protobuf.UInt32Value - 76, // 77: envoy.config.route.v3.RetryPolicy.per_try_timeout:type_name -> google.protobuf.Duration - 76, // 78: envoy.config.route.v3.RetryPolicy.per_try_idle_timeout:type_name -> google.protobuf.Duration + 68, // 76: envoy.config.route.v3.RetryPolicy.num_retries:type_name -> google.protobuf.UInt32Value + 77, // 77: envoy.config.route.v3.RetryPolicy.per_try_timeout:type_name -> google.protobuf.Duration + 77, // 78: envoy.config.route.v3.RetryPolicy.per_try_idle_timeout:type_name -> google.protobuf.Duration 46, // 79: envoy.config.route.v3.RetryPolicy.retry_priority:type_name -> envoy.config.route.v3.RetryPolicy.RetryPriority 47, // 80: envoy.config.route.v3.RetryPolicy.retry_host_predicate:type_name -> envoy.config.route.v3.RetryPolicy.RetryHostPredicate - 69, // 81: envoy.config.route.v3.RetryPolicy.retry_options_predicates:type_name -> envoy.config.core.v3.TypedExtensionConfig + 70, // 81: envoy.config.route.v3.RetryPolicy.retry_options_predicates:type_name -> envoy.config.core.v3.TypedExtensionConfig 48, // 82: envoy.config.route.v3.RetryPolicy.retry_back_off:type_name -> envoy.config.route.v3.RetryPolicy.RetryBackOff 50, // 83: envoy.config.route.v3.RetryPolicy.rate_limited_retry_back_off:type_name -> envoy.config.route.v3.RetryPolicy.RateLimitedRetryBackOff 24, // 84: envoy.config.route.v3.RetryPolicy.retriable_headers:type_name -> envoy.config.route.v3.HeaderMatcher 24, // 85: envoy.config.route.v3.RetryPolicy.retriable_request_headers:type_name -> envoy.config.route.v3.HeaderMatcher - 67, // 86: envoy.config.route.v3.HedgePolicy.initial_requests:type_name -> google.protobuf.UInt32Value - 78, // 87: envoy.config.route.v3.HedgePolicy.additional_request_chance:type_name -> envoy.type.v3.FractionalPercent - 75, // 88: envoy.config.route.v3.RedirectAction.regex_rewrite:type_name -> envoy.type.matcher.v3.RegexMatchAndSubstitute + 68, // 86: envoy.config.route.v3.HedgePolicy.initial_requests:type_name -> google.protobuf.UInt32Value + 79, // 87: envoy.config.route.v3.HedgePolicy.additional_request_chance:type_name -> envoy.type.v3.FractionalPercent + 76, // 88: envoy.config.route.v3.RedirectAction.regex_rewrite:type_name -> envoy.type.matcher.v3.RegexMatchAndSubstitute 4, // 89: envoy.config.route.v3.RedirectAction.response_code:type_name -> envoy.config.route.v3.RedirectAction.RedirectResponseCode - 79, // 90: envoy.config.route.v3.DirectResponseAction.body:type_name -> envoy.config.core.v3.DataSource - 71, // 91: envoy.config.route.v3.Decorator.propagate:type_name -> google.protobuf.BoolValue - 78, // 92: envoy.config.route.v3.Tracing.client_sampling:type_name -> envoy.type.v3.FractionalPercent - 78, // 93: envoy.config.route.v3.Tracing.random_sampling:type_name -> envoy.type.v3.FractionalPercent - 78, // 94: envoy.config.route.v3.Tracing.overall_sampling:type_name -> envoy.type.v3.FractionalPercent - 80, // 95: envoy.config.route.v3.Tracing.custom_tags:type_name -> envoy.type.tracing.v3.CustomTag + 80, // 90: envoy.config.route.v3.DirectResponseAction.body:type_name -> envoy.config.core.v3.DataSource + 72, // 91: envoy.config.route.v3.Decorator.propagate:type_name -> google.protobuf.BoolValue + 79, // 92: envoy.config.route.v3.Tracing.client_sampling:type_name -> envoy.type.v3.FractionalPercent + 79, // 93: envoy.config.route.v3.Tracing.random_sampling:type_name -> envoy.type.v3.FractionalPercent + 79, // 94: envoy.config.route.v3.Tracing.overall_sampling:type_name -> envoy.type.v3.FractionalPercent + 81, // 95: envoy.config.route.v3.Tracing.custom_tags:type_name -> envoy.type.tracing.v3.CustomTag 24, // 96: envoy.config.route.v3.VirtualCluster.headers:type_name -> envoy.config.route.v3.HeaderMatcher - 67, // 97: envoy.config.route.v3.RateLimit.stage:type_name -> google.protobuf.UInt32Value + 68, // 97: envoy.config.route.v3.RateLimit.stage:type_name -> google.protobuf.UInt32Value 51, // 98: envoy.config.route.v3.RateLimit.actions:type_name -> envoy.config.route.v3.RateLimit.Action 52, // 99: envoy.config.route.v3.RateLimit.limit:type_name -> envoy.config.route.v3.RateLimit.Override - 70, // 100: envoy.config.route.v3.HeaderMatcher.safe_regex_match:type_name -> envoy.type.matcher.v3.RegexMatcher - 81, // 101: envoy.config.route.v3.HeaderMatcher.range_match:type_name -> envoy.type.v3.Int64Range - 74, // 102: envoy.config.route.v3.HeaderMatcher.string_match:type_name -> envoy.type.matcher.v3.StringMatcher - 74, // 103: envoy.config.route.v3.QueryParameterMatcher.string_match:type_name -> envoy.type.matcher.v3.StringMatcher - 67, // 104: envoy.config.route.v3.InternalRedirectPolicy.max_internal_redirects:type_name -> google.protobuf.UInt32Value - 69, // 105: envoy.config.route.v3.InternalRedirectPolicy.predicates:type_name -> envoy.config.core.v3.TypedExtensionConfig - 66, // 106: envoy.config.route.v3.FilterConfig.config:type_name -> google.protobuf.Any - 66, // 107: envoy.config.route.v3.VirtualHost.TypedPerFilterConfigEntry.value:type_name -> google.protobuf.Any - 66, // 108: envoy.config.route.v3.Route.TypedPerFilterConfigEntry.value:type_name -> google.protobuf.Any - 67, // 109: envoy.config.route.v3.WeightedCluster.ClusterWeight.weight:type_name -> google.protobuf.UInt32Value - 68, // 110: envoy.config.route.v3.WeightedCluster.ClusterWeight.metadata_match:type_name -> envoy.config.core.v3.Metadata - 65, // 111: envoy.config.route.v3.WeightedCluster.ClusterWeight.request_headers_to_add:type_name -> envoy.config.core.v3.HeaderValueOption - 65, // 112: envoy.config.route.v3.WeightedCluster.ClusterWeight.response_headers_to_add:type_name -> envoy.config.core.v3.HeaderValueOption - 31, // 113: envoy.config.route.v3.WeightedCluster.ClusterWeight.typed_per_filter_config:type_name -> envoy.config.route.v3.WeightedCluster.ClusterWeight.TypedPerFilterConfigEntry - 66, // 114: envoy.config.route.v3.WeightedCluster.ClusterWeight.TypedPerFilterConfigEntry.value:type_name -> google.protobuf.Any - 71, // 115: envoy.config.route.v3.RouteMatch.TlsContextMatchOptions.presented:type_name -> google.protobuf.BoolValue - 71, // 116: envoy.config.route.v3.RouteMatch.TlsContextMatchOptions.validated:type_name -> google.protobuf.BoolValue - 72, // 117: envoy.config.route.v3.RouteAction.RequestMirrorPolicy.runtime_fraction:type_name -> envoy.config.core.v3.RuntimeFractionalPercent - 71, // 118: envoy.config.route.v3.RouteAction.RequestMirrorPolicy.trace_sampled:type_name -> google.protobuf.BoolValue - 39, // 119: envoy.config.route.v3.RouteAction.HashPolicy.header:type_name -> envoy.config.route.v3.RouteAction.HashPolicy.Header - 41, // 120: envoy.config.route.v3.RouteAction.HashPolicy.cookie:type_name -> envoy.config.route.v3.RouteAction.HashPolicy.Cookie - 42, // 121: envoy.config.route.v3.RouteAction.HashPolicy.connection_properties:type_name -> envoy.config.route.v3.RouteAction.HashPolicy.ConnectionProperties - 43, // 122: envoy.config.route.v3.RouteAction.HashPolicy.query_parameter:type_name -> envoy.config.route.v3.RouteAction.HashPolicy.QueryParameter - 44, // 123: envoy.config.route.v3.RouteAction.HashPolicy.filter_state:type_name -> envoy.config.route.v3.RouteAction.HashPolicy.FilterState - 71, // 124: envoy.config.route.v3.RouteAction.UpgradeConfig.enabled:type_name -> google.protobuf.BoolValue - 45, // 125: envoy.config.route.v3.RouteAction.UpgradeConfig.connect_config:type_name -> envoy.config.route.v3.RouteAction.UpgradeConfig.ConnectConfig - 76, // 126: envoy.config.route.v3.RouteAction.MaxStreamDuration.max_stream_duration:type_name -> google.protobuf.Duration - 76, // 127: envoy.config.route.v3.RouteAction.MaxStreamDuration.grpc_timeout_header_max:type_name -> google.protobuf.Duration - 76, // 128: envoy.config.route.v3.RouteAction.MaxStreamDuration.grpc_timeout_header_offset:type_name -> google.protobuf.Duration - 75, // 129: envoy.config.route.v3.RouteAction.HashPolicy.Header.regex_rewrite:type_name -> envoy.type.matcher.v3.RegexMatchAndSubstitute - 76, // 130: envoy.config.route.v3.RouteAction.HashPolicy.Cookie.ttl:type_name -> google.protobuf.Duration - 40, // 131: envoy.config.route.v3.RouteAction.HashPolicy.Cookie.attributes:type_name -> envoy.config.route.v3.RouteAction.HashPolicy.CookieAttribute - 82, // 132: envoy.config.route.v3.RouteAction.UpgradeConfig.ConnectConfig.proxy_protocol_config:type_name -> envoy.config.core.v3.ProxyProtocolConfig - 66, // 133: envoy.config.route.v3.RetryPolicy.RetryPriority.typed_config:type_name -> google.protobuf.Any - 66, // 134: envoy.config.route.v3.RetryPolicy.RetryHostPredicate.typed_config:type_name -> google.protobuf.Any - 76, // 135: envoy.config.route.v3.RetryPolicy.RetryBackOff.base_interval:type_name -> google.protobuf.Duration - 76, // 136: envoy.config.route.v3.RetryPolicy.RetryBackOff.max_interval:type_name -> google.protobuf.Duration - 3, // 137: envoy.config.route.v3.RetryPolicy.ResetHeader.format:type_name -> envoy.config.route.v3.RetryPolicy.ResetHeaderFormat - 49, // 138: envoy.config.route.v3.RetryPolicy.RateLimitedRetryBackOff.reset_headers:type_name -> envoy.config.route.v3.RetryPolicy.ResetHeader - 76, // 139: envoy.config.route.v3.RetryPolicy.RateLimitedRetryBackOff.max_interval:type_name -> google.protobuf.Duration - 53, // 140: envoy.config.route.v3.RateLimit.Action.source_cluster:type_name -> envoy.config.route.v3.RateLimit.Action.SourceCluster - 54, // 141: envoy.config.route.v3.RateLimit.Action.destination_cluster:type_name -> envoy.config.route.v3.RateLimit.Action.DestinationCluster - 55, // 142: envoy.config.route.v3.RateLimit.Action.request_headers:type_name -> envoy.config.route.v3.RateLimit.Action.RequestHeaders - 56, // 143: envoy.config.route.v3.RateLimit.Action.remote_address:type_name -> envoy.config.route.v3.RateLimit.Action.RemoteAddress - 58, // 144: envoy.config.route.v3.RateLimit.Action.generic_key:type_name -> envoy.config.route.v3.RateLimit.Action.GenericKey - 59, // 145: envoy.config.route.v3.RateLimit.Action.header_value_match:type_name -> envoy.config.route.v3.RateLimit.Action.HeaderValueMatch - 60, // 146: envoy.config.route.v3.RateLimit.Action.dynamic_metadata:type_name -> envoy.config.route.v3.RateLimit.Action.DynamicMetaData - 61, // 147: envoy.config.route.v3.RateLimit.Action.metadata:type_name -> envoy.config.route.v3.RateLimit.Action.MetaData - 69, // 148: envoy.config.route.v3.RateLimit.Action.extension:type_name -> envoy.config.core.v3.TypedExtensionConfig - 57, // 149: envoy.config.route.v3.RateLimit.Action.masked_remote_address:type_name -> envoy.config.route.v3.RateLimit.Action.MaskedRemoteAddress - 62, // 150: envoy.config.route.v3.RateLimit.Action.query_parameter_value_match:type_name -> envoy.config.route.v3.RateLimit.Action.QueryParameterValueMatch - 63, // 151: envoy.config.route.v3.RateLimit.Override.dynamic_metadata:type_name -> envoy.config.route.v3.RateLimit.Override.DynamicMetadata - 67, // 152: envoy.config.route.v3.RateLimit.Action.MaskedRemoteAddress.v4_prefix_mask_len:type_name -> google.protobuf.UInt32Value - 67, // 153: envoy.config.route.v3.RateLimit.Action.MaskedRemoteAddress.v6_prefix_mask_len:type_name -> google.protobuf.UInt32Value - 71, // 154: envoy.config.route.v3.RateLimit.Action.HeaderValueMatch.expect_match:type_name -> google.protobuf.BoolValue - 24, // 155: envoy.config.route.v3.RateLimit.Action.HeaderValueMatch.headers:type_name -> envoy.config.route.v3.HeaderMatcher - 83, // 156: envoy.config.route.v3.RateLimit.Action.DynamicMetaData.metadata_key:type_name -> envoy.type.metadata.v3.MetadataKey - 83, // 157: envoy.config.route.v3.RateLimit.Action.MetaData.metadata_key:type_name -> envoy.type.metadata.v3.MetadataKey - 5, // 158: envoy.config.route.v3.RateLimit.Action.MetaData.source:type_name -> envoy.config.route.v3.RateLimit.Action.MetaData.Source - 71, // 159: envoy.config.route.v3.RateLimit.Action.QueryParameterValueMatch.expect_match:type_name -> google.protobuf.BoolValue - 25, // 160: envoy.config.route.v3.RateLimit.Action.QueryParameterValueMatch.query_parameters:type_name -> envoy.config.route.v3.QueryParameterMatcher - 83, // 161: envoy.config.route.v3.RateLimit.Override.DynamicMetadata.metadata_key:type_name -> envoy.type.metadata.v3.MetadataKey - 162, // [162:162] is the sub-list for method output_type - 162, // [162:162] is the sub-list for method input_type - 162, // [162:162] is the sub-list for extension type_name - 162, // [162:162] is the sub-list for extension extendee - 0, // [0:162] is the sub-list for field type_name + 53, // 100: envoy.config.route.v3.RateLimit.hits_addend:type_name -> envoy.config.route.v3.RateLimit.HitsAddend + 71, // 101: envoy.config.route.v3.HeaderMatcher.safe_regex_match:type_name -> envoy.type.matcher.v3.RegexMatcher + 82, // 102: envoy.config.route.v3.HeaderMatcher.range_match:type_name -> envoy.type.v3.Int64Range + 75, // 103: envoy.config.route.v3.HeaderMatcher.string_match:type_name -> envoy.type.matcher.v3.StringMatcher + 75, // 104: envoy.config.route.v3.QueryParameterMatcher.string_match:type_name -> envoy.type.matcher.v3.StringMatcher + 68, // 105: envoy.config.route.v3.InternalRedirectPolicy.max_internal_redirects:type_name -> google.protobuf.UInt32Value + 70, // 106: envoy.config.route.v3.InternalRedirectPolicy.predicates:type_name -> envoy.config.core.v3.TypedExtensionConfig + 67, // 107: envoy.config.route.v3.FilterConfig.config:type_name -> google.protobuf.Any + 67, // 108: envoy.config.route.v3.VirtualHost.TypedPerFilterConfigEntry.value:type_name -> google.protobuf.Any + 67, // 109: envoy.config.route.v3.Route.TypedPerFilterConfigEntry.value:type_name -> google.protobuf.Any + 68, // 110: envoy.config.route.v3.WeightedCluster.ClusterWeight.weight:type_name -> google.protobuf.UInt32Value + 69, // 111: envoy.config.route.v3.WeightedCluster.ClusterWeight.metadata_match:type_name -> envoy.config.core.v3.Metadata + 66, // 112: envoy.config.route.v3.WeightedCluster.ClusterWeight.request_headers_to_add:type_name -> envoy.config.core.v3.HeaderValueOption + 66, // 113: envoy.config.route.v3.WeightedCluster.ClusterWeight.response_headers_to_add:type_name -> envoy.config.core.v3.HeaderValueOption + 31, // 114: envoy.config.route.v3.WeightedCluster.ClusterWeight.typed_per_filter_config:type_name -> envoy.config.route.v3.WeightedCluster.ClusterWeight.TypedPerFilterConfigEntry + 67, // 115: envoy.config.route.v3.WeightedCluster.ClusterWeight.TypedPerFilterConfigEntry.value:type_name -> google.protobuf.Any + 72, // 116: envoy.config.route.v3.RouteMatch.TlsContextMatchOptions.presented:type_name -> google.protobuf.BoolValue + 72, // 117: envoy.config.route.v3.RouteMatch.TlsContextMatchOptions.validated:type_name -> google.protobuf.BoolValue + 73, // 118: envoy.config.route.v3.RouteAction.RequestMirrorPolicy.runtime_fraction:type_name -> envoy.config.core.v3.RuntimeFractionalPercent + 72, // 119: envoy.config.route.v3.RouteAction.RequestMirrorPolicy.trace_sampled:type_name -> google.protobuf.BoolValue + 39, // 120: envoy.config.route.v3.RouteAction.HashPolicy.header:type_name -> envoy.config.route.v3.RouteAction.HashPolicy.Header + 41, // 121: envoy.config.route.v3.RouteAction.HashPolicy.cookie:type_name -> envoy.config.route.v3.RouteAction.HashPolicy.Cookie + 42, // 122: envoy.config.route.v3.RouteAction.HashPolicy.connection_properties:type_name -> envoy.config.route.v3.RouteAction.HashPolicy.ConnectionProperties + 43, // 123: envoy.config.route.v3.RouteAction.HashPolicy.query_parameter:type_name -> envoy.config.route.v3.RouteAction.HashPolicy.QueryParameter + 44, // 124: envoy.config.route.v3.RouteAction.HashPolicy.filter_state:type_name -> envoy.config.route.v3.RouteAction.HashPolicy.FilterState + 72, // 125: envoy.config.route.v3.RouteAction.UpgradeConfig.enabled:type_name -> google.protobuf.BoolValue + 45, // 126: envoy.config.route.v3.RouteAction.UpgradeConfig.connect_config:type_name -> envoy.config.route.v3.RouteAction.UpgradeConfig.ConnectConfig + 77, // 127: envoy.config.route.v3.RouteAction.MaxStreamDuration.max_stream_duration:type_name -> google.protobuf.Duration + 77, // 128: envoy.config.route.v3.RouteAction.MaxStreamDuration.grpc_timeout_header_max:type_name -> google.protobuf.Duration + 77, // 129: envoy.config.route.v3.RouteAction.MaxStreamDuration.grpc_timeout_header_offset:type_name -> google.protobuf.Duration + 76, // 130: envoy.config.route.v3.RouteAction.HashPolicy.Header.regex_rewrite:type_name -> envoy.type.matcher.v3.RegexMatchAndSubstitute + 77, // 131: envoy.config.route.v3.RouteAction.HashPolicy.Cookie.ttl:type_name -> google.protobuf.Duration + 40, // 132: envoy.config.route.v3.RouteAction.HashPolicy.Cookie.attributes:type_name -> envoy.config.route.v3.RouteAction.HashPolicy.CookieAttribute + 83, // 133: envoy.config.route.v3.RouteAction.UpgradeConfig.ConnectConfig.proxy_protocol_config:type_name -> envoy.config.core.v3.ProxyProtocolConfig + 67, // 134: envoy.config.route.v3.RetryPolicy.RetryPriority.typed_config:type_name -> google.protobuf.Any + 67, // 135: envoy.config.route.v3.RetryPolicy.RetryHostPredicate.typed_config:type_name -> google.protobuf.Any + 77, // 136: envoy.config.route.v3.RetryPolicy.RetryBackOff.base_interval:type_name -> google.protobuf.Duration + 77, // 137: envoy.config.route.v3.RetryPolicy.RetryBackOff.max_interval:type_name -> google.protobuf.Duration + 3, // 138: envoy.config.route.v3.RetryPolicy.ResetHeader.format:type_name -> envoy.config.route.v3.RetryPolicy.ResetHeaderFormat + 49, // 139: envoy.config.route.v3.RetryPolicy.RateLimitedRetryBackOff.reset_headers:type_name -> envoy.config.route.v3.RetryPolicy.ResetHeader + 77, // 140: envoy.config.route.v3.RetryPolicy.RateLimitedRetryBackOff.max_interval:type_name -> google.protobuf.Duration + 54, // 141: envoy.config.route.v3.RateLimit.Action.source_cluster:type_name -> envoy.config.route.v3.RateLimit.Action.SourceCluster + 55, // 142: envoy.config.route.v3.RateLimit.Action.destination_cluster:type_name -> envoy.config.route.v3.RateLimit.Action.DestinationCluster + 56, // 143: envoy.config.route.v3.RateLimit.Action.request_headers:type_name -> envoy.config.route.v3.RateLimit.Action.RequestHeaders + 57, // 144: envoy.config.route.v3.RateLimit.Action.remote_address:type_name -> envoy.config.route.v3.RateLimit.Action.RemoteAddress + 59, // 145: envoy.config.route.v3.RateLimit.Action.generic_key:type_name -> envoy.config.route.v3.RateLimit.Action.GenericKey + 60, // 146: envoy.config.route.v3.RateLimit.Action.header_value_match:type_name -> envoy.config.route.v3.RateLimit.Action.HeaderValueMatch + 61, // 147: envoy.config.route.v3.RateLimit.Action.dynamic_metadata:type_name -> envoy.config.route.v3.RateLimit.Action.DynamicMetaData + 62, // 148: envoy.config.route.v3.RateLimit.Action.metadata:type_name -> envoy.config.route.v3.RateLimit.Action.MetaData + 70, // 149: envoy.config.route.v3.RateLimit.Action.extension:type_name -> envoy.config.core.v3.TypedExtensionConfig + 58, // 150: envoy.config.route.v3.RateLimit.Action.masked_remote_address:type_name -> envoy.config.route.v3.RateLimit.Action.MaskedRemoteAddress + 63, // 151: envoy.config.route.v3.RateLimit.Action.query_parameter_value_match:type_name -> envoy.config.route.v3.RateLimit.Action.QueryParameterValueMatch + 64, // 152: envoy.config.route.v3.RateLimit.Override.dynamic_metadata:type_name -> envoy.config.route.v3.RateLimit.Override.DynamicMetadata + 84, // 153: envoy.config.route.v3.RateLimit.HitsAddend.number:type_name -> google.protobuf.UInt64Value + 68, // 154: envoy.config.route.v3.RateLimit.Action.MaskedRemoteAddress.v4_prefix_mask_len:type_name -> google.protobuf.UInt32Value + 68, // 155: envoy.config.route.v3.RateLimit.Action.MaskedRemoteAddress.v6_prefix_mask_len:type_name -> google.protobuf.UInt32Value + 72, // 156: envoy.config.route.v3.RateLimit.Action.HeaderValueMatch.expect_match:type_name -> google.protobuf.BoolValue + 24, // 157: envoy.config.route.v3.RateLimit.Action.HeaderValueMatch.headers:type_name -> envoy.config.route.v3.HeaderMatcher + 85, // 158: envoy.config.route.v3.RateLimit.Action.DynamicMetaData.metadata_key:type_name -> envoy.type.metadata.v3.MetadataKey + 85, // 159: envoy.config.route.v3.RateLimit.Action.MetaData.metadata_key:type_name -> envoy.type.metadata.v3.MetadataKey + 5, // 160: envoy.config.route.v3.RateLimit.Action.MetaData.source:type_name -> envoy.config.route.v3.RateLimit.Action.MetaData.Source + 72, // 161: envoy.config.route.v3.RateLimit.Action.QueryParameterValueMatch.expect_match:type_name -> google.protobuf.BoolValue + 25, // 162: envoy.config.route.v3.RateLimit.Action.QueryParameterValueMatch.query_parameters:type_name -> envoy.config.route.v3.QueryParameterMatcher + 85, // 163: envoy.config.route.v3.RateLimit.Override.DynamicMetadata.metadata_key:type_name -> envoy.type.metadata.v3.MetadataKey + 164, // [164:164] is the sub-list for method output_type + 164, // [164:164] is the sub-list for method input_type + 164, // [164:164] is the sub-list for extension type_name + 164, // [164:164] is the sub-list for extension extendee + 0, // [0:164] is the sub-list for field type_name } func init() { file_envoy_config_route_v3_route_components_proto_init() } @@ -8837,7 +8991,7 @@ func file_envoy_config_route_v3_route_components_proto_init() { } } file_envoy_config_route_v3_route_components_proto_msgTypes[47].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*RateLimit_Action_SourceCluster); i { + switch v := v.(*RateLimit_HitsAddend); i { case 0: return &v.state case 1: @@ -8849,7 +9003,7 @@ func file_envoy_config_route_v3_route_components_proto_init() { } } file_envoy_config_route_v3_route_components_proto_msgTypes[48].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*RateLimit_Action_DestinationCluster); i { + switch v := v.(*RateLimit_Action_SourceCluster); i { case 0: return &v.state case 1: @@ -8861,7 +9015,7 @@ func file_envoy_config_route_v3_route_components_proto_init() { } } file_envoy_config_route_v3_route_components_proto_msgTypes[49].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*RateLimit_Action_RequestHeaders); i { + switch v := v.(*RateLimit_Action_DestinationCluster); i { case 0: return &v.state case 1: @@ -8873,7 +9027,7 @@ func file_envoy_config_route_v3_route_components_proto_init() { } } file_envoy_config_route_v3_route_components_proto_msgTypes[50].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*RateLimit_Action_RemoteAddress); i { + switch v := v.(*RateLimit_Action_RequestHeaders); i { case 0: return &v.state case 1: @@ -8885,7 +9039,7 @@ func file_envoy_config_route_v3_route_components_proto_init() { } } file_envoy_config_route_v3_route_components_proto_msgTypes[51].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*RateLimit_Action_MaskedRemoteAddress); i { + switch v := v.(*RateLimit_Action_RemoteAddress); i { case 0: return &v.state case 1: @@ -8897,7 +9051,7 @@ func file_envoy_config_route_v3_route_components_proto_init() { } } file_envoy_config_route_v3_route_components_proto_msgTypes[52].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*RateLimit_Action_GenericKey); i { + switch v := v.(*RateLimit_Action_MaskedRemoteAddress); i { case 0: return &v.state case 1: @@ -8909,7 +9063,7 @@ func file_envoy_config_route_v3_route_components_proto_init() { } } file_envoy_config_route_v3_route_components_proto_msgTypes[53].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*RateLimit_Action_HeaderValueMatch); i { + switch v := v.(*RateLimit_Action_GenericKey); i { case 0: return &v.state case 1: @@ -8921,7 +9075,7 @@ func file_envoy_config_route_v3_route_components_proto_init() { } } file_envoy_config_route_v3_route_components_proto_msgTypes[54].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*RateLimit_Action_DynamicMetaData); i { + switch v := v.(*RateLimit_Action_HeaderValueMatch); i { case 0: return &v.state case 1: @@ -8933,7 +9087,7 @@ func file_envoy_config_route_v3_route_components_proto_init() { } } file_envoy_config_route_v3_route_components_proto_msgTypes[55].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*RateLimit_Action_MetaData); i { + switch v := v.(*RateLimit_Action_DynamicMetaData); i { case 0: return &v.state case 1: @@ -8945,7 +9099,7 @@ func file_envoy_config_route_v3_route_components_proto_init() { } } file_envoy_config_route_v3_route_components_proto_msgTypes[56].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*RateLimit_Action_QueryParameterValueMatch); i { + switch v := v.(*RateLimit_Action_MetaData); i { case 0: return &v.state case 1: @@ -8957,6 +9111,18 @@ func file_envoy_config_route_v3_route_components_proto_init() { } } file_envoy_config_route_v3_route_components_proto_msgTypes[57].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*RateLimit_Action_QueryParameterValueMatch); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_envoy_config_route_v3_route_components_proto_msgTypes[58].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*RateLimit_Override_DynamicMetadata); i { case 0: return &v.state @@ -9060,7 +9226,7 @@ func file_envoy_config_route_v3_route_components_proto_init() { GoPackagePath: reflect.TypeOf(x{}).PkgPath(), RawDescriptor: file_envoy_config_route_v3_route_components_proto_rawDesc, NumEnums: 6, - NumMessages: 58, + NumMessages: 59, NumExtensions: 0, NumServices: 0, }, diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/route/v3/route_components.pb.validate.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/route/v3/route_components.pb.validate.go index ffa6daf7b8c25..0f2a6c28f8258 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/route/v3/route_components.pb.validate.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/route/v3/route_components.pb.validate.go @@ -5561,6 +5561,37 @@ func (m *RateLimit) validate(all bool) error { } } + if all { + switch v := interface{}(m.GetHitsAddend()).(type) { + case interface{ ValidateAll() error }: + if err := v.ValidateAll(); err != nil { + errors = append(errors, RateLimitValidationError{ + field: "HitsAddend", + reason: "embedded message failed validation", + cause: err, + }) + } + case interface{ Validate() error }: + if err := v.Validate(); err != nil { + errors = append(errors, RateLimitValidationError{ + field: "HitsAddend", + reason: "embedded message failed validation", + cause: err, + }) + } + } + } else if v, ok := interface{}(m.GetHitsAddend()).(interface{ Validate() error }); ok { + if err := v.Validate(); err != nil { + return RateLimitValidationError{ + field: "HitsAddend", + reason: "embedded message failed validation", + cause: err, + } + } + } + + // no validation rules for ApplyOnStreamDone + if len(errors) > 0 { return RateLimitMultiError(errors) } @@ -10677,6 +10708,149 @@ var _ interface { ErrorName() string } = RateLimit_OverrideValidationError{} +// Validate checks the field values on RateLimit_HitsAddend with the rules +// defined in the proto definition for this message. If any rules are +// violated, the first error encountered is returned, or nil if there are no violations. +func (m *RateLimit_HitsAddend) Validate() error { + return m.validate(false) +} + +// ValidateAll checks the field values on RateLimit_HitsAddend with the rules +// defined in the proto definition for this message. If any rules are +// violated, the result is a list of violation errors wrapped in +// RateLimit_HitsAddendMultiError, or nil if none found. +func (m *RateLimit_HitsAddend) ValidateAll() error { + return m.validate(true) +} + +func (m *RateLimit_HitsAddend) validate(all bool) error { + if m == nil { + return nil + } + + var errors []error + + if wrapper := m.GetNumber(); wrapper != nil { + + if wrapper.GetValue() > 1000000000 { + err := RateLimit_HitsAddendValidationError{ + field: "Number", + reason: "value must be less than or equal to 1000000000", + } + if !all { + return err + } + errors = append(errors, err) + } + + } + + if m.GetFormat() != "" { + + if !strings.HasPrefix(m.GetFormat(), "%") { + err := RateLimit_HitsAddendValidationError{ + field: "Format", + reason: "value does not have prefix \"%\"", + } + if !all { + return err + } + errors = append(errors, err) + } + + if !strings.HasSuffix(m.GetFormat(), "%") { + err := RateLimit_HitsAddendValidationError{ + field: "Format", + reason: "value does not have suffix \"%\"", + } + if !all { + return err + } + errors = append(errors, err) + } + + } + + if len(errors) > 0 { + return RateLimit_HitsAddendMultiError(errors) + } + + return nil +} + +// RateLimit_HitsAddendMultiError is an error wrapping multiple validation +// errors returned by RateLimit_HitsAddend.ValidateAll() if the designated +// constraints aren't met. +type RateLimit_HitsAddendMultiError []error + +// Error returns a concatenation of all the error messages it wraps. +func (m RateLimit_HitsAddendMultiError) Error() string { + var msgs []string + for _, err := range m { + msgs = append(msgs, err.Error()) + } + return strings.Join(msgs, "; ") +} + +// AllErrors returns a list of validation violation errors. +func (m RateLimit_HitsAddendMultiError) AllErrors() []error { return m } + +// RateLimit_HitsAddendValidationError is the validation error returned by +// RateLimit_HitsAddend.Validate if the designated constraints aren't met. +type RateLimit_HitsAddendValidationError struct { + field string + reason string + cause error + key bool +} + +// Field function returns field value. +func (e RateLimit_HitsAddendValidationError) Field() string { return e.field } + +// Reason function returns reason value. +func (e RateLimit_HitsAddendValidationError) Reason() string { return e.reason } + +// Cause function returns cause value. +func (e RateLimit_HitsAddendValidationError) Cause() error { return e.cause } + +// Key function returns key value. +func (e RateLimit_HitsAddendValidationError) Key() bool { return e.key } + +// ErrorName returns error name. +func (e RateLimit_HitsAddendValidationError) ErrorName() string { + return "RateLimit_HitsAddendValidationError" +} + +// Error satisfies the builtin error interface +func (e RateLimit_HitsAddendValidationError) Error() string { + cause := "" + if e.cause != nil { + cause = fmt.Sprintf(" | caused by: %v", e.cause) + } + + key := "" + if e.key { + key = "key for " + } + + return fmt.Sprintf( + "invalid %sRateLimit_HitsAddend.%s: %s%s", + key, + e.field, + e.reason, + cause) +} + +var _ error = RateLimit_HitsAddendValidationError{} + +var _ interface { + Field() string + Reason() string + Key() bool + Cause() error + ErrorName() string +} = RateLimit_HitsAddendValidationError{} + // Validate checks the field values on RateLimit_Action_SourceCluster with the // rules defined in the proto definition for this message. If any rules are // violated, the first error encountered is returned, or nil if there are no violations. diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/route/v3/route_components_vtproto.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/route/v3/route_components_vtproto.pb.go index 79709bb972015..2d9add642c549 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/route/v3/route_components_vtproto.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/route/v3/route_components_vtproto.pb.go @@ -5220,6 +5220,56 @@ func (m *RateLimit_Override_DynamicMetadata_) MarshalToSizedBufferVTStrict(dAtA } return len(dAtA) - i, nil } +func (m *RateLimit_HitsAddend) MarshalVTStrict() (dAtA []byte, err error) { + if m == nil { + return nil, nil + } + size := m.SizeVT() + dAtA = make([]byte, size) + n, err := m.MarshalToSizedBufferVTStrict(dAtA[:size]) + if err != nil { + return nil, err + } + return dAtA[:n], nil +} + +func (m *RateLimit_HitsAddend) MarshalToVTStrict(dAtA []byte) (int, error) { + size := m.SizeVT() + return m.MarshalToSizedBufferVTStrict(dAtA[:size]) +} + +func (m *RateLimit_HitsAddend) MarshalToSizedBufferVTStrict(dAtA []byte) (int, error) { + if m == nil { + return 0, nil + } + i := len(dAtA) + _ = i + var l int + _ = l + if m.unknownFields != nil { + i -= len(m.unknownFields) + copy(dAtA[i:], m.unknownFields) + } + if len(m.Format) > 0 { + i -= len(m.Format) + copy(dAtA[i:], m.Format) + i = protohelpers.EncodeVarint(dAtA, i, uint64(len(m.Format))) + i-- + dAtA[i] = 0x12 + } + if m.Number != nil { + size, err := (*wrapperspb.UInt64Value)(m.Number).MarshalToSizedBufferVTStrict(dAtA[:i]) + if err != nil { + return 0, err + } + i -= size + i = protohelpers.EncodeVarint(dAtA, i, uint64(size)) + i-- + dAtA[i] = 0xa + } + return len(dAtA) - i, nil +} + func (m *RateLimit) MarshalVTStrict() (dAtA []byte, err error) { if m == nil { return nil, nil @@ -5250,6 +5300,26 @@ func (m *RateLimit) MarshalToSizedBufferVTStrict(dAtA []byte) (int, error) { i -= len(m.unknownFields) copy(dAtA[i:], m.unknownFields) } + if m.ApplyOnStreamDone { + i-- + if m.ApplyOnStreamDone { + dAtA[i] = 1 + } else { + dAtA[i] = 0 + } + i-- + dAtA[i] = 0x30 + } + if m.HitsAddend != nil { + size, err := m.HitsAddend.MarshalToSizedBufferVTStrict(dAtA[:i]) + if err != nil { + return 0, err + } + i -= size + i = protohelpers.EncodeVarint(dAtA, i, uint64(size)) + i-- + dAtA[i] = 0x2a + } if m.Limit != nil { size, err := m.Limit.MarshalToSizedBufferVTStrict(dAtA[:i]) if err != nil { @@ -8033,6 +8103,24 @@ func (m *RateLimit_Override_DynamicMetadata_) SizeVT() (n int) { } return n } +func (m *RateLimit_HitsAddend) SizeVT() (n int) { + if m == nil { + return 0 + } + var l int + _ = l + if m.Number != nil { + l = (*wrapperspb.UInt64Value)(m.Number).SizeVT() + n += 1 + l + protohelpers.SizeOfVarint(uint64(l)) + } + l = len(m.Format) + if l > 0 { + n += 1 + l + protohelpers.SizeOfVarint(uint64(l)) + } + n += len(m.unknownFields) + return n +} + func (m *RateLimit) SizeVT() (n int) { if m == nil { return 0 @@ -8057,6 +8145,13 @@ func (m *RateLimit) SizeVT() (n int) { l = m.Limit.SizeVT() n += 1 + l + protohelpers.SizeOfVarint(uint64(l)) } + if m.HitsAddend != nil { + l = m.HitsAddend.SizeVT() + n += 1 + l + protohelpers.SizeOfVarint(uint64(l)) + } + if m.ApplyOnStreamDone { + n += 2 + } n += len(m.unknownFields) return n } diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/route/v3/scoped_route.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/route/v3/scoped_route.pb.go index 1c02988b6919f..04af07efeb6db 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/route/v3/scoped_route.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/route/v3/scoped_route.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/route/v3/scoped_route.proto package routev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/tap/v3/common.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/tap/v3/common.pb.go index 284516c99e17f..d15b44177187f 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/tap/v3/common.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/tap/v3/common.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/tap/v3/common.proto package tapv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/datadog.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/datadog.pb.go index 1975c6f020d03..a988bc600d724 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/datadog.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/datadog.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/trace/v3/datadog.proto package tracev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/dynamic_ot.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/dynamic_ot.pb.go index a3dd5bb95981c..860f58a50dc52 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/dynamic_ot.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/dynamic_ot.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/trace/v3/dynamic_ot.proto package tracev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/http_tracer.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/http_tracer.pb.go index 98a8a86f15fc4..0b6476a4e6cb7 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/http_tracer.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/http_tracer.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/trace/v3/http_tracer.proto package tracev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/lightstep.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/lightstep.pb.go index e7eeb33ef677e..ad9d76669721d 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/lightstep.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/lightstep.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/trace/v3/lightstep.proto package tracev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/opencensus.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/opencensus.pb.go deleted file mode 100644 index b7e7c69f61528..0000000000000 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/opencensus.pb.go +++ /dev/null @@ -1,489 +0,0 @@ -// Code generated by protoc-gen-go. DO NOT EDIT. -// versions: -// protoc-gen-go v1.30.0 -// protoc v5.26.1 -// source: envoy/config/trace/v3/opencensus.proto - -package tracev3 - -import ( - v1 "github.com/census-instrumentation/opencensus-proto/gen-go/trace/v1" - _ "github.com/cncf/xds/go/udpa/annotations" - _ "github.com/envoyproxy/go-control-plane/envoy/annotations" - v3 "github.com/envoyproxy/go-control-plane/envoy/config/core/v3" - protoreflect "google.golang.org/protobuf/reflect/protoreflect" - protoimpl "google.golang.org/protobuf/runtime/protoimpl" - reflect "reflect" - sync "sync" -) - -const ( - // Verify that this generated code is sufficiently up-to-date. - _ = protoimpl.EnforceVersion(20 - protoimpl.MinVersion) - // Verify that runtime/protoimpl is sufficiently up-to-date. - _ = protoimpl.EnforceVersion(protoimpl.MaxVersion - 20) -) - -type OpenCensusConfig_TraceContext int32 - -const ( - // No-op default, no trace context is utilized. - OpenCensusConfig_NONE OpenCensusConfig_TraceContext = 0 - // W3C Trace-Context format "traceparent:" header. - OpenCensusConfig_TRACE_CONTEXT OpenCensusConfig_TraceContext = 1 - // Binary "grpc-trace-bin:" header. - OpenCensusConfig_GRPC_TRACE_BIN OpenCensusConfig_TraceContext = 2 - // "X-Cloud-Trace-Context:" header. - OpenCensusConfig_CLOUD_TRACE_CONTEXT OpenCensusConfig_TraceContext = 3 - // X-B3-* headers. - OpenCensusConfig_B3 OpenCensusConfig_TraceContext = 4 -) - -// Enum value maps for OpenCensusConfig_TraceContext. -var ( - OpenCensusConfig_TraceContext_name = map[int32]string{ - 0: "NONE", - 1: "TRACE_CONTEXT", - 2: "GRPC_TRACE_BIN", - 3: "CLOUD_TRACE_CONTEXT", - 4: "B3", - } - OpenCensusConfig_TraceContext_value = map[string]int32{ - "NONE": 0, - "TRACE_CONTEXT": 1, - "GRPC_TRACE_BIN": 2, - "CLOUD_TRACE_CONTEXT": 3, - "B3": 4, - } -) - -func (x OpenCensusConfig_TraceContext) Enum() *OpenCensusConfig_TraceContext { - p := new(OpenCensusConfig_TraceContext) - *p = x - return p -} - -func (x OpenCensusConfig_TraceContext) String() string { - return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) -} - -func (OpenCensusConfig_TraceContext) Descriptor() protoreflect.EnumDescriptor { - return file_envoy_config_trace_v3_opencensus_proto_enumTypes[0].Descriptor() -} - -func (OpenCensusConfig_TraceContext) Type() protoreflect.EnumType { - return &file_envoy_config_trace_v3_opencensus_proto_enumTypes[0] -} - -func (x OpenCensusConfig_TraceContext) Number() protoreflect.EnumNumber { - return protoreflect.EnumNumber(x) -} - -// Deprecated: Use OpenCensusConfig_TraceContext.Descriptor instead. -func (OpenCensusConfig_TraceContext) EnumDescriptor() ([]byte, []int) { - return file_envoy_config_trace_v3_opencensus_proto_rawDescGZIP(), []int{0, 0} -} - -// Configuration for the OpenCensus tracer. -// [#next-free-field: 15] -// [#extension: envoy.tracers.opencensus] -type OpenCensusConfig struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - // Configures tracing, e.g. the sampler, max number of annotations, etc. - // - // Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. - TraceConfig *v1.TraceConfig `protobuf:"bytes,1,opt,name=trace_config,json=traceConfig,proto3" json:"trace_config,omitempty"` - // Enables the stdout exporter if set to true. This is intended for debugging - // purposes. - // - // Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. - StdoutExporterEnabled bool `protobuf:"varint,2,opt,name=stdout_exporter_enabled,json=stdoutExporterEnabled,proto3" json:"stdout_exporter_enabled,omitempty"` - // Enables the Stackdriver exporter if set to true. The project_id must also - // be set. - // - // Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. - StackdriverExporterEnabled bool `protobuf:"varint,3,opt,name=stackdriver_exporter_enabled,json=stackdriverExporterEnabled,proto3" json:"stackdriver_exporter_enabled,omitempty"` - // The Cloud project_id to use for Stackdriver tracing. - // - // Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. - StackdriverProjectId string `protobuf:"bytes,4,opt,name=stackdriver_project_id,json=stackdriverProjectId,proto3" json:"stackdriver_project_id,omitempty"` - // (optional) By default, the Stackdriver exporter will connect to production - // Stackdriver. If stackdriver_address is non-empty, it will instead connect - // to this address, which is in the gRPC format: - // https://github.com/grpc/grpc/blob/master/doc/naming.md - // - // Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. - StackdriverAddress string `protobuf:"bytes,10,opt,name=stackdriver_address,json=stackdriverAddress,proto3" json:"stackdriver_address,omitempty"` - // (optional) The gRPC server that hosts Stackdriver tracing service. Only - // Google gRPC is supported. If :ref:`target_uri ` - // is not provided, the default production Stackdriver address will be used. - // - // Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. - StackdriverGrpcService *v3.GrpcService `protobuf:"bytes,13,opt,name=stackdriver_grpc_service,json=stackdriverGrpcService,proto3" json:"stackdriver_grpc_service,omitempty"` - // Enables the Zipkin exporter if set to true. The url and service name must - // also be set. This is deprecated, prefer to use Envoy's :ref:`native Zipkin - // tracer `. - // - // Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. - ZipkinExporterEnabled bool `protobuf:"varint,5,opt,name=zipkin_exporter_enabled,json=zipkinExporterEnabled,proto3" json:"zipkin_exporter_enabled,omitempty"` - // The URL to Zipkin, e.g. "http://127.0.0.1:9411/api/v2/spans". This is - // deprecated, prefer to use Envoy's :ref:`native Zipkin tracer - // `. - // - // Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. - ZipkinUrl string `protobuf:"bytes,6,opt,name=zipkin_url,json=zipkinUrl,proto3" json:"zipkin_url,omitempty"` - // Enables the OpenCensus Agent exporter if set to true. The ocagent_address or - // ocagent_grpc_service must also be set. - // - // Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. - OcagentExporterEnabled bool `protobuf:"varint,11,opt,name=ocagent_exporter_enabled,json=ocagentExporterEnabled,proto3" json:"ocagent_exporter_enabled,omitempty"` - // The address of the OpenCensus Agent, if its exporter is enabled, in gRPC - // format: https://github.com/grpc/grpc/blob/master/doc/naming.md - // [#comment:TODO: deprecate this field] - // - // Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. - OcagentAddress string `protobuf:"bytes,12,opt,name=ocagent_address,json=ocagentAddress,proto3" json:"ocagent_address,omitempty"` - // (optional) The gRPC server hosted by the OpenCensus Agent. Only Google gRPC is supported. - // This is only used if the ocagent_address is left empty. - // - // Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. - OcagentGrpcService *v3.GrpcService `protobuf:"bytes,14,opt,name=ocagent_grpc_service,json=ocagentGrpcService,proto3" json:"ocagent_grpc_service,omitempty"` - // List of incoming trace context headers we will accept. First one found - // wins. - // - // Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. - IncomingTraceContext []OpenCensusConfig_TraceContext `protobuf:"varint,8,rep,packed,name=incoming_trace_context,json=incomingTraceContext,proto3,enum=envoy.config.trace.v3.OpenCensusConfig_TraceContext" json:"incoming_trace_context,omitempty"` - // List of outgoing trace context headers we will produce. - // - // Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. - OutgoingTraceContext []OpenCensusConfig_TraceContext `protobuf:"varint,9,rep,packed,name=outgoing_trace_context,json=outgoingTraceContext,proto3,enum=envoy.config.trace.v3.OpenCensusConfig_TraceContext" json:"outgoing_trace_context,omitempty"` -} - -func (x *OpenCensusConfig) Reset() { - *x = OpenCensusConfig{} - if protoimpl.UnsafeEnabled { - mi := &file_envoy_config_trace_v3_opencensus_proto_msgTypes[0] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *OpenCensusConfig) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*OpenCensusConfig) ProtoMessage() {} - -func (x *OpenCensusConfig) ProtoReflect() protoreflect.Message { - mi := &file_envoy_config_trace_v3_opencensus_proto_msgTypes[0] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use OpenCensusConfig.ProtoReflect.Descriptor instead. -func (*OpenCensusConfig) Descriptor() ([]byte, []int) { - return file_envoy_config_trace_v3_opencensus_proto_rawDescGZIP(), []int{0} -} - -// Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. -func (x *OpenCensusConfig) GetTraceConfig() *v1.TraceConfig { - if x != nil { - return x.TraceConfig - } - return nil -} - -// Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. -func (x *OpenCensusConfig) GetStdoutExporterEnabled() bool { - if x != nil { - return x.StdoutExporterEnabled - } - return false -} - -// Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. -func (x *OpenCensusConfig) GetStackdriverExporterEnabled() bool { - if x != nil { - return x.StackdriverExporterEnabled - } - return false -} - -// Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. -func (x *OpenCensusConfig) GetStackdriverProjectId() string { - if x != nil { - return x.StackdriverProjectId - } - return "" -} - -// Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. -func (x *OpenCensusConfig) GetStackdriverAddress() string { - if x != nil { - return x.StackdriverAddress - } - return "" -} - -// Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. -func (x *OpenCensusConfig) GetStackdriverGrpcService() *v3.GrpcService { - if x != nil { - return x.StackdriverGrpcService - } - return nil -} - -// Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. -func (x *OpenCensusConfig) GetZipkinExporterEnabled() bool { - if x != nil { - return x.ZipkinExporterEnabled - } - return false -} - -// Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. -func (x *OpenCensusConfig) GetZipkinUrl() string { - if x != nil { - return x.ZipkinUrl - } - return "" -} - -// Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. -func (x *OpenCensusConfig) GetOcagentExporterEnabled() bool { - if x != nil { - return x.OcagentExporterEnabled - } - return false -} - -// Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. -func (x *OpenCensusConfig) GetOcagentAddress() string { - if x != nil { - return x.OcagentAddress - } - return "" -} - -// Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. -func (x *OpenCensusConfig) GetOcagentGrpcService() *v3.GrpcService { - if x != nil { - return x.OcagentGrpcService - } - return nil -} - -// Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. -func (x *OpenCensusConfig) GetIncomingTraceContext() []OpenCensusConfig_TraceContext { - if x != nil { - return x.IncomingTraceContext - } - return nil -} - -// Deprecated: Marked as deprecated in envoy/config/trace/v3/opencensus.proto. -func (x *OpenCensusConfig) GetOutgoingTraceContext() []OpenCensusConfig_TraceContext { - if x != nil { - return x.OutgoingTraceContext - } - return nil -} - -var File_envoy_config_trace_v3_opencensus_proto protoreflect.FileDescriptor - -var file_envoy_config_trace_v3_opencensus_proto_rawDesc = []byte{ - 0x0a, 0x26, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2f, 0x74, - 0x72, 0x61, 0x63, 0x65, 0x2f, 0x76, 0x33, 0x2f, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, - 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x15, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, - 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x33, 0x1a, - 0x27, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2f, 0x63, 0x6f, - 0x72, 0x65, 0x2f, 0x76, 0x33, 0x2f, 0x67, 0x72, 0x70, 0x63, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, - 0x63, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x2c, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, - 0x6e, 0x73, 0x75, 0x73, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x74, 0x72, 0x61, 0x63, 0x65, - 0x2f, 0x76, 0x31, 0x2f, 0x74, 0x72, 0x61, 0x63, 0x65, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x23, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x61, 0x6e, - 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x1e, 0x75, 0x64, 0x70, - 0x61, 0x2f, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x6d, 0x69, - 0x67, 0x72, 0x61, 0x74, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x1d, 0x75, 0x64, 0x70, - 0x61, 0x2f, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x73, 0x74, - 0x61, 0x74, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x21, 0x75, 0x64, 0x70, 0x61, - 0x2f, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x76, 0x65, 0x72, - 0x73, 0x69, 0x6f, 0x6e, 0x69, 0x6e, 0x67, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0x90, 0x0a, - 0x0a, 0x10, 0x4f, 0x70, 0x65, 0x6e, 0x43, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x43, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x12, 0x5c, 0x0a, 0x0c, 0x74, 0x72, 0x61, 0x63, 0x65, 0x5f, 0x63, 0x6f, 0x6e, 0x66, - 0x69, 0x67, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x26, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, - 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x74, 0x72, 0x61, 0x63, - 0x65, 0x2e, 0x76, 0x31, 0x2e, 0x54, 0x72, 0x61, 0x63, 0x65, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x42, 0x11, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0xb8, 0xee, 0xf2, 0xd2, 0x05, - 0x01, 0x18, 0x01, 0x52, 0x0b, 0x74, 0x72, 0x61, 0x63, 0x65, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x12, 0x49, 0x0a, 0x17, 0x73, 0x74, 0x64, 0x6f, 0x75, 0x74, 0x5f, 0x65, 0x78, 0x70, 0x6f, 0x72, - 0x74, 0x65, 0x72, 0x5f, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x08, 0x42, 0x11, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0xb8, 0xee, 0xf2, 0xd2, - 0x05, 0x01, 0x18, 0x01, 0x52, 0x15, 0x73, 0x74, 0x64, 0x6f, 0x75, 0x74, 0x45, 0x78, 0x70, 0x6f, - 0x72, 0x74, 0x65, 0x72, 0x45, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x12, 0x53, 0x0a, 0x1c, 0x73, - 0x74, 0x61, 0x63, 0x6b, 0x64, 0x72, 0x69, 0x76, 0x65, 0x72, 0x5f, 0x65, 0x78, 0x70, 0x6f, 0x72, - 0x74, 0x65, 0x72, 0x5f, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, - 0x08, 0x42, 0x11, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0xb8, 0xee, 0xf2, 0xd2, - 0x05, 0x01, 0x18, 0x01, 0x52, 0x1a, 0x73, 0x74, 0x61, 0x63, 0x6b, 0x64, 0x72, 0x69, 0x76, 0x65, - 0x72, 0x45, 0x78, 0x70, 0x6f, 0x72, 0x74, 0x65, 0x72, 0x45, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, - 0x12, 0x47, 0x0a, 0x16, 0x73, 0x74, 0x61, 0x63, 0x6b, 0x64, 0x72, 0x69, 0x76, 0x65, 0x72, 0x5f, - 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x5f, 0x69, 0x64, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, - 0x42, 0x11, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0xb8, 0xee, 0xf2, 0xd2, 0x05, - 0x01, 0x18, 0x01, 0x52, 0x14, 0x73, 0x74, 0x61, 0x63, 0x6b, 0x64, 0x72, 0x69, 0x76, 0x65, 0x72, - 0x50, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x49, 0x64, 0x12, 0x42, 0x0a, 0x13, 0x73, 0x74, 0x61, - 0x63, 0x6b, 0x64, 0x72, 0x69, 0x76, 0x65, 0x72, 0x5f, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, - 0x18, 0x0a, 0x20, 0x01, 0x28, 0x09, 0x42, 0x11, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, - 0x30, 0xb8, 0xee, 0xf2, 0xd2, 0x05, 0x01, 0x18, 0x01, 0x52, 0x12, 0x73, 0x74, 0x61, 0x63, 0x6b, - 0x64, 0x72, 0x69, 0x76, 0x65, 0x72, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x12, 0x6e, 0x0a, - 0x18, 0x73, 0x74, 0x61, 0x63, 0x6b, 0x64, 0x72, 0x69, 0x76, 0x65, 0x72, 0x5f, 0x67, 0x72, 0x70, - 0x63, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x18, 0x0d, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x21, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, - 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x47, 0x72, 0x70, 0x63, 0x53, 0x65, 0x72, 0x76, 0x69, - 0x63, 0x65, 0x42, 0x11, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0xb8, 0xee, 0xf2, - 0xd2, 0x05, 0x01, 0x18, 0x01, 0x52, 0x16, 0x73, 0x74, 0x61, 0x63, 0x6b, 0x64, 0x72, 0x69, 0x76, - 0x65, 0x72, 0x47, 0x72, 0x70, 0x63, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x12, 0x49, 0x0a, - 0x17, 0x7a, 0x69, 0x70, 0x6b, 0x69, 0x6e, 0x5f, 0x65, 0x78, 0x70, 0x6f, 0x72, 0x74, 0x65, 0x72, - 0x5f, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x42, 0x11, - 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0xb8, 0xee, 0xf2, 0xd2, 0x05, 0x01, 0x18, - 0x01, 0x52, 0x15, 0x7a, 0x69, 0x70, 0x6b, 0x69, 0x6e, 0x45, 0x78, 0x70, 0x6f, 0x72, 0x74, 0x65, - 0x72, 0x45, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x12, 0x30, 0x0a, 0x0a, 0x7a, 0x69, 0x70, 0x6b, - 0x69, 0x6e, 0x5f, 0x75, 0x72, 0x6c, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x42, 0x11, 0x92, 0xc7, - 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0xb8, 0xee, 0xf2, 0xd2, 0x05, 0x01, 0x18, 0x01, 0x52, - 0x09, 0x7a, 0x69, 0x70, 0x6b, 0x69, 0x6e, 0x55, 0x72, 0x6c, 0x12, 0x4b, 0x0a, 0x18, 0x6f, 0x63, - 0x61, 0x67, 0x65, 0x6e, 0x74, 0x5f, 0x65, 0x78, 0x70, 0x6f, 0x72, 0x74, 0x65, 0x72, 0x5f, 0x65, - 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x08, 0x42, 0x11, 0x92, 0xc7, - 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0xb8, 0xee, 0xf2, 0xd2, 0x05, 0x01, 0x18, 0x01, 0x52, - 0x16, 0x6f, 0x63, 0x61, 0x67, 0x65, 0x6e, 0x74, 0x45, 0x78, 0x70, 0x6f, 0x72, 0x74, 0x65, 0x72, - 0x45, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x12, 0x3a, 0x0a, 0x0f, 0x6f, 0x63, 0x61, 0x67, 0x65, - 0x6e, 0x74, 0x5f, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x09, - 0x42, 0x11, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0xb8, 0xee, 0xf2, 0xd2, 0x05, - 0x01, 0x18, 0x01, 0x52, 0x0e, 0x6f, 0x63, 0x61, 0x67, 0x65, 0x6e, 0x74, 0x41, 0x64, 0x64, 0x72, - 0x65, 0x73, 0x73, 0x12, 0x66, 0x0a, 0x14, 0x6f, 0x63, 0x61, 0x67, 0x65, 0x6e, 0x74, 0x5f, 0x67, - 0x72, 0x70, 0x63, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x18, 0x0e, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x21, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x47, 0x72, 0x70, 0x63, 0x53, 0x65, 0x72, - 0x76, 0x69, 0x63, 0x65, 0x42, 0x11, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0xb8, - 0xee, 0xf2, 0xd2, 0x05, 0x01, 0x18, 0x01, 0x52, 0x12, 0x6f, 0x63, 0x61, 0x67, 0x65, 0x6e, 0x74, - 0x47, 0x72, 0x70, 0x63, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x12, 0x7d, 0x0a, 0x16, 0x69, - 0x6e, 0x63, 0x6f, 0x6d, 0x69, 0x6e, 0x67, 0x5f, 0x74, 0x72, 0x61, 0x63, 0x65, 0x5f, 0x63, 0x6f, - 0x6e, 0x74, 0x65, 0x78, 0x74, 0x18, 0x08, 0x20, 0x03, 0x28, 0x0e, 0x32, 0x34, 0x2e, 0x65, 0x6e, - 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, - 0x2e, 0x76, 0x33, 0x2e, 0x4f, 0x70, 0x65, 0x6e, 0x43, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x43, 0x6f, - 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x54, 0x72, 0x61, 0x63, 0x65, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, - 0x74, 0x42, 0x11, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0xb8, 0xee, 0xf2, 0xd2, - 0x05, 0x01, 0x18, 0x01, 0x52, 0x14, 0x69, 0x6e, 0x63, 0x6f, 0x6d, 0x69, 0x6e, 0x67, 0x54, 0x72, - 0x61, 0x63, 0x65, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x12, 0x7d, 0x0a, 0x16, 0x6f, 0x75, - 0x74, 0x67, 0x6f, 0x69, 0x6e, 0x67, 0x5f, 0x74, 0x72, 0x61, 0x63, 0x65, 0x5f, 0x63, 0x6f, 0x6e, - 0x74, 0x65, 0x78, 0x74, 0x18, 0x09, 0x20, 0x03, 0x28, 0x0e, 0x32, 0x34, 0x2e, 0x65, 0x6e, 0x76, - 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, - 0x76, 0x33, 0x2e, 0x4f, 0x70, 0x65, 0x6e, 0x43, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x43, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x2e, 0x54, 0x72, 0x61, 0x63, 0x65, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, - 0x42, 0x11, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0xb8, 0xee, 0xf2, 0xd2, 0x05, - 0x01, 0x18, 0x01, 0x52, 0x14, 0x6f, 0x75, 0x74, 0x67, 0x6f, 0x69, 0x6e, 0x67, 0x54, 0x72, 0x61, - 0x63, 0x65, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x22, 0x60, 0x0a, 0x0c, 0x54, 0x72, 0x61, - 0x63, 0x65, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x12, 0x08, 0x0a, 0x04, 0x4e, 0x4f, 0x4e, - 0x45, 0x10, 0x00, 0x12, 0x11, 0x0a, 0x0d, 0x54, 0x52, 0x41, 0x43, 0x45, 0x5f, 0x43, 0x4f, 0x4e, - 0x54, 0x45, 0x58, 0x54, 0x10, 0x01, 0x12, 0x12, 0x0a, 0x0e, 0x47, 0x52, 0x50, 0x43, 0x5f, 0x54, - 0x52, 0x41, 0x43, 0x45, 0x5f, 0x42, 0x49, 0x4e, 0x10, 0x02, 0x12, 0x17, 0x0a, 0x13, 0x43, 0x4c, - 0x4f, 0x55, 0x44, 0x5f, 0x54, 0x52, 0x41, 0x43, 0x45, 0x5f, 0x43, 0x4f, 0x4e, 0x54, 0x45, 0x58, - 0x54, 0x10, 0x03, 0x12, 0x06, 0x0a, 0x02, 0x42, 0x33, 0x10, 0x04, 0x3a, 0x2d, 0x9a, 0xc5, 0x88, - 0x1e, 0x28, 0x0a, 0x26, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x32, 0x2e, 0x4f, 0x70, 0x65, 0x6e, 0x43, 0x65, - 0x6e, 0x73, 0x75, 0x73, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x4a, 0x04, 0x08, 0x07, 0x10, 0x08, - 0x42, 0xb9, 0x01, 0xf2, 0x98, 0xfe, 0x8f, 0x05, 0x2d, 0x12, 0x2b, 0x65, 0x6e, 0x76, 0x6f, 0x79, - 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x63, - 0x65, 0x72, 0x73, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x76, - 0x34, 0x61, 0x6c, 0x70, 0x68, 0x61, 0xba, 0x80, 0xc8, 0xd1, 0x06, 0x02, 0x10, 0x02, 0x0a, 0x23, - 0x69, 0x6f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2e, 0x65, 0x6e, - 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, - 0x2e, 0x76, 0x33, 0x42, 0x0f, 0x4f, 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x50, - 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x44, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, 0x2e, 0x63, - 0x6f, 0x6d, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2f, 0x67, 0x6f, - 0x2d, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x2d, 0x70, 0x6c, 0x61, 0x6e, 0x65, 0x2f, 0x65, - 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2f, 0x74, 0x72, 0x61, 0x63, - 0x65, 0x2f, 0x76, 0x33, 0x3b, 0x74, 0x72, 0x61, 0x63, 0x65, 0x76, 0x33, 0x62, 0x06, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x33, -} - -var ( - file_envoy_config_trace_v3_opencensus_proto_rawDescOnce sync.Once - file_envoy_config_trace_v3_opencensus_proto_rawDescData = file_envoy_config_trace_v3_opencensus_proto_rawDesc -) - -func file_envoy_config_trace_v3_opencensus_proto_rawDescGZIP() []byte { - file_envoy_config_trace_v3_opencensus_proto_rawDescOnce.Do(func() { - file_envoy_config_trace_v3_opencensus_proto_rawDescData = protoimpl.X.CompressGZIP(file_envoy_config_trace_v3_opencensus_proto_rawDescData) - }) - return file_envoy_config_trace_v3_opencensus_proto_rawDescData -} - -var file_envoy_config_trace_v3_opencensus_proto_enumTypes = make([]protoimpl.EnumInfo, 1) -var file_envoy_config_trace_v3_opencensus_proto_msgTypes = make([]protoimpl.MessageInfo, 1) -var file_envoy_config_trace_v3_opencensus_proto_goTypes = []interface{}{ - (OpenCensusConfig_TraceContext)(0), // 0: envoy.config.trace.v3.OpenCensusConfig.TraceContext - (*OpenCensusConfig)(nil), // 1: envoy.config.trace.v3.OpenCensusConfig - (*v1.TraceConfig)(nil), // 2: opencensus.proto.trace.v1.TraceConfig - (*v3.GrpcService)(nil), // 3: envoy.config.core.v3.GrpcService -} -var file_envoy_config_trace_v3_opencensus_proto_depIdxs = []int32{ - 2, // 0: envoy.config.trace.v3.OpenCensusConfig.trace_config:type_name -> opencensus.proto.trace.v1.TraceConfig - 3, // 1: envoy.config.trace.v3.OpenCensusConfig.stackdriver_grpc_service:type_name -> envoy.config.core.v3.GrpcService - 3, // 2: envoy.config.trace.v3.OpenCensusConfig.ocagent_grpc_service:type_name -> envoy.config.core.v3.GrpcService - 0, // 3: envoy.config.trace.v3.OpenCensusConfig.incoming_trace_context:type_name -> envoy.config.trace.v3.OpenCensusConfig.TraceContext - 0, // 4: envoy.config.trace.v3.OpenCensusConfig.outgoing_trace_context:type_name -> envoy.config.trace.v3.OpenCensusConfig.TraceContext - 5, // [5:5] is the sub-list for method output_type - 5, // [5:5] is the sub-list for method input_type - 5, // [5:5] is the sub-list for extension type_name - 5, // [5:5] is the sub-list for extension extendee - 0, // [0:5] is the sub-list for field type_name -} - -func init() { file_envoy_config_trace_v3_opencensus_proto_init() } -func file_envoy_config_trace_v3_opencensus_proto_init() { - if File_envoy_config_trace_v3_opencensus_proto != nil { - return - } - if !protoimpl.UnsafeEnabled { - file_envoy_config_trace_v3_opencensus_proto_msgTypes[0].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*OpenCensusConfig); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - } - type x struct{} - out := protoimpl.TypeBuilder{ - File: protoimpl.DescBuilder{ - GoPackagePath: reflect.TypeOf(x{}).PkgPath(), - RawDescriptor: file_envoy_config_trace_v3_opencensus_proto_rawDesc, - NumEnums: 1, - NumMessages: 1, - NumExtensions: 0, - NumServices: 0, - }, - GoTypes: file_envoy_config_trace_v3_opencensus_proto_goTypes, - DependencyIndexes: file_envoy_config_trace_v3_opencensus_proto_depIdxs, - EnumInfos: file_envoy_config_trace_v3_opencensus_proto_enumTypes, - MessageInfos: file_envoy_config_trace_v3_opencensus_proto_msgTypes, - }.Build() - File_envoy_config_trace_v3_opencensus_proto = out.File - file_envoy_config_trace_v3_opencensus_proto_rawDesc = nil - file_envoy_config_trace_v3_opencensus_proto_goTypes = nil - file_envoy_config_trace_v3_opencensus_proto_depIdxs = nil -} diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/opencensus.pb.validate.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/opencensus.pb.validate.go deleted file mode 100644 index 4e8286181c6db..0000000000000 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/opencensus.pb.validate.go +++ /dev/null @@ -1,240 +0,0 @@ -//go:build !disable_pgv -// Code generated by protoc-gen-validate. DO NOT EDIT. -// source: envoy/config/trace/v3/opencensus.proto - -package tracev3 - -import ( - "bytes" - "errors" - "fmt" - "net" - "net/mail" - "net/url" - "regexp" - "sort" - "strings" - "time" - "unicode/utf8" - - "google.golang.org/protobuf/types/known/anypb" -) - -// ensure the imports are used -var ( - _ = bytes.MinRead - _ = errors.New("") - _ = fmt.Print - _ = utf8.UTFMax - _ = (*regexp.Regexp)(nil) - _ = (*strings.Reader)(nil) - _ = net.IPv4len - _ = time.Duration(0) - _ = (*url.URL)(nil) - _ = (*mail.Address)(nil) - _ = anypb.Any{} - _ = sort.Sort -) - -// Validate checks the field values on OpenCensusConfig with the rules defined -// in the proto definition for this message. If any rules are violated, the -// first error encountered is returned, or nil if there are no violations. -func (m *OpenCensusConfig) Validate() error { - return m.validate(false) -} - -// ValidateAll checks the field values on OpenCensusConfig with the rules -// defined in the proto definition for this message. If any rules are -// violated, the result is a list of violation errors wrapped in -// OpenCensusConfigMultiError, or nil if none found. -func (m *OpenCensusConfig) ValidateAll() error { - return m.validate(true) -} - -func (m *OpenCensusConfig) validate(all bool) error { - if m == nil { - return nil - } - - var errors []error - - if all { - switch v := interface{}(m.GetTraceConfig()).(type) { - case interface{ ValidateAll() error }: - if err := v.ValidateAll(); err != nil { - errors = append(errors, OpenCensusConfigValidationError{ - field: "TraceConfig", - reason: "embedded message failed validation", - cause: err, - }) - } - case interface{ Validate() error }: - if err := v.Validate(); err != nil { - errors = append(errors, OpenCensusConfigValidationError{ - field: "TraceConfig", - reason: "embedded message failed validation", - cause: err, - }) - } - } - } else if v, ok := interface{}(m.GetTraceConfig()).(interface{ Validate() error }); ok { - if err := v.Validate(); err != nil { - return OpenCensusConfigValidationError{ - field: "TraceConfig", - reason: "embedded message failed validation", - cause: err, - } - } - } - - // no validation rules for StdoutExporterEnabled - - // no validation rules for StackdriverExporterEnabled - - // no validation rules for StackdriverProjectId - - // no validation rules for StackdriverAddress - - if all { - switch v := interface{}(m.GetStackdriverGrpcService()).(type) { - case interface{ ValidateAll() error }: - if err := v.ValidateAll(); err != nil { - errors = append(errors, OpenCensusConfigValidationError{ - field: "StackdriverGrpcService", - reason: "embedded message failed validation", - cause: err, - }) - } - case interface{ Validate() error }: - if err := v.Validate(); err != nil { - errors = append(errors, OpenCensusConfigValidationError{ - field: "StackdriverGrpcService", - reason: "embedded message failed validation", - cause: err, - }) - } - } - } else if v, ok := interface{}(m.GetStackdriverGrpcService()).(interface{ Validate() error }); ok { - if err := v.Validate(); err != nil { - return OpenCensusConfigValidationError{ - field: "StackdriverGrpcService", - reason: "embedded message failed validation", - cause: err, - } - } - } - - // no validation rules for ZipkinExporterEnabled - - // no validation rules for ZipkinUrl - - // no validation rules for OcagentExporterEnabled - - // no validation rules for OcagentAddress - - if all { - switch v := interface{}(m.GetOcagentGrpcService()).(type) { - case interface{ ValidateAll() error }: - if err := v.ValidateAll(); err != nil { - errors = append(errors, OpenCensusConfigValidationError{ - field: "OcagentGrpcService", - reason: "embedded message failed validation", - cause: err, - }) - } - case interface{ Validate() error }: - if err := v.Validate(); err != nil { - errors = append(errors, OpenCensusConfigValidationError{ - field: "OcagentGrpcService", - reason: "embedded message failed validation", - cause: err, - }) - } - } - } else if v, ok := interface{}(m.GetOcagentGrpcService()).(interface{ Validate() error }); ok { - if err := v.Validate(); err != nil { - return OpenCensusConfigValidationError{ - field: "OcagentGrpcService", - reason: "embedded message failed validation", - cause: err, - } - } - } - - if len(errors) > 0 { - return OpenCensusConfigMultiError(errors) - } - - return nil -} - -// OpenCensusConfigMultiError is an error wrapping multiple validation errors -// returned by OpenCensusConfig.ValidateAll() if the designated constraints -// aren't met. -type OpenCensusConfigMultiError []error - -// Error returns a concatenation of all the error messages it wraps. -func (m OpenCensusConfigMultiError) Error() string { - var msgs []string - for _, err := range m { - msgs = append(msgs, err.Error()) - } - return strings.Join(msgs, "; ") -} - -// AllErrors returns a list of validation violation errors. -func (m OpenCensusConfigMultiError) AllErrors() []error { return m } - -// OpenCensusConfigValidationError is the validation error returned by -// OpenCensusConfig.Validate if the designated constraints aren't met. -type OpenCensusConfigValidationError struct { - field string - reason string - cause error - key bool -} - -// Field function returns field value. -func (e OpenCensusConfigValidationError) Field() string { return e.field } - -// Reason function returns reason value. -func (e OpenCensusConfigValidationError) Reason() string { return e.reason } - -// Cause function returns cause value. -func (e OpenCensusConfigValidationError) Cause() error { return e.cause } - -// Key function returns key value. -func (e OpenCensusConfigValidationError) Key() bool { return e.key } - -// ErrorName returns error name. -func (e OpenCensusConfigValidationError) ErrorName() string { return "OpenCensusConfigValidationError" } - -// Error satisfies the builtin error interface -func (e OpenCensusConfigValidationError) Error() string { - cause := "" - if e.cause != nil { - cause = fmt.Sprintf(" | caused by: %v", e.cause) - } - - key := "" - if e.key { - key = "key for " - } - - return fmt.Sprintf( - "invalid %sOpenCensusConfig.%s: %s%s", - key, - e.field, - e.reason, - cause) -} - -var _ error = OpenCensusConfigValidationError{} - -var _ interface { - Field() string - Reason() string - Key() bool - Cause() error - ErrorName() string -} = OpenCensusConfigValidationError{} diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/opencensus_vtproto.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/opencensus_vtproto.pb.go deleted file mode 100644 index 66b08bf86ed0e..0000000000000 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/opencensus_vtproto.pb.go +++ /dev/null @@ -1,311 +0,0 @@ -//go:build vtprotobuf -// +build vtprotobuf - -// Code generated by protoc-gen-go-vtproto. DO NOT EDIT. -// source: envoy/config/trace/v3/opencensus.proto - -package tracev3 - -import ( - protohelpers "github.com/planetscale/vtprotobuf/protohelpers" - proto "google.golang.org/protobuf/proto" - protoimpl "google.golang.org/protobuf/runtime/protoimpl" -) - -const ( - // Verify that this generated code is sufficiently up-to-date. - _ = protoimpl.EnforceVersion(20 - protoimpl.MinVersion) - // Verify that runtime/protoimpl is sufficiently up-to-date. - _ = protoimpl.EnforceVersion(protoimpl.MaxVersion - 20) -) - -func (m *OpenCensusConfig) MarshalVTStrict() (dAtA []byte, err error) { - if m == nil { - return nil, nil - } - size := m.SizeVT() - dAtA = make([]byte, size) - n, err := m.MarshalToSizedBufferVTStrict(dAtA[:size]) - if err != nil { - return nil, err - } - return dAtA[:n], nil -} - -func (m *OpenCensusConfig) MarshalToVTStrict(dAtA []byte) (int, error) { - size := m.SizeVT() - return m.MarshalToSizedBufferVTStrict(dAtA[:size]) -} - -func (m *OpenCensusConfig) MarshalToSizedBufferVTStrict(dAtA []byte) (int, error) { - if m == nil { - return 0, nil - } - i := len(dAtA) - _ = i - var l int - _ = l - if m.unknownFields != nil { - i -= len(m.unknownFields) - copy(dAtA[i:], m.unknownFields) - } - if m.OcagentGrpcService != nil { - if vtmsg, ok := interface{}(m.OcagentGrpcService).(interface { - MarshalToSizedBufferVTStrict([]byte) (int, error) - }); ok { - size, err := vtmsg.MarshalToSizedBufferVTStrict(dAtA[:i]) - if err != nil { - return 0, err - } - i -= size - i = protohelpers.EncodeVarint(dAtA, i, uint64(size)) - } else { - encoded, err := proto.Marshal(m.OcagentGrpcService) - if err != nil { - return 0, err - } - i -= len(encoded) - copy(dAtA[i:], encoded) - i = protohelpers.EncodeVarint(dAtA, i, uint64(len(encoded))) - } - i-- - dAtA[i] = 0x72 - } - if m.StackdriverGrpcService != nil { - if vtmsg, ok := interface{}(m.StackdriverGrpcService).(interface { - MarshalToSizedBufferVTStrict([]byte) (int, error) - }); ok { - size, err := vtmsg.MarshalToSizedBufferVTStrict(dAtA[:i]) - if err != nil { - return 0, err - } - i -= size - i = protohelpers.EncodeVarint(dAtA, i, uint64(size)) - } else { - encoded, err := proto.Marshal(m.StackdriverGrpcService) - if err != nil { - return 0, err - } - i -= len(encoded) - copy(dAtA[i:], encoded) - i = protohelpers.EncodeVarint(dAtA, i, uint64(len(encoded))) - } - i-- - dAtA[i] = 0x6a - } - if len(m.OcagentAddress) > 0 { - i -= len(m.OcagentAddress) - copy(dAtA[i:], m.OcagentAddress) - i = protohelpers.EncodeVarint(dAtA, i, uint64(len(m.OcagentAddress))) - i-- - dAtA[i] = 0x62 - } - if m.OcagentExporterEnabled { - i-- - if m.OcagentExporterEnabled { - dAtA[i] = 1 - } else { - dAtA[i] = 0 - } - i-- - dAtA[i] = 0x58 - } - if len(m.StackdriverAddress) > 0 { - i -= len(m.StackdriverAddress) - copy(dAtA[i:], m.StackdriverAddress) - i = protohelpers.EncodeVarint(dAtA, i, uint64(len(m.StackdriverAddress))) - i-- - dAtA[i] = 0x52 - } - if len(m.OutgoingTraceContext) > 0 { - var pksize2 int - for _, num := range m.OutgoingTraceContext { - pksize2 += protohelpers.SizeOfVarint(uint64(num)) - } - i -= pksize2 - j1 := i - for _, num1 := range m.OutgoingTraceContext { - num := uint64(num1) - for num >= 1<<7 { - dAtA[j1] = uint8(uint64(num)&0x7f | 0x80) - num >>= 7 - j1++ - } - dAtA[j1] = uint8(num) - j1++ - } - i = protohelpers.EncodeVarint(dAtA, i, uint64(pksize2)) - i-- - dAtA[i] = 0x4a - } - if len(m.IncomingTraceContext) > 0 { - var pksize4 int - for _, num := range m.IncomingTraceContext { - pksize4 += protohelpers.SizeOfVarint(uint64(num)) - } - i -= pksize4 - j3 := i - for _, num1 := range m.IncomingTraceContext { - num := uint64(num1) - for num >= 1<<7 { - dAtA[j3] = uint8(uint64(num)&0x7f | 0x80) - num >>= 7 - j3++ - } - dAtA[j3] = uint8(num) - j3++ - } - i = protohelpers.EncodeVarint(dAtA, i, uint64(pksize4)) - i-- - dAtA[i] = 0x42 - } - if len(m.ZipkinUrl) > 0 { - i -= len(m.ZipkinUrl) - copy(dAtA[i:], m.ZipkinUrl) - i = protohelpers.EncodeVarint(dAtA, i, uint64(len(m.ZipkinUrl))) - i-- - dAtA[i] = 0x32 - } - if m.ZipkinExporterEnabled { - i-- - if m.ZipkinExporterEnabled { - dAtA[i] = 1 - } else { - dAtA[i] = 0 - } - i-- - dAtA[i] = 0x28 - } - if len(m.StackdriverProjectId) > 0 { - i -= len(m.StackdriverProjectId) - copy(dAtA[i:], m.StackdriverProjectId) - i = protohelpers.EncodeVarint(dAtA, i, uint64(len(m.StackdriverProjectId))) - i-- - dAtA[i] = 0x22 - } - if m.StackdriverExporterEnabled { - i-- - if m.StackdriverExporterEnabled { - dAtA[i] = 1 - } else { - dAtA[i] = 0 - } - i-- - dAtA[i] = 0x18 - } - if m.StdoutExporterEnabled { - i-- - if m.StdoutExporterEnabled { - dAtA[i] = 1 - } else { - dAtA[i] = 0 - } - i-- - dAtA[i] = 0x10 - } - if m.TraceConfig != nil { - if vtmsg, ok := interface{}(m.TraceConfig).(interface { - MarshalToSizedBufferVTStrict([]byte) (int, error) - }); ok { - size, err := vtmsg.MarshalToSizedBufferVTStrict(dAtA[:i]) - if err != nil { - return 0, err - } - i -= size - i = protohelpers.EncodeVarint(dAtA, i, uint64(size)) - } else { - encoded, err := proto.Marshal(m.TraceConfig) - if err != nil { - return 0, err - } - i -= len(encoded) - copy(dAtA[i:], encoded) - i = protohelpers.EncodeVarint(dAtA, i, uint64(len(encoded))) - } - i-- - dAtA[i] = 0xa - } - return len(dAtA) - i, nil -} - -func (m *OpenCensusConfig) SizeVT() (n int) { - if m == nil { - return 0 - } - var l int - _ = l - if m.TraceConfig != nil { - if size, ok := interface{}(m.TraceConfig).(interface { - SizeVT() int - }); ok { - l = size.SizeVT() - } else { - l = proto.Size(m.TraceConfig) - } - n += 1 + l + protohelpers.SizeOfVarint(uint64(l)) - } - if m.StdoutExporterEnabled { - n += 2 - } - if m.StackdriverExporterEnabled { - n += 2 - } - l = len(m.StackdriverProjectId) - if l > 0 { - n += 1 + l + protohelpers.SizeOfVarint(uint64(l)) - } - if m.ZipkinExporterEnabled { - n += 2 - } - l = len(m.ZipkinUrl) - if l > 0 { - n += 1 + l + protohelpers.SizeOfVarint(uint64(l)) - } - if len(m.IncomingTraceContext) > 0 { - l = 0 - for _, e := range m.IncomingTraceContext { - l += protohelpers.SizeOfVarint(uint64(e)) - } - n += 1 + protohelpers.SizeOfVarint(uint64(l)) + l - } - if len(m.OutgoingTraceContext) > 0 { - l = 0 - for _, e := range m.OutgoingTraceContext { - l += protohelpers.SizeOfVarint(uint64(e)) - } - n += 1 + protohelpers.SizeOfVarint(uint64(l)) + l - } - l = len(m.StackdriverAddress) - if l > 0 { - n += 1 + l + protohelpers.SizeOfVarint(uint64(l)) - } - if m.OcagentExporterEnabled { - n += 2 - } - l = len(m.OcagentAddress) - if l > 0 { - n += 1 + l + protohelpers.SizeOfVarint(uint64(l)) - } - if m.StackdriverGrpcService != nil { - if size, ok := interface{}(m.StackdriverGrpcService).(interface { - SizeVT() int - }); ok { - l = size.SizeVT() - } else { - l = proto.Size(m.StackdriverGrpcService) - } - n += 1 + l + protohelpers.SizeOfVarint(uint64(l)) - } - if m.OcagentGrpcService != nil { - if size, ok := interface{}(m.OcagentGrpcService).(interface { - SizeVT() int - }); ok { - l = size.SizeVT() - } else { - l = proto.Size(m.OcagentGrpcService) - } - n += 1 + l + protohelpers.SizeOfVarint(uint64(l)) - } - n += len(m.unknownFields) - return n -} diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/opentelemetry.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/opentelemetry.pb.go index a0087e25807a2..bc07370525612 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/opentelemetry.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/opentelemetry.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/trace/v3/opentelemetry.proto package tracev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/service.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/service.pb.go index 662b1bea5d586..1834dfed4b54f 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/service.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/service.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/trace/v3/service.proto package tracev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/skywalking.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/skywalking.pb.go index 948ea5f138107..c7a247ee416f5 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/skywalking.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/skywalking.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/trace/v3/skywalking.proto package tracev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/trace.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/trace.pb.go index 94ded5e4a217b..468631cd576dc 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/trace.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/trace.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/trace/v3/trace.proto package tracev3 @@ -35,26 +35,23 @@ var file_envoy_config_trace_v3_trace_proto_rawDesc = []byte{ 0x74, 0x74, 0x70, 0x5f, 0x74, 0x72, 0x61, 0x63, 0x65, 0x72, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x25, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2f, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2f, 0x76, 0x33, 0x2f, 0x6c, 0x69, 0x67, 0x68, 0x74, 0x73, 0x74, 0x65, - 0x70, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x26, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x63, + 0x70, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x29, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2f, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2f, 0x76, 0x33, 0x2f, 0x6f, - 0x70, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, - 0x29, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2f, 0x74, 0x72, - 0x61, 0x63, 0x65, 0x2f, 0x76, 0x33, 0x2f, 0x6f, 0x70, 0x65, 0x6e, 0x74, 0x65, 0x6c, 0x65, 0x6d, - 0x65, 0x74, 0x72, 0x79, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x23, 0x65, 0x6e, 0x76, 0x6f, - 0x79, 0x2f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2f, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2f, 0x76, - 0x33, 0x2f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, - 0x22, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2f, 0x74, 0x72, - 0x61, 0x63, 0x65, 0x2f, 0x76, 0x33, 0x2f, 0x7a, 0x69, 0x70, 0x6b, 0x69, 0x6e, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x42, 0x79, 0x0a, 0x23, 0x69, 0x6f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, - 0x72, 0x6f, 0x78, 0x79, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, - 0x67, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, 0x76, 0x33, 0x42, 0x0a, 0x54, 0x72, 0x61, 0x63, - 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x44, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, - 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2f, - 0x67, 0x6f, 0x2d, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x2d, 0x70, 0x6c, 0x61, 0x6e, 0x65, - 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2f, 0x74, 0x72, - 0x61, 0x63, 0x65, 0x2f, 0x76, 0x33, 0x3b, 0x74, 0x72, 0x61, 0x63, 0x65, 0x76, 0x33, 0x50, 0x00, - 0x50, 0x01, 0x50, 0x02, 0x50, 0x03, 0x50, 0x04, 0x50, 0x05, 0x50, 0x06, 0x50, 0x07, 0x62, 0x06, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x70, 0x65, 0x6e, 0x74, 0x65, 0x6c, 0x65, 0x6d, 0x65, 0x74, 0x72, 0x79, 0x2e, 0x70, 0x72, 0x6f, + 0x74, 0x6f, 0x1a, 0x23, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, + 0x2f, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2f, 0x76, 0x33, 0x2f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, + 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x22, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x63, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2f, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2f, 0x76, 0x33, 0x2f, 0x7a, + 0x69, 0x70, 0x6b, 0x69, 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x42, 0x79, 0x0a, 0x23, 0x69, + 0x6f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2e, 0x65, 0x6e, 0x76, + 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2e, + 0x76, 0x33, 0x42, 0x0a, 0x54, 0x72, 0x61, 0x63, 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, + 0x5a, 0x44, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x65, 0x6e, 0x76, + 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2f, 0x67, 0x6f, 0x2d, 0x63, 0x6f, 0x6e, 0x74, 0x72, + 0x6f, 0x6c, 0x2d, 0x70, 0x6c, 0x61, 0x6e, 0x65, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x63, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2f, 0x74, 0x72, 0x61, 0x63, 0x65, 0x2f, 0x76, 0x33, 0x3b, 0x74, + 0x72, 0x61, 0x63, 0x65, 0x76, 0x33, 0x50, 0x00, 0x50, 0x01, 0x50, 0x02, 0x50, 0x03, 0x50, 0x04, + 0x50, 0x05, 0x50, 0x06, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var file_envoy_config_trace_v3_trace_proto_goTypes = []interface{}{} @@ -75,7 +72,6 @@ func file_envoy_config_trace_v3_trace_proto_init() { file_envoy_config_trace_v3_dynamic_ot_proto_init() file_envoy_config_trace_v3_http_tracer_proto_init() file_envoy_config_trace_v3_lightstep_proto_init() - file_envoy_config_trace_v3_opencensus_proto_init() file_envoy_config_trace_v3_opentelemetry_proto_init() file_envoy_config_trace_v3_service_proto_init() file_envoy_config_trace_v3_zipkin_proto_init() diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/xray.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/xray.pb.go index c040e1e0ee59c..fc7976cec5436 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/xray.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/xray.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/trace/v3/xray.proto package tracev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/zipkin.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/zipkin.pb.go index bf96a43d7aa17..493b226067474 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/zipkin.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/config/trace/v3/zipkin.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/config/trace/v3/zipkin.proto package tracev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/data/accesslog/v3/accesslog.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/data/accesslog/v3/accesslog.pb.go index eb9a42f3d7ddd..17a203d06207e 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/data/accesslog/v3/accesslog.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/data/accesslog/v3/accesslog.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/data/accesslog/v3/accesslog.proto package accesslogv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/clusters/aggregate/v3/cluster.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/clusters/aggregate/v3/cluster.pb.go index ed75102d4eaea..5efe492cc65a1 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/clusters/aggregate/v3/cluster.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/clusters/aggregate/v3/cluster.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/extensions/clusters/aggregate/v3/cluster.proto package aggregatev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/filters/common/fault/v3/fault.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/filters/common/fault/v3/fault.pb.go index 13e47ea83255f..3059925c78cdb 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/filters/common/fault/v3/fault.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/filters/common/fault/v3/fault.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/extensions/filters/common/fault/v3/fault.proto package faultv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/filters/http/fault/v3/fault.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/filters/http/fault/v3/fault.pb.go index cea58cea9d569..da602ca623ac6 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/filters/http/fault/v3/fault.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/filters/http/fault/v3/fault.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/extensions/filters/http/fault/v3/fault.proto package faultv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/filters/http/rbac/v3/rbac.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/filters/http/rbac/v3/rbac.pb.go index bcf5c7d40725b..593350edbf206 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/filters/http/rbac/v3/rbac.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/filters/http/rbac/v3/rbac.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/extensions/filters/http/rbac/v3/rbac.proto package rbacv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/filters/http/router/v3/router.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/filters/http/router/v3/router.pb.go index 01a368894bcd4..40602a4c045b0 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/filters/http/router/v3/router.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/filters/http/router/v3/router.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/extensions/filters/http/router/v3/router.proto package routerv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/filters/network/http_connection_manager/v3/http_connection_manager.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/filters/network/http_connection_manager/v3/http_connection_manager.pb.go index 02027795c33b2..d5284d9c9697b 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/filters/network/http_connection_manager/v3/http_connection_manager.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/filters/network/http_connection_manager/v3/http_connection_manager.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/extensions/filters/network/http_connection_manager/v3/http_connection_manager.proto package http_connection_managerv3 @@ -588,7 +588,7 @@ type HttpConnectionManager struct { // // .. warning:: // - // In the next release, no IP addresses will be considered trusted. If you have tooling such as probes + // As of Envoy 1.33.0 no IP addresses will be considered trusted. If you have tooling such as probes // on your private network which need to be treated as trusted (e.g. changing arbitrary x-envoy headers) // you will have to manually include those addresses or CIDR ranges like: // @@ -2044,15 +2044,6 @@ type HttpConnectionManager_Tracing struct { CustomTags []*v34.CustomTag `protobuf:"bytes,8,rep,name=custom_tags,json=customTags,proto3" json:"custom_tags,omitempty"` // Configuration for an external tracing provider. // If not specified, no tracing will be performed. - // - // .. attention:: - // - // Please be aware that ``envoy.tracers.opencensus`` provider can only be configured once - // in Envoy lifetime. - // Any attempts to reconfigure it or to use different configurations for different HCM filters - // will be rejected. - // Such a constraint is inherent to OpenCensus itself. It cannot be overcome without changes - // on OpenCensus side. Provider *v35.Tracing_Http `protobuf:"bytes,9,opt,name=provider,proto3" json:"provider,omitempty"` // Create separate tracing span for each upstream request if true. And if this flag is set to true, // the tracing provider will assume that Envoy will be independent hop in the trace chain and may diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/client_side_weighted_round_robin/v3/client_side_weighted_round_robin.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/client_side_weighted_round_robin/v3/client_side_weighted_round_robin.pb.go index d21286cf88045..a97860788dba8 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/client_side_weighted_round_robin/v3/client_side_weighted_round_robin.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/client_side_weighted_round_robin/v3/client_side_weighted_round_robin.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/extensions/load_balancing_policies/client_side_weighted_round_robin/v3/client_side_weighted_round_robin.proto package client_side_weighted_round_robinv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/common/v3/common.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/common/v3/common.pb.go index 726732605b4a6..0018f1e401d7b 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/common/v3/common.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/common/v3/common.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/extensions/load_balancing_policies/common/v3/common.proto package commonv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/least_request/v3/least_request.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/least_request/v3/least_request.pb.go index 819df3d7b7cf8..df7dcae685fc8 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/least_request/v3/least_request.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/least_request/v3/least_request.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/extensions/load_balancing_policies/least_request/v3/least_request.proto package least_requestv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/pick_first/v3/pick_first.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/pick_first/v3/pick_first.pb.go index 7468da4ac838a..3780fbc7da8db 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/pick_first/v3/pick_first.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/pick_first/v3/pick_first.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/extensions/load_balancing_policies/pick_first/v3/pick_first.proto package pick_firstv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/ring_hash/v3/ring_hash.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/ring_hash/v3/ring_hash.pb.go index 6c544cc726ae8..9d06c449d1af7 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/ring_hash/v3/ring_hash.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/ring_hash/v3/ring_hash.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/extensions/load_balancing_policies/ring_hash/v3/ring_hash.proto package ring_hashv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/wrr_locality/v3/wrr_locality.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/wrr_locality/v3/wrr_locality.pb.go index 7c3741a23dd26..02d5d7d5cf62b 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/wrr_locality/v3/wrr_locality.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/load_balancing_policies/wrr_locality/v3/wrr_locality.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/extensions/load_balancing_policies/wrr_locality/v3/wrr_locality.proto package wrr_localityv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/rbac/audit_loggers/stream/v3/stream.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/rbac/audit_loggers/stream/v3/stream.pb.go index 4199deae58717..d8d5667081bf9 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/rbac/audit_loggers/stream/v3/stream.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/rbac/audit_loggers/stream/v3/stream.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/extensions/rbac/audit_loggers/stream/v3/stream.proto package streamv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/cert.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/cert.pb.go index 37df4d7a638b6..f614c45427f33 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/cert.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/cert.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/extensions/transport_sockets/tls/v3/cert.proto package tlsv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/common.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/common.pb.go index f9aa84130a664..bb2fd3a0e8210 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/common.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/common.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/extensions/transport_sockets/tls/v3/common.proto package tlsv3 @@ -519,12 +519,13 @@ type TlsCertificate struct { // ` documentation for further details. WatchedDirectory *v3.WatchedDirectory `protobuf:"bytes,7,opt,name=watched_directory,json=watchedDirectory,proto3" json:"watched_directory,omitempty"` // BoringSSL private key method provider. This is an alternative to :ref:`private_key - // ` field. This can't be - // marked as “oneof“ due to API compatibility reasons. Setting both :ref:`private_key - // ` and - // :ref:`private_key_provider - // ` fields will result in an - // error. + // ` field. + // When both :ref:`private_key ` and + // :ref:`private_key_provider ` fields are set, + // “private_key_provider“ takes precedence. + // If “private_key_provider“ is unavailable and :ref:`fallback + // ` + // is enabled, “private_key“ will be used. PrivateKeyProvider *PrivateKeyProvider `protobuf:"bytes,6,opt,name=private_key_provider,json=privateKeyProvider,proto3" json:"private_key_provider,omitempty"` // The password to decrypt the TLS private key. If this field is not set, it is assumed that the // TLS private key is not password encrypted. diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/secret.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/secret.pb.go index cf919ed971ba8..888dae0c64657 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/secret.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/secret.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/extensions/transport_sockets/tls/v3/secret.proto package tlsv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/tls.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/tls.pb.go index db43da6745ad4..f1cedde9e5b95 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/tls.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/tls.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/extensions/transport_sockets/tls/v3/tls.proto package tlsv3 @@ -29,22 +29,14 @@ const ( type DownstreamTlsContext_OcspStaplePolicy int32 const ( - // OCSP responses are optional. If an OCSP response is absent - // or expired, the associated certificate will be used for - // connections without an OCSP staple. + // OCSP responses are optional. If absent or expired, the certificate is used without stapling. DownstreamTlsContext_LENIENT_STAPLING DownstreamTlsContext_OcspStaplePolicy = 0 - // OCSP responses are optional. If an OCSP response is absent, - // the associated certificate will be used without an - // OCSP staple. If a response is provided but is expired, - // the associated certificate will not be used for - // subsequent connections. If no suitable certificate is found, - // the connection is rejected. + // OCSP responses are optional. If absent, the certificate is used without stapling. If present but expired, + // the certificate is not used for subsequent connections. Connections are rejected if no suitable certificate + // is found. DownstreamTlsContext_STRICT_STAPLING DownstreamTlsContext_OcspStaplePolicy = 1 - // OCSP responses are required. Configuration will fail if - // a certificate is provided without an OCSP response. If a - // response expires, the associated certificate will not be - // used connections. If no suitable certificate is found, the - // connection is rejected. + // OCSP responses are required. Connections fail if a certificate lacks a valid OCSP response. Expired responses + // prevent certificate use in new connections, and connections are rejected if no suitable certificate is available. DownstreamTlsContext_MUST_STAPLE DownstreamTlsContext_OcspStaplePolicy = 2 ) @@ -89,7 +81,7 @@ func (DownstreamTlsContext_OcspStaplePolicy) EnumDescriptor() ([]byte, []int) { return file_envoy_extensions_transport_sockets_tls_v3_tls_proto_rawDescGZIP(), []int{1, 0} } -// [#next-free-field: 6] +// [#next-free-field: 8] type UpstreamTlsContext struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -99,12 +91,28 @@ type UpstreamTlsContext struct { // // .. attention:: // - // Server certificate verification is not enabled by default. Configure - // :ref:`trusted_ca` to enable - // verification. + // Server certificate verification is not enabled by default. To enable verification, configure + // :ref:`trusted_ca`. CommonTlsContext *CommonTlsContext `protobuf:"bytes,1,opt,name=common_tls_context,json=commonTlsContext,proto3" json:"common_tls_context,omitempty"` // SNI string to use when creating TLS backend connections. Sni string `protobuf:"bytes,2,opt,name=sni,proto3" json:"sni,omitempty"` + // If true, replaces the SNI for the connection with the hostname of the upstream host, if + // the hostname is known due to either a DNS cluster type or the + // :ref:`hostname ` is set on + // the host. + // + // See :ref:`SNI configuration ` for details on how this + // interacts with other validation options. + AutoHostSni bool `protobuf:"varint,6,opt,name=auto_host_sni,json=autoHostSni,proto3" json:"auto_host_sni,omitempty"` + // If true, replaces any Subject Alternative Name (SAN) validations with a validation for a DNS SAN matching + // the SNI value sent. The validation uses the actual requested SNI, regardless of how the SNI is configured. + // + // For common cases where an SNI value is present and the server certificate should include a corresponding SAN, + // this option ensures the SAN is properly validated. + // + // See the :ref:`validation configuration ` for how this interacts with + // other validation options. + AutoSniSanValidation bool `protobuf:"varint,7,opt,name=auto_sni_san_validation,json=autoSniSanValidation,proto3" json:"auto_sni_san_validation,omitempty"` // If true, server-initiated TLS renegotiation will be allowed. // // .. attention:: @@ -112,15 +120,19 @@ type UpstreamTlsContext struct { // TLS renegotiation is considered insecure and shouldn't be used unless absolutely necessary. AllowRenegotiation bool `protobuf:"varint,3,opt,name=allow_renegotiation,json=allowRenegotiation,proto3" json:"allow_renegotiation,omitempty"` // Maximum number of session keys (Pre-Shared Keys for TLSv1.3+, Session IDs and Session Tickets - // for TLSv1.2 and older) to store for the purpose of session resumption. + // for TLSv1.2 and older) to be stored for session resumption. // // Defaults to 1, setting this to 0 disables session resumption. MaxSessionKeys *wrapperspb.UInt32Value `protobuf:"bytes,4,opt,name=max_session_keys,json=maxSessionKeys,proto3" json:"max_session_keys,omitempty"` - // This field is used to control the enforcement, whereby the handshake will fail if the keyUsage extension - // is present and incompatible with the TLS usage. Currently, the default value is false (i.e., enforcement off) - // but it is expected to be changed to true by default in a future release. - // “ssl.was_key_usage_invalid“ in :ref:`listener metrics ` will be set for certificate - // configurations that would fail if this option were set to true. + // Controls enforcement of the “keyUsage“ extension in peer certificates. If set to “true“, the handshake will fail if + // the “keyUsage“ is incompatible with TLS usage. + // + // .. note:: + // + // The default value is ``false`` (i.e., enforcement off). It is expected to change to ``true`` in a future release. + // + // The “ssl.was_key_usage_invalid“ in :ref:`listener metrics ` metric will be incremented + // for configurations that would fail if this option were enabled. EnforceRsaKeyUsage *wrapperspb.BoolValue `protobuf:"bytes,5,opt,name=enforce_rsa_key_usage,json=enforceRsaKeyUsage,proto3" json:"enforce_rsa_key_usage,omitempty"` } @@ -170,6 +182,20 @@ func (x *UpstreamTlsContext) GetSni() string { return "" } +func (x *UpstreamTlsContext) GetAutoHostSni() bool { + if x != nil { + return x.AutoHostSni + } + return false +} + +func (x *UpstreamTlsContext) GetAutoSniSanValidation() bool { + if x != nil { + return x.AutoSniSanValidation + } + return false +} + func (x *UpstreamTlsContext) GetAllowRenegotiation() bool { if x != nil { return x.AllowRenegotiation @@ -211,24 +237,34 @@ type DownstreamTlsContext struct { // *DownstreamTlsContext_SessionTicketKeysSdsSecretConfig // *DownstreamTlsContext_DisableStatelessSessionResumption SessionTicketKeysType isDownstreamTlsContext_SessionTicketKeysType `protobuf_oneof:"session_ticket_keys_type"` - // If set to true, the TLS server will not maintain a session cache of TLS sessions. (This is - // relevant only for TLSv1.2 and earlier.) + // If “true“, the TLS server will not maintain a session cache of TLS sessions. + // + // .. note:: + // + // This applies only to TLSv1.2 and earlier. DisableStatefulSessionResumption bool `protobuf:"varint,10,opt,name=disable_stateful_session_resumption,json=disableStatefulSessionResumption,proto3" json:"disable_stateful_session_resumption,omitempty"` - // If specified, “session_timeout“ will change the maximum lifetime (in seconds) of the TLS session. - // Currently this value is used as a hint for the `TLS session ticket lifetime (for TLSv1.2) `_. - // Only seconds can be specified (fractional seconds are ignored). + // Maximum lifetime of TLS sessions. If specified, “session_timeout“ will change the maximum lifetime + // of the TLS session. + // + // This serves as a hint for the `TLS session ticket lifetime (for TLSv1.2) `_. + // Only whole seconds are considered; fractional seconds are ignored. SessionTimeout *durationpb.Duration `protobuf:"bytes,6,opt,name=session_timeout,json=sessionTimeout,proto3" json:"session_timeout,omitempty"` - // Config for whether to use certificates if they do not have - // an accompanying OCSP response or if the response expires at runtime. - // Defaults to LENIENT_STAPLING + // Configuration for handling certificates without an OCSP response or with expired responses. + // + // Defaults to “LENIENT_STAPLING“ OcspStaplePolicy DownstreamTlsContext_OcspStaplePolicy `protobuf:"varint,8,opt,name=ocsp_staple_policy,json=ocspStaplePolicy,proto3,enum=envoy.extensions.transport_sockets.tls.v3.DownstreamTlsContext_OcspStaplePolicy" json:"ocsp_staple_policy,omitempty"` // Multiple certificates are allowed in Downstream transport socket to serve different SNI. - // If the client provides SNI but no such cert matched, it will decide to full scan certificates or not based on this config. - // Defaults to false. See more details in :ref:`Multiple TLS certificates `. + // This option controls the behavior when no matching certificate is found for the received SNI value, + // or no SNI value was sent. If enabled, all certificates will be evaluated for a match for non-SNI criteria + // such as key type and OCSP settings. If disabled, the first provided certificate will be used. + // Defaults to “false“. See more details in :ref:`Multiple TLS certificates `. FullScanCertsOnSniMismatch *wrapperspb.BoolValue `protobuf:"bytes,9,opt,name=full_scan_certs_on_sni_mismatch,json=fullScanCertsOnSniMismatch,proto3" json:"full_scan_certs_on_sni_mismatch,omitempty"` - // By default, Envoy as a server uses its preferred cipher during the handshake. - // Setting this to true would allow the downstream client's preferred cipher to be used instead. - // Has no effect when using TLSv1_3. + // If “true“, the downstream client's preferred cipher is used during the handshake. If “false“, Envoy + // uses its preferred cipher. + // + // .. note:: + // + // This has no effect when using TLSv1_3. PreferClientCiphers bool `protobuf:"varint,11,opt,name=prefer_client_ciphers,json=preferClientCiphers,proto3" json:"prefer_client_ciphers,omitempty"` } @@ -389,13 +425,11 @@ type TlsKeyLog struct { sizeCache protoimpl.SizeCache unknownFields protoimpl.UnknownFields - // The path to save the TLS key log. + // Path to save the TLS key log. Path string `protobuf:"bytes,1,opt,name=path,proto3" json:"path,omitempty"` - // The local IP address that will be used to filter the connection which should save the TLS key log - // If it is not set, any local IP address will be matched. + // Local IP address ranges to filter connections for TLS key logging. If not set, matches any local IP address. LocalAddressRange []*v3.CidrRange `protobuf:"bytes,2,rep,name=local_address_range,json=localAddressRange,proto3" json:"local_address_range,omitempty"` - // The remote IP address that will be used to filter the connection which should save the TLS key log - // If it is not set, any remote IP address will be matched. + // Remote IP address ranges to filter connections for TLS key logging. If not set, matches any remote IP address. RemoteAddressRange []*v3.CidrRange `protobuf:"bytes,3,rep,name=remote_address_range,json=remoteAddressRange,proto3" json:"remote_address_range,omitempty"` } @@ -472,7 +506,7 @@ type CommonTlsContext struct { // fetched/refreshed over the network asynchronously with respect to the TLS handshake. // // The same number and types of certificates as :ref:`tls_certificates ` - // are valid in the the certificates fetched through this setting. + // are valid in the certificates fetched through this setting. // // If “tls_certificates“ or “tls_certificate_provider_instance“ are set, this field // is ignored. @@ -689,13 +723,17 @@ type CommonTlsContext_ValidationContextSdsSecretConfig struct { } type CommonTlsContext_CombinedValidationContext struct { - // Combined certificate validation context holds a default CertificateValidationContext - // and SDS config. When SDS server returns dynamic CertificateValidationContext, both dynamic - // and default CertificateValidationContext are merged into a new CertificateValidationContext - // for validation. This merge is done by Message::MergeFrom(), so dynamic - // CertificateValidationContext overwrites singular fields in default - // CertificateValidationContext, and concatenates repeated fields to default - // CertificateValidationContext, and logical OR is applied to boolean fields. + // Combines the default “CertificateValidationContext“ with the SDS-provided dynamic context for certificate + // validation. + // + // When the SDS server returns a dynamic “CertificateValidationContext“, it is merged + // with the default context using “Message::MergeFrom()“. The merging rules are as follows: + // + // * **Singular Fields:** Dynamic fields override the default singular fields. + // * **Repeated Fields:** Dynamic repeated fields are concatenated with the default repeated fields. + // * **Boolean Fields:** Boolean fields are combined using a logical OR operation. + // + // The resulting “CertificateValidationContext“ is used to perform certificate validation. CombinedValidationContext *CommonTlsContext_CombinedCertificateValidationContext `protobuf:"bytes,8,opt,name=combined_validation_context,json=combinedValidationContext,proto3,oneof"` } @@ -728,8 +766,8 @@ func (*CommonTlsContext_ValidationContextCertificateProvider) isCommonTlsContext func (*CommonTlsContext_ValidationContextCertificateProviderInstance) isCommonTlsContext_ValidationContextType() { } -// Config for Certificate provider to get certificates. This provider should allow certificates to be -// fetched/refreshed over the network asynchronously with respect to the TLS handshake. +// Config for the Certificate Provider to fetch certificates. Certificates are fetched/refreshed asynchronously over +// the network relative to the TLS handshake. // // DEPRECATED: This message is not currently used, but if we ever do need it, we will want to // move it out of CommonTlsContext and into common.proto, similar to the existing @@ -1013,7 +1051,7 @@ var file_envoy_extensions_transport_sockets_tls_v3_tls_proto_rawDesc = []byte{ 0x75, 0x64, 0x70, 0x61, 0x2f, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x69, 0x6e, 0x67, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x17, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x65, 0x2f, 0x76, 0x61, 0x6c, 0x69, - 0x64, 0x61, 0x74, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0x90, 0x03, 0x0a, 0x12, 0x55, + 0x64, 0x61, 0x74, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0xeb, 0x03, 0x0a, 0x12, 0x55, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x12, 0x69, 0x0a, 0x12, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x5f, 0x74, 0x6c, 0x73, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x3b, 0x2e, @@ -1023,321 +1061,327 @@ var file_envoy_extensions_transport_sockets_tls_v3_tls_proto_rawDesc = []byte{ 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x52, 0x10, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x12, 0x1a, 0x0a, 0x03, 0x73, 0x6e, 0x69, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x72, 0x03, - 0x28, 0xff, 0x01, 0x52, 0x03, 0x73, 0x6e, 0x69, 0x12, 0x2f, 0x0a, 0x13, 0x61, 0x6c, 0x6c, 0x6f, - 0x77, 0x5f, 0x72, 0x65, 0x6e, 0x65, 0x67, 0x6f, 0x74, 0x69, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, - 0x03, 0x20, 0x01, 0x28, 0x08, 0x52, 0x12, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x52, 0x65, 0x6e, 0x65, - 0x67, 0x6f, 0x74, 0x69, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x46, 0x0a, 0x10, 0x6d, 0x61, 0x78, - 0x5f, 0x73, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x5f, 0x6b, 0x65, 0x79, 0x73, 0x18, 0x04, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, - 0x65, 0x52, 0x0e, 0x6d, 0x61, 0x78, 0x53, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x4b, 0x65, 0x79, - 0x73, 0x12, 0x4d, 0x0a, 0x15, 0x65, 0x6e, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x5f, 0x72, 0x73, 0x61, - 0x5f, 0x6b, 0x65, 0x79, 0x5f, 0x75, 0x73, 0x61, 0x67, 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x12, 0x65, 0x6e, - 0x66, 0x6f, 0x72, 0x63, 0x65, 0x52, 0x73, 0x61, 0x4b, 0x65, 0x79, 0x55, 0x73, 0x61, 0x67, 0x65, - 0x3a, 0x2b, 0x9a, 0xc5, 0x88, 0x1e, 0x26, 0x0a, 0x24, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, - 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x61, 0x75, 0x74, 0x68, 0x2e, 0x55, 0x70, 0x73, 0x74, 0x72, - 0x65, 0x61, 0x6d, 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x22, 0xce, 0x09, - 0x0a, 0x14, 0x44, 0x6f, 0x77, 0x6e, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x54, 0x6c, 0x73, 0x43, - 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x12, 0x69, 0x0a, 0x12, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, - 0x5f, 0x74, 0x6c, 0x73, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x18, 0x01, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x3b, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, - 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, - 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x43, - 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x52, - 0x10, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, - 0x74, 0x12, 0x58, 0x0a, 0x1a, 0x72, 0x65, 0x71, 0x75, 0x69, 0x72, 0x65, 0x5f, 0x63, 0x6c, 0x69, - 0x65, 0x6e, 0x74, 0x5f, 0x63, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, - 0x65, 0x52, 0x18, 0x72, 0x65, 0x71, 0x75, 0x69, 0x72, 0x65, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, - 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x12, 0x3b, 0x0a, 0x0b, 0x72, - 0x65, 0x71, 0x75, 0x69, 0x72, 0x65, 0x5f, 0x73, 0x6e, 0x69, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, + 0x28, 0xff, 0x01, 0x52, 0x03, 0x73, 0x6e, 0x69, 0x12, 0x22, 0x0a, 0x0d, 0x61, 0x75, 0x74, 0x6f, + 0x5f, 0x68, 0x6f, 0x73, 0x74, 0x5f, 0x73, 0x6e, 0x69, 0x18, 0x06, 0x20, 0x01, 0x28, 0x08, 0x52, + 0x0b, 0x61, 0x75, 0x74, 0x6f, 0x48, 0x6f, 0x73, 0x74, 0x53, 0x6e, 0x69, 0x12, 0x35, 0x0a, 0x17, + 0x61, 0x75, 0x74, 0x6f, 0x5f, 0x73, 0x6e, 0x69, 0x5f, 0x73, 0x61, 0x6e, 0x5f, 0x76, 0x61, 0x6c, + 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x07, 0x20, 0x01, 0x28, 0x08, 0x52, 0x14, 0x61, + 0x75, 0x74, 0x6f, 0x53, 0x6e, 0x69, 0x53, 0x61, 0x6e, 0x56, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x12, 0x2f, 0x0a, 0x13, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x5f, 0x72, 0x65, 0x6e, + 0x65, 0x67, 0x6f, 0x74, 0x69, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, + 0x52, 0x12, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x52, 0x65, 0x6e, 0x65, 0x67, 0x6f, 0x74, 0x69, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x46, 0x0a, 0x10, 0x6d, 0x61, 0x78, 0x5f, 0x73, 0x65, 0x73, 0x73, + 0x69, 0x6f, 0x6e, 0x5f, 0x6b, 0x65, 0x79, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, + 0x2e, 0x55, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x0e, 0x6d, 0x61, + 0x78, 0x53, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x4b, 0x65, 0x79, 0x73, 0x12, 0x4d, 0x0a, 0x15, + 0x65, 0x6e, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x5f, 0x72, 0x73, 0x61, 0x5f, 0x6b, 0x65, 0x79, 0x5f, + 0x75, 0x73, 0x61, 0x67, 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, + 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x12, 0x65, 0x6e, 0x66, 0x6f, 0x72, 0x63, 0x65, + 0x52, 0x73, 0x61, 0x4b, 0x65, 0x79, 0x55, 0x73, 0x61, 0x67, 0x65, 0x3a, 0x2b, 0x9a, 0xc5, 0x88, + 0x1e, 0x26, 0x0a, 0x24, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, + 0x2e, 0x61, 0x75, 0x74, 0x68, 0x2e, 0x55, 0x70, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x54, 0x6c, + 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x22, 0xce, 0x09, 0x0a, 0x14, 0x44, 0x6f, 0x77, + 0x6e, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, + 0x74, 0x12, 0x69, 0x0a, 0x12, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x5f, 0x74, 0x6c, 0x73, 0x5f, + 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x3b, 0x2e, + 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, + 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, + 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, + 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x52, 0x10, 0x63, 0x6f, 0x6d, 0x6d, + 0x6f, 0x6e, 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x12, 0x58, 0x0a, 0x1a, + 0x72, 0x65, 0x71, 0x75, 0x69, 0x72, 0x65, 0x5f, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x5f, 0x63, + 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x0a, 0x72, 0x65, - 0x71, 0x75, 0x69, 0x72, 0x65, 0x53, 0x6e, 0x69, 0x12, 0x71, 0x0a, 0x13, 0x73, 0x65, 0x73, 0x73, - 0x69, 0x6f, 0x6e, 0x5f, 0x74, 0x69, 0x63, 0x6b, 0x65, 0x74, 0x5f, 0x6b, 0x65, 0x79, 0x73, 0x18, - 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x3f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, - 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, - 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, - 0x33, 0x2e, 0x54, 0x6c, 0x73, 0x53, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x54, 0x69, 0x63, 0x6b, - 0x65, 0x74, 0x4b, 0x65, 0x79, 0x73, 0x48, 0x00, 0x52, 0x11, 0x73, 0x65, 0x73, 0x73, 0x69, 0x6f, - 0x6e, 0x54, 0x69, 0x63, 0x6b, 0x65, 0x74, 0x4b, 0x65, 0x79, 0x73, 0x12, 0x8d, 0x01, 0x0a, 0x25, - 0x73, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x5f, 0x74, 0x69, 0x63, 0x6b, 0x65, 0x74, 0x5f, 0x6b, - 0x65, 0x79, 0x73, 0x5f, 0x73, 0x64, 0x73, 0x5f, 0x73, 0x65, 0x63, 0x72, 0x65, 0x74, 0x5f, 0x63, - 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x3a, 0x2e, 0x65, 0x6e, - 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, - 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, - 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x64, 0x73, 0x53, 0x65, 0x63, 0x72, 0x65, - 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x48, 0x00, 0x52, 0x20, 0x73, 0x65, 0x73, 0x73, 0x69, - 0x6f, 0x6e, 0x54, 0x69, 0x63, 0x6b, 0x65, 0x74, 0x4b, 0x65, 0x79, 0x73, 0x53, 0x64, 0x73, 0x53, - 0x65, 0x63, 0x72, 0x65, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x51, 0x0a, 0x24, 0x64, - 0x69, 0x73, 0x61, 0x62, 0x6c, 0x65, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x65, 0x6c, 0x65, 0x73, 0x73, - 0x5f, 0x73, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x73, 0x75, 0x6d, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x18, 0x07, 0x20, 0x01, 0x28, 0x08, 0x48, 0x00, 0x52, 0x21, 0x64, 0x69, 0x73, - 0x61, 0x62, 0x6c, 0x65, 0x53, 0x74, 0x61, 0x74, 0x65, 0x6c, 0x65, 0x73, 0x73, 0x53, 0x65, 0x73, - 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x73, 0x75, 0x6d, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4d, - 0x0a, 0x23, 0x64, 0x69, 0x73, 0x61, 0x62, 0x6c, 0x65, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x65, 0x66, - 0x75, 0x6c, 0x5f, 0x73, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x73, 0x75, 0x6d, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x08, 0x52, 0x20, 0x64, 0x69, 0x73, - 0x61, 0x62, 0x6c, 0x65, 0x53, 0x74, 0x61, 0x74, 0x65, 0x66, 0x75, 0x6c, 0x53, 0x65, 0x73, 0x73, - 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x73, 0x75, 0x6d, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x54, 0x0a, - 0x0f, 0x73, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, - 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x42, 0x10, 0xfa, 0x42, 0x0d, 0xaa, 0x01, 0x0a, 0x1a, 0x06, 0x08, 0x80, 0x80, 0x80, 0x80, - 0x10, 0x32, 0x00, 0x52, 0x0e, 0x73, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x54, 0x69, 0x6d, 0x65, - 0x6f, 0x75, 0x74, 0x12, 0x88, 0x01, 0x0a, 0x12, 0x6f, 0x63, 0x73, 0x70, 0x5f, 0x73, 0x74, 0x61, - 0x70, 0x6c, 0x65, 0x5f, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0e, - 0x32, 0x50, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, + 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x18, 0x72, 0x65, + 0x71, 0x75, 0x69, 0x72, 0x65, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x43, 0x65, 0x72, 0x74, 0x69, + 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x12, 0x3b, 0x0a, 0x0b, 0x72, 0x65, 0x71, 0x75, 0x69, 0x72, + 0x65, 0x5f, 0x73, 0x6e, 0x69, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, + 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x0a, 0x72, 0x65, 0x71, 0x75, 0x69, 0x72, 0x65, + 0x53, 0x6e, 0x69, 0x12, 0x71, 0x0a, 0x13, 0x73, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x5f, 0x74, + 0x69, 0x63, 0x6b, 0x65, 0x74, 0x5f, 0x6b, 0x65, 0x79, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x3f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, - 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x44, 0x6f, 0x77, - 0x6e, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, - 0x74, 0x2e, 0x4f, 0x63, 0x73, 0x70, 0x53, 0x74, 0x61, 0x70, 0x6c, 0x65, 0x50, 0x6f, 0x6c, 0x69, - 0x63, 0x79, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x82, 0x01, 0x02, 0x10, 0x01, 0x52, 0x10, 0x6f, 0x63, - 0x73, 0x70, 0x53, 0x74, 0x61, 0x70, 0x6c, 0x65, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x5f, - 0x0a, 0x1f, 0x66, 0x75, 0x6c, 0x6c, 0x5f, 0x73, 0x63, 0x61, 0x6e, 0x5f, 0x63, 0x65, 0x72, 0x74, - 0x73, 0x5f, 0x6f, 0x6e, 0x5f, 0x73, 0x6e, 0x69, 0x5f, 0x6d, 0x69, 0x73, 0x6d, 0x61, 0x74, 0x63, - 0x68, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, - 0x6c, 0x75, 0x65, 0x52, 0x1a, 0x66, 0x75, 0x6c, 0x6c, 0x53, 0x63, 0x61, 0x6e, 0x43, 0x65, 0x72, - 0x74, 0x73, 0x4f, 0x6e, 0x53, 0x6e, 0x69, 0x4d, 0x69, 0x73, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x12, - 0x32, 0x0a, 0x15, 0x70, 0x72, 0x65, 0x66, 0x65, 0x72, 0x5f, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, - 0x5f, 0x63, 0x69, 0x70, 0x68, 0x65, 0x72, 0x73, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x08, 0x52, 0x13, - 0x70, 0x72, 0x65, 0x66, 0x65, 0x72, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x43, 0x69, 0x70, 0x68, - 0x65, 0x72, 0x73, 0x22, 0x4e, 0x0a, 0x10, 0x4f, 0x63, 0x73, 0x70, 0x53, 0x74, 0x61, 0x70, 0x6c, - 0x65, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x14, 0x0a, 0x10, 0x4c, 0x45, 0x4e, 0x49, 0x45, - 0x4e, 0x54, 0x5f, 0x53, 0x54, 0x41, 0x50, 0x4c, 0x49, 0x4e, 0x47, 0x10, 0x00, 0x12, 0x13, 0x0a, - 0x0f, 0x53, 0x54, 0x52, 0x49, 0x43, 0x54, 0x5f, 0x53, 0x54, 0x41, 0x50, 0x4c, 0x49, 0x4e, 0x47, - 0x10, 0x01, 0x12, 0x0f, 0x0a, 0x0b, 0x4d, 0x55, 0x53, 0x54, 0x5f, 0x53, 0x54, 0x41, 0x50, 0x4c, - 0x45, 0x10, 0x02, 0x3a, 0x2d, 0x9a, 0xc5, 0x88, 0x1e, 0x28, 0x0a, 0x26, 0x65, 0x6e, 0x76, 0x6f, - 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x61, 0x75, 0x74, 0x68, 0x2e, 0x44, 0x6f, - 0x77, 0x6e, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, - 0x78, 0x74, 0x42, 0x1a, 0x0a, 0x18, 0x73, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x5f, 0x74, 0x69, - 0x63, 0x6b, 0x65, 0x74, 0x5f, 0x6b, 0x65, 0x79, 0x73, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x22, 0xcc, - 0x01, 0x0a, 0x09, 0x54, 0x6c, 0x73, 0x4b, 0x65, 0x79, 0x4c, 0x6f, 0x67, 0x12, 0x1b, 0x0a, 0x04, - 0x70, 0x61, 0x74, 0x68, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, - 0x02, 0x10, 0x01, 0x52, 0x04, 0x70, 0x61, 0x74, 0x68, 0x12, 0x4f, 0x0a, 0x13, 0x6c, 0x6f, 0x63, - 0x61, 0x6c, 0x5f, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, - 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, - 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x69, - 0x64, 0x72, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x52, 0x11, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x41, 0x64, - 0x64, 0x72, 0x65, 0x73, 0x73, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x51, 0x0a, 0x14, 0x72, 0x65, - 0x6d, 0x6f, 0x74, 0x65, 0x5f, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x5f, 0x72, 0x61, 0x6e, - 0x67, 0x65, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, - 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, - 0x43, 0x69, 0x64, 0x72, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x52, 0x12, 0x72, 0x65, 0x6d, 0x6f, 0x74, - 0x65, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x22, 0xdd, 0x18, - 0x0a, 0x10, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, - 0x78, 0x74, 0x12, 0x57, 0x0a, 0x0a, 0x74, 0x6c, 0x73, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x73, - 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x38, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, + 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x6c, 0x73, + 0x53, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x54, 0x69, 0x63, 0x6b, 0x65, 0x74, 0x4b, 0x65, 0x79, + 0x73, 0x48, 0x00, 0x52, 0x11, 0x73, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x54, 0x69, 0x63, 0x6b, + 0x65, 0x74, 0x4b, 0x65, 0x79, 0x73, 0x12, 0x8d, 0x01, 0x0a, 0x25, 0x73, 0x65, 0x73, 0x73, 0x69, + 0x6f, 0x6e, 0x5f, 0x74, 0x69, 0x63, 0x6b, 0x65, 0x74, 0x5f, 0x6b, 0x65, 0x79, 0x73, 0x5f, 0x73, + 0x64, 0x73, 0x5f, 0x73, 0x65, 0x63, 0x72, 0x65, 0x74, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, + 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x3a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, - 0x76, 0x33, 0x2e, 0x54, 0x6c, 0x73, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x73, - 0x52, 0x09, 0x74, 0x6c, 0x73, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x12, 0x64, 0x0a, 0x10, 0x74, - 0x6c, 0x73, 0x5f, 0x63, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x73, 0x18, - 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x39, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, - 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, - 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, - 0x33, 0x2e, 0x54, 0x6c, 0x73, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, - 0x52, 0x0f, 0x74, 0x6c, 0x73, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, - 0x73, 0x12, 0x86, 0x01, 0x0a, 0x22, 0x74, 0x6c, 0x73, 0x5f, 0x63, 0x65, 0x72, 0x74, 0x69, 0x66, - 0x69, 0x63, 0x61, 0x74, 0x65, 0x5f, 0x73, 0x64, 0x73, 0x5f, 0x73, 0x65, 0x63, 0x72, 0x65, 0x74, - 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x73, 0x18, 0x06, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x3a, - 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, - 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, - 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x64, 0x73, 0x53, 0x65, - 0x63, 0x72, 0x65, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x1e, 0x74, 0x6c, 0x73, 0x43, - 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x53, 0x64, 0x73, 0x53, 0x65, 0x63, - 0x72, 0x65, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x73, 0x12, 0x97, 0x01, 0x0a, 0x21, 0x74, - 0x6c, 0x73, 0x5f, 0x63, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x5f, 0x70, - 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x5f, 0x69, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, - 0x18, 0x0e, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x4c, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, - 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, - 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, - 0x76, 0x33, 0x2e, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x50, 0x72, - 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x50, 0x6c, 0x75, 0x67, 0x69, 0x6e, 0x49, 0x6e, 0x73, 0x74, - 0x61, 0x6e, 0x63, 0x65, 0x52, 0x1e, 0x74, 0x6c, 0x73, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, - 0x63, 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x49, 0x6e, 0x73, 0x74, - 0x61, 0x6e, 0x63, 0x65, 0x12, 0x71, 0x0a, 0x1f, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x5f, 0x74, - 0x6c, 0x73, 0x5f, 0x63, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x5f, 0x73, - 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x18, 0x10, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, - 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, - 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x79, 0x70, 0x65, 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, - 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x1c, 0x63, 0x75, 0x73, 0x74, 0x6f, - 0x6d, 0x54, 0x6c, 0x73, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x53, - 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x12, 0xad, 0x01, 0x0a, 0x24, 0x74, 0x6c, 0x73, 0x5f, - 0x63, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x5f, 0x63, 0x65, 0x72, 0x74, - 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x5f, 0x70, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, - 0x18, 0x09, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x4f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, - 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, - 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, - 0x76, 0x33, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, - 0x65, 0x78, 0x74, 0x2e, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x50, - 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, - 0x2e, 0x30, 0x18, 0x01, 0x52, 0x21, 0x74, 0x6c, 0x73, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, - 0x63, 0x61, 0x74, 0x65, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x50, - 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x12, 0xc6, 0x01, 0x0a, 0x2d, 0x74, 0x6c, 0x73, 0x5f, - 0x63, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x5f, 0x63, 0x65, 0x72, 0x74, - 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x5f, 0x70, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, - 0x5f, 0x69, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x57, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, - 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, - 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, - 0x6f, 0x6e, 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x2e, 0x43, 0x65, 0x72, - 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, - 0x49, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, - 0x33, 0x2e, 0x30, 0x18, 0x01, 0x52, 0x29, 0x74, 0x6c, 0x73, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, - 0x69, 0x63, 0x61, 0x74, 0x65, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, - 0x50, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x49, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, - 0x12, 0x78, 0x0a, 0x12, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, - 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x47, 0x2e, 0x65, - 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, - 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, - 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, - 0x63, 0x61, 0x74, 0x65, 0x56, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, - 0x6e, 0x74, 0x65, 0x78, 0x74, 0x48, 0x00, 0x52, 0x11, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x12, 0x8c, 0x01, 0x0a, 0x24, 0x76, - 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x78, - 0x74, 0x5f, 0x73, 0x64, 0x73, 0x5f, 0x73, 0x65, 0x63, 0x72, 0x65, 0x74, 0x5f, 0x63, 0x6f, 0x6e, - 0x66, 0x69, 0x67, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x3a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, + 0x76, 0x33, 0x2e, 0x53, 0x64, 0x73, 0x53, 0x65, 0x63, 0x72, 0x65, 0x74, 0x43, 0x6f, 0x6e, 0x66, + 0x69, 0x67, 0x48, 0x00, 0x52, 0x20, 0x73, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x54, 0x69, 0x63, + 0x6b, 0x65, 0x74, 0x4b, 0x65, 0x79, 0x73, 0x53, 0x64, 0x73, 0x53, 0x65, 0x63, 0x72, 0x65, 0x74, + 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x51, 0x0a, 0x24, 0x64, 0x69, 0x73, 0x61, 0x62, 0x6c, + 0x65, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x65, 0x6c, 0x65, 0x73, 0x73, 0x5f, 0x73, 0x65, 0x73, 0x73, + 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x73, 0x75, 0x6d, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x07, + 0x20, 0x01, 0x28, 0x08, 0x48, 0x00, 0x52, 0x21, 0x64, 0x69, 0x73, 0x61, 0x62, 0x6c, 0x65, 0x53, + 0x74, 0x61, 0x74, 0x65, 0x6c, 0x65, 0x73, 0x73, 0x53, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x52, + 0x65, 0x73, 0x75, 0x6d, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4d, 0x0a, 0x23, 0x64, 0x69, 0x73, + 0x61, 0x62, 0x6c, 0x65, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x65, 0x66, 0x75, 0x6c, 0x5f, 0x73, 0x65, + 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x73, 0x75, 0x6d, 0x70, 0x74, 0x69, 0x6f, 0x6e, + 0x18, 0x0a, 0x20, 0x01, 0x28, 0x08, 0x52, 0x20, 0x64, 0x69, 0x73, 0x61, 0x62, 0x6c, 0x65, 0x53, + 0x74, 0x61, 0x74, 0x65, 0x66, 0x75, 0x6c, 0x53, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x65, + 0x73, 0x75, 0x6d, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x54, 0x0a, 0x0f, 0x73, 0x65, 0x73, 0x73, + 0x69, 0x6f, 0x6e, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x18, 0x06, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x10, 0xfa, 0x42, + 0x0d, 0xaa, 0x01, 0x0a, 0x1a, 0x06, 0x08, 0x80, 0x80, 0x80, 0x80, 0x10, 0x32, 0x00, 0x52, 0x0e, + 0x73, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x54, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x12, 0x88, + 0x01, 0x0a, 0x12, 0x6f, 0x63, 0x73, 0x70, 0x5f, 0x73, 0x74, 0x61, 0x70, 0x6c, 0x65, 0x5f, 0x70, + 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x50, 0x2e, 0x65, 0x6e, + 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, + 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, + 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x44, 0x6f, 0x77, 0x6e, 0x73, 0x74, 0x72, 0x65, + 0x61, 0x6d, 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x2e, 0x4f, 0x63, 0x73, + 0x70, 0x53, 0x74, 0x61, 0x70, 0x6c, 0x65, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x42, 0x08, 0xfa, + 0x42, 0x05, 0x82, 0x01, 0x02, 0x10, 0x01, 0x52, 0x10, 0x6f, 0x63, 0x73, 0x70, 0x53, 0x74, 0x61, + 0x70, 0x6c, 0x65, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x12, 0x5f, 0x0a, 0x1f, 0x66, 0x75, 0x6c, + 0x6c, 0x5f, 0x73, 0x63, 0x61, 0x6e, 0x5f, 0x63, 0x65, 0x72, 0x74, 0x73, 0x5f, 0x6f, 0x6e, 0x5f, + 0x73, 0x6e, 0x69, 0x5f, 0x6d, 0x69, 0x73, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x18, 0x09, 0x20, 0x01, + 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, + 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, 0x1a, + 0x66, 0x75, 0x6c, 0x6c, 0x53, 0x63, 0x61, 0x6e, 0x43, 0x65, 0x72, 0x74, 0x73, 0x4f, 0x6e, 0x53, + 0x6e, 0x69, 0x4d, 0x69, 0x73, 0x6d, 0x61, 0x74, 0x63, 0x68, 0x12, 0x32, 0x0a, 0x15, 0x70, 0x72, + 0x65, 0x66, 0x65, 0x72, 0x5f, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x5f, 0x63, 0x69, 0x70, 0x68, + 0x65, 0x72, 0x73, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x08, 0x52, 0x13, 0x70, 0x72, 0x65, 0x66, 0x65, + 0x72, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x43, 0x69, 0x70, 0x68, 0x65, 0x72, 0x73, 0x22, 0x4e, + 0x0a, 0x10, 0x4f, 0x63, 0x73, 0x70, 0x53, 0x74, 0x61, 0x70, 0x6c, 0x65, 0x50, 0x6f, 0x6c, 0x69, + 0x63, 0x79, 0x12, 0x14, 0x0a, 0x10, 0x4c, 0x45, 0x4e, 0x49, 0x45, 0x4e, 0x54, 0x5f, 0x53, 0x54, + 0x41, 0x50, 0x4c, 0x49, 0x4e, 0x47, 0x10, 0x00, 0x12, 0x13, 0x0a, 0x0f, 0x53, 0x54, 0x52, 0x49, + 0x43, 0x54, 0x5f, 0x53, 0x54, 0x41, 0x50, 0x4c, 0x49, 0x4e, 0x47, 0x10, 0x01, 0x12, 0x0f, 0x0a, + 0x0b, 0x4d, 0x55, 0x53, 0x54, 0x5f, 0x53, 0x54, 0x41, 0x50, 0x4c, 0x45, 0x10, 0x02, 0x3a, 0x2d, + 0x9a, 0xc5, 0x88, 0x1e, 0x28, 0x0a, 0x26, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, + 0x2e, 0x76, 0x32, 0x2e, 0x61, 0x75, 0x74, 0x68, 0x2e, 0x44, 0x6f, 0x77, 0x6e, 0x73, 0x74, 0x72, + 0x65, 0x61, 0x6d, 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x42, 0x1a, 0x0a, + 0x18, 0x73, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x5f, 0x74, 0x69, 0x63, 0x6b, 0x65, 0x74, 0x5f, + 0x6b, 0x65, 0x79, 0x73, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x22, 0xcc, 0x01, 0x0a, 0x09, 0x54, 0x6c, + 0x73, 0x4b, 0x65, 0x79, 0x4c, 0x6f, 0x67, 0x12, 0x1b, 0x0a, 0x04, 0x70, 0x61, 0x74, 0x68, 0x18, + 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x04, + 0x70, 0x61, 0x74, 0x68, 0x12, 0x4f, 0x0a, 0x13, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x5f, 0x61, 0x64, + 0x64, 0x72, 0x65, 0x73, 0x73, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x18, 0x02, 0x20, 0x03, 0x28, + 0x0b, 0x32, 0x1f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, + 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x69, 0x64, 0x72, 0x52, 0x61, 0x6e, + 0x67, 0x65, 0x52, 0x11, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, + 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x51, 0x0a, 0x14, 0x72, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x5f, + 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x18, 0x03, 0x20, + 0x03, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, + 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x69, 0x64, 0x72, 0x52, + 0x61, 0x6e, 0x67, 0x65, 0x52, 0x12, 0x72, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x41, 0x64, 0x64, 0x72, + 0x65, 0x73, 0x73, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x22, 0xdd, 0x18, 0x0a, 0x10, 0x43, 0x6f, 0x6d, + 0x6d, 0x6f, 0x6e, 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x12, 0x57, 0x0a, + 0x0a, 0x74, 0x6c, 0x73, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x38, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, + 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, + 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x6c, + 0x73, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x73, 0x52, 0x09, 0x74, 0x6c, 0x73, + 0x50, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x12, 0x64, 0x0a, 0x10, 0x74, 0x6c, 0x73, 0x5f, 0x63, 0x65, + 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, + 0x32, 0x39, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, + 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, + 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x6c, 0x73, + 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x52, 0x0f, 0x74, 0x6c, 0x73, + 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x73, 0x12, 0x86, 0x01, 0x0a, + 0x22, 0x74, 0x6c, 0x73, 0x5f, 0x63, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, + 0x5f, 0x73, 0x64, 0x73, 0x5f, 0x73, 0x65, 0x63, 0x72, 0x65, 0x74, 0x5f, 0x63, 0x6f, 0x6e, 0x66, + 0x69, 0x67, 0x73, 0x18, 0x06, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x3a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x64, 0x73, 0x53, 0x65, 0x63, 0x72, 0x65, 0x74, 0x43, - 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x48, 0x00, 0x52, 0x20, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x53, 0x64, 0x73, 0x53, 0x65, 0x63, - 0x72, 0x65, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0xa2, 0x01, 0x0a, 0x1b, 0x63, 0x6f, - 0x6d, 0x62, 0x69, 0x6e, 0x65, 0x64, 0x5f, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x60, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, - 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, - 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, - 0x6f, 0x6e, 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x2e, 0x43, 0x6f, 0x6d, - 0x62, 0x69, 0x6e, 0x65, 0x64, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, - 0x56, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, - 0x74, 0x48, 0x00, 0x52, 0x19, 0x63, 0x6f, 0x6d, 0x62, 0x69, 0x6e, 0x65, 0x64, 0x56, 0x61, 0x6c, - 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x12, 0xb5, - 0x01, 0x0a, 0x27, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x6f, - 0x6e, 0x74, 0x65, 0x78, 0x74, 0x5f, 0x63, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, - 0x65, 0x5f, 0x70, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x4f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, - 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, - 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6f, 0x6d, - 0x6d, 0x6f, 0x6e, 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x2e, 0x43, 0x65, - 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, - 0x72, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x48, 0x00, - 0x52, 0x24, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x74, - 0x65, 0x78, 0x74, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x50, 0x72, - 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x12, 0xce, 0x01, 0x0a, 0x30, 0x76, 0x61, 0x6c, 0x69, 0x64, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x5f, 0x63, 0x65, + 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x1e, 0x74, 0x6c, 0x73, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, + 0x69, 0x63, 0x61, 0x74, 0x65, 0x53, 0x64, 0x73, 0x53, 0x65, 0x63, 0x72, 0x65, 0x74, 0x43, 0x6f, + 0x6e, 0x66, 0x69, 0x67, 0x73, 0x12, 0x97, 0x01, 0x0a, 0x21, 0x74, 0x6c, 0x73, 0x5f, 0x63, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x5f, 0x70, 0x72, 0x6f, 0x76, 0x69, 0x64, - 0x65, 0x72, 0x5f, 0x69, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x18, 0x0c, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x57, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, + 0x65, 0x72, 0x5f, 0x69, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x18, 0x0e, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x4c, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, + 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, + 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x65, + 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, + 0x72, 0x50, 0x6c, 0x75, 0x67, 0x69, 0x6e, 0x49, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x52, + 0x1e, 0x74, 0x6c, 0x73, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x50, + 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x49, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x12, + 0x71, 0x0a, 0x1f, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x5f, 0x74, 0x6c, 0x73, 0x5f, 0x63, 0x65, + 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x5f, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, + 0x6f, 0x72, 0x18, 0x10, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, + 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, + 0x54, 0x79, 0x70, 0x65, 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x43, 0x6f, + 0x6e, 0x66, 0x69, 0x67, 0x52, 0x1c, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x54, 0x6c, 0x73, 0x43, + 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x53, 0x65, 0x6c, 0x65, 0x63, 0x74, + 0x6f, 0x72, 0x12, 0xad, 0x01, 0x0a, 0x24, 0x74, 0x6c, 0x73, 0x5f, 0x63, 0x65, 0x72, 0x74, 0x69, + 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x5f, 0x63, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, + 0x74, 0x65, 0x5f, 0x70, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x18, 0x09, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x4f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x2e, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, 0x76, 0x69, 0x64, - 0x65, 0x72, 0x49, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, - 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x48, 0x00, 0x52, 0x2c, 0x76, 0x61, 0x6c, 0x69, 0x64, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x43, 0x65, 0x72, 0x74, - 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x49, - 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x12, 0x25, 0x0a, 0x0e, 0x61, 0x6c, 0x70, 0x6e, 0x5f, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x73, 0x18, 0x04, 0x20, 0x03, 0x28, 0x09, 0x52, - 0x0d, 0x61, 0x6c, 0x70, 0x6e, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x73, 0x12, 0x57, - 0x0a, 0x11, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x5f, 0x68, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, - 0x6b, 0x65, 0x72, 0x18, 0x0d, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, - 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, - 0x2e, 0x54, 0x79, 0x70, 0x65, 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x43, - 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x52, 0x10, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x48, 0x61, 0x6e, - 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x72, 0x12, 0x4d, 0x0a, 0x07, 0x6b, 0x65, 0x79, 0x5f, 0x6c, - 0x6f, 0x67, 0x18, 0x0f, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x34, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, - 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, - 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, - 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x6c, 0x73, 0x4b, 0x65, 0x79, 0x4c, 0x6f, 0x67, 0x52, 0x06, - 0x6b, 0x65, 0x79, 0x4c, 0x6f, 0x67, 0x1a, 0x92, 0x01, 0x0a, 0x13, 0x43, 0x65, 0x72, 0x74, 0x69, - 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x12, 0x1b, - 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, - 0x04, 0x72, 0x02, 0x10, 0x01, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x4f, 0x0a, 0x0c, 0x74, - 0x79, 0x70, 0x65, 0x64, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x2a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x79, 0x70, 0x65, 0x64, 0x45, 0x78, - 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x48, 0x00, 0x52, - 0x0b, 0x74, 0x79, 0x70, 0x65, 0x64, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x42, 0x0d, 0x0a, 0x06, - 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0x03, 0xf8, 0x42, 0x01, 0x1a, 0x6d, 0x0a, 0x1b, 0x43, + 0x65, 0x72, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x52, + 0x21, 0x74, 0x6c, 0x73, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, 0x76, 0x69, 0x64, - 0x65, 0x72, 0x49, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x12, 0x23, 0x0a, 0x0d, 0x69, 0x6e, - 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x0c, 0x69, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x4e, 0x61, 0x6d, 0x65, 0x12, - 0x29, 0x0a, 0x10, 0x63, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x5f, 0x6e, - 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0f, 0x63, 0x65, 0x72, 0x74, 0x69, - 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x4e, 0x61, 0x6d, 0x65, 0x1a, 0xa4, 0x06, 0x0a, 0x24, 0x43, - 0x6f, 0x6d, 0x62, 0x69, 0x6e, 0x65, 0x64, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, - 0x74, 0x65, 0x56, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x74, - 0x65, 0x78, 0x74, 0x12, 0x8f, 0x01, 0x0a, 0x1a, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, - 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x65, - 0x78, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x47, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, - 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, - 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, - 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, - 0x56, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, - 0x74, 0x42, 0x08, 0xfa, 0x42, 0x05, 0x8a, 0x01, 0x02, 0x10, 0x01, 0x52, 0x18, 0x64, 0x65, 0x66, - 0x61, 0x75, 0x6c, 0x74, 0x56, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, - 0x6e, 0x74, 0x65, 0x78, 0x74, 0x12, 0x94, 0x01, 0x0a, 0x24, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, + 0x65, 0x72, 0x12, 0xc6, 0x01, 0x0a, 0x2d, 0x74, 0x6c, 0x73, 0x5f, 0x63, 0x65, 0x72, 0x74, 0x69, + 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x5f, 0x63, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, + 0x74, 0x65, 0x5f, 0x70, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x5f, 0x69, 0x6e, 0x73, 0x74, + 0x61, 0x6e, 0x63, 0x65, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x57, 0x2e, 0x65, 0x6e, 0x76, + 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, + 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, + 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x54, 0x6c, 0x73, + 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x2e, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, + 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x49, 0x6e, 0x73, 0x74, 0x61, + 0x6e, 0x63, 0x65, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, + 0x52, 0x29, 0x74, 0x6c, 0x73, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, + 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, 0x76, 0x69, + 0x64, 0x65, 0x72, 0x49, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x12, 0x78, 0x0a, 0x12, 0x76, + 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x78, + 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x47, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, + 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, + 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, + 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x56, + 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, + 0x48, 0x00, 0x52, 0x11, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, + 0x6e, 0x74, 0x65, 0x78, 0x74, 0x12, 0x8c, 0x01, 0x0a, 0x24, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x5f, 0x73, 0x64, 0x73, - 0x5f, 0x73, 0x65, 0x63, 0x72, 0x65, 0x74, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x02, + 0x5f, 0x73, 0x65, 0x63, 0x72, 0x65, 0x74, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x3a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x64, 0x73, 0x53, 0x65, 0x63, 0x72, 0x65, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, - 0x42, 0x08, 0xfa, 0x42, 0x05, 0x8a, 0x01, 0x02, 0x10, 0x01, 0x52, 0x20, 0x76, 0x61, 0x6c, 0x69, - 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x53, 0x64, 0x73, - 0x53, 0x65, 0x63, 0x72, 0x65, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0xb3, 0x01, 0x0a, - 0x27, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x6f, 0x6e, 0x74, - 0x65, 0x78, 0x74, 0x5f, 0x63, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x5f, - 0x70, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x4f, - 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, - 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, - 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, - 0x6e, 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x2e, 0x43, 0x65, 0x72, 0x74, - 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x42, - 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x52, 0x24, 0x76, 0x61, - 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x43, - 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, 0x76, 0x69, 0x64, - 0x65, 0x72, 0x12, 0xcc, 0x01, 0x0a, 0x30, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x5f, 0x63, 0x65, 0x72, 0x74, 0x69, 0x66, - 0x69, 0x63, 0x61, 0x74, 0x65, 0x5f, 0x70, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x5f, 0x69, - 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x57, 0x2e, - 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, - 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, - 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, - 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x2e, 0x43, 0x65, 0x72, 0x74, 0x69, - 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x49, 0x6e, - 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, - 0x30, 0x18, 0x01, 0x52, 0x2c, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, - 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, + 0x48, 0x00, 0x52, 0x20, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, + 0x6e, 0x74, 0x65, 0x78, 0x74, 0x53, 0x64, 0x73, 0x53, 0x65, 0x63, 0x72, 0x65, 0x74, 0x43, 0x6f, + 0x6e, 0x66, 0x69, 0x67, 0x12, 0xa2, 0x01, 0x0a, 0x1b, 0x63, 0x6f, 0x6d, 0x62, 0x69, 0x6e, 0x65, + 0x64, 0x5f, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x6f, 0x6e, + 0x74, 0x65, 0x78, 0x74, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x60, 0x2e, 0x65, 0x6e, 0x76, + 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, + 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, + 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x54, 0x6c, 0x73, + 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x2e, 0x43, 0x6f, 0x6d, 0x62, 0x69, 0x6e, 0x65, 0x64, + 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x56, 0x61, 0x6c, 0x69, 0x64, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x48, 0x00, 0x52, 0x19, + 0x63, 0x6f, 0x6d, 0x62, 0x69, 0x6e, 0x65, 0x64, 0x56, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x12, 0xb5, 0x01, 0x0a, 0x27, 0x76, 0x61, + 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, + 0x5f, 0x63, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x5f, 0x70, 0x72, 0x6f, + 0x76, 0x69, 0x64, 0x65, 0x72, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x4f, 0x2e, 0x65, 0x6e, + 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, + 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, + 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x54, 0x6c, + 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x2e, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, + 0x63, 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x42, 0x0b, 0x92, 0xc7, + 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x48, 0x00, 0x52, 0x24, 0x76, 0x61, 0x6c, + 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x43, 0x65, + 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, + 0x72, 0x12, 0xce, 0x01, 0x0a, 0x30, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x5f, 0x63, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, + 0x63, 0x61, 0x74, 0x65, 0x5f, 0x70, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x5f, 0x69, 0x6e, + 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x57, 0x2e, 0x65, + 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, + 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, + 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x54, + 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x2e, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, + 0x69, 0x63, 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x49, 0x6e, 0x73, + 0x74, 0x61, 0x6e, 0x63, 0x65, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, + 0x18, 0x01, 0x48, 0x00, 0x52, 0x2c, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, + 0x74, 0x65, 0x50, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x49, 0x6e, 0x73, 0x74, 0x61, 0x6e, + 0x63, 0x65, 0x12, 0x25, 0x0a, 0x0e, 0x61, 0x6c, 0x70, 0x6e, 0x5f, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x63, 0x6f, 0x6c, 0x73, 0x18, 0x04, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0d, 0x61, 0x6c, 0x70, 0x6e, + 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x73, 0x12, 0x57, 0x0a, 0x11, 0x63, 0x75, 0x73, + 0x74, 0x6f, 0x6d, 0x5f, 0x68, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x72, 0x18, 0x0d, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, + 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x79, 0x70, 0x65, + 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, + 0x52, 0x10, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, + 0x65, 0x72, 0x12, 0x4d, 0x0a, 0x07, 0x6b, 0x65, 0x79, 0x5f, 0x6c, 0x6f, 0x67, 0x18, 0x0f, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x34, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, + 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, + 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, + 0x54, 0x6c, 0x73, 0x4b, 0x65, 0x79, 0x4c, 0x6f, 0x67, 0x52, 0x06, 0x6b, 0x65, 0x79, 0x4c, 0x6f, + 0x67, 0x1a, 0x92, 0x01, 0x0a, 0x13, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, + 0x65, 0x50, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x12, 0x1b, 0x0a, 0x04, 0x6e, 0x61, 0x6d, + 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x07, 0xfa, 0x42, 0x04, 0x72, 0x02, 0x10, 0x01, + 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x4f, 0x0a, 0x0c, 0x74, 0x79, 0x70, 0x65, 0x64, 0x5f, + 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2a, 0x2e, 0x65, + 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x2e, 0x63, 0x6f, 0x72, 0x65, + 0x2e, 0x76, 0x33, 0x2e, 0x54, 0x79, 0x70, 0x65, 0x64, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, + 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x48, 0x00, 0x52, 0x0b, 0x74, 0x79, 0x70, 0x65, + 0x64, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x42, 0x0d, 0x0a, 0x06, 0x63, 0x6f, 0x6e, 0x66, 0x69, + 0x67, 0x12, 0x03, 0xf8, 0x42, 0x01, 0x1a, 0x6d, 0x0a, 0x1b, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, + 0x69, 0x63, 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x49, 0x6e, 0x73, + 0x74, 0x61, 0x6e, 0x63, 0x65, 0x12, 0x23, 0x0a, 0x0d, 0x69, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x63, + 0x65, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x69, 0x6e, + 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x29, 0x0a, 0x10, 0x63, 0x65, + 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, + 0x20, 0x01, 0x28, 0x09, 0x52, 0x0f, 0x63, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, + 0x65, 0x4e, 0x61, 0x6d, 0x65, 0x1a, 0xa4, 0x06, 0x0a, 0x24, 0x43, 0x6f, 0x6d, 0x62, 0x69, 0x6e, + 0x65, 0x64, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x56, 0x61, 0x6c, + 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x12, 0x8f, + 0x01, 0x0a, 0x1a, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x69, 0x64, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x18, 0x01, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x47, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, + 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, + 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, + 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x56, 0x61, 0x6c, 0x69, 0x64, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x42, 0x08, 0xfa, 0x42, + 0x05, 0x8a, 0x01, 0x02, 0x10, 0x01, 0x52, 0x18, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x56, + 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, + 0x12, 0x94, 0x01, 0x0a, 0x24, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, + 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x5f, 0x73, 0x64, 0x73, 0x5f, 0x73, 0x65, 0x63, 0x72, + 0x65, 0x74, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x3a, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, + 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, + 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x53, 0x64, 0x73, 0x53, + 0x65, 0x63, 0x72, 0x65, 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x42, 0x08, 0xfa, 0x42, 0x05, + 0x8a, 0x01, 0x02, 0x10, 0x01, 0x52, 0x20, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x53, 0x64, 0x73, 0x53, 0x65, 0x63, 0x72, 0x65, + 0x74, 0x43, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x12, 0xb3, 0x01, 0x0a, 0x27, 0x76, 0x61, 0x6c, 0x69, + 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x5f, 0x63, + 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x5f, 0x70, 0x72, 0x6f, 0x76, 0x69, + 0x64, 0x65, 0x72, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x4f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, + 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, + 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, + 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x54, 0x6c, 0x73, 0x43, + 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x2e, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, + 0x74, 0x65, 0x50, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, + 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x52, 0x24, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, + 0x69, 0x63, 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x12, 0xcc, 0x01, + 0x0a, 0x30, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x6f, 0x6e, + 0x74, 0x65, 0x78, 0x74, 0x5f, 0x63, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, + 0x5f, 0x70, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x5f, 0x69, 0x6e, 0x73, 0x74, 0x61, 0x6e, + 0x63, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x57, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, + 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, + 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, + 0x73, 0x2e, 0x76, 0x33, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x54, 0x6c, 0x73, 0x43, 0x6f, + 0x6e, 0x74, 0x65, 0x78, 0x74, 0x2e, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x49, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x63, - 0x65, 0x3a, 0x4e, 0x9a, 0xc5, 0x88, 0x1e, 0x49, 0x0a, 0x47, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, - 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x61, 0x75, 0x74, 0x68, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, - 0x6f, 0x6e, 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x2e, 0x43, 0x6f, 0x6d, - 0x62, 0x69, 0x6e, 0x65, 0x64, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, - 0x56, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, - 0x74, 0x3a, 0x29, 0x9a, 0xc5, 0x88, 0x1e, 0x24, 0x0a, 0x22, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, - 0x61, 0x70, 0x69, 0x2e, 0x76, 0x32, 0x2e, 0x61, 0x75, 0x74, 0x68, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, - 0x6f, 0x6e, 0x54, 0x6c, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x42, 0x19, 0x0a, 0x17, - 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x65, - 0x78, 0x74, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x4a, 0x04, 0x08, 0x05, 0x10, 0x06, 0x42, 0xa5, 0x01, - 0xba, 0x80, 0xc8, 0xd1, 0x06, 0x02, 0x10, 0x02, 0x0a, 0x37, 0x69, 0x6f, 0x2e, 0x65, 0x6e, 0x76, - 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, - 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, - 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, - 0x33, 0x42, 0x08, 0x54, 0x6c, 0x73, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x56, 0x67, - 0x69, 0x74, 0x68, 0x75, 0x62, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, - 0x72, 0x6f, 0x78, 0x79, 0x2f, 0x67, 0x6f, 0x2d, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x2d, - 0x70, 0x6c, 0x61, 0x6e, 0x65, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x65, 0x78, 0x74, 0x65, - 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2f, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, - 0x5f, 0x73, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2f, 0x74, 0x6c, 0x73, 0x2f, 0x76, 0x33, 0x3b, - 0x74, 0x6c, 0x73, 0x76, 0x33, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x65, 0x42, 0x0b, 0x92, 0xc7, 0x86, 0xd8, 0x04, 0x03, 0x33, 0x2e, 0x30, 0x18, 0x01, 0x52, 0x2c, + 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, + 0x74, 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x50, 0x72, 0x6f, 0x76, + 0x69, 0x64, 0x65, 0x72, 0x49, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x3a, 0x4e, 0x9a, 0xc5, + 0x88, 0x1e, 0x49, 0x0a, 0x47, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, + 0x32, 0x2e, 0x61, 0x75, 0x74, 0x68, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x54, 0x6c, 0x73, + 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x2e, 0x43, 0x6f, 0x6d, 0x62, 0x69, 0x6e, 0x65, 0x64, + 0x43, 0x65, 0x72, 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x56, 0x61, 0x6c, 0x69, 0x64, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x3a, 0x29, 0x9a, 0xc5, + 0x88, 0x1e, 0x24, 0x0a, 0x22, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x76, + 0x32, 0x2e, 0x61, 0x75, 0x74, 0x68, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x54, 0x6c, 0x73, + 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x42, 0x19, 0x0a, 0x17, 0x76, 0x61, 0x6c, 0x69, 0x64, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x5f, 0x74, 0x79, + 0x70, 0x65, 0x4a, 0x04, 0x08, 0x05, 0x10, 0x06, 0x42, 0xa5, 0x01, 0xba, 0x80, 0xc8, 0xd1, 0x06, + 0x02, 0x10, 0x02, 0x0a, 0x37, 0x69, 0x6f, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, + 0x78, 0x79, 0x2e, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, + 0x6f, 0x6e, 0x73, 0x2e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, + 0x63, 0x6b, 0x65, 0x74, 0x73, 0x2e, 0x74, 0x6c, 0x73, 0x2e, 0x76, 0x33, 0x42, 0x08, 0x54, 0x6c, + 0x73, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x56, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, + 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x70, 0x72, 0x6f, 0x78, 0x79, 0x2f, + 0x67, 0x6f, 0x2d, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x2d, 0x70, 0x6c, 0x61, 0x6e, 0x65, + 0x2f, 0x65, 0x6e, 0x76, 0x6f, 0x79, 0x2f, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, + 0x73, 0x2f, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x6f, 0x63, 0x6b, + 0x65, 0x74, 0x73, 0x2f, 0x74, 0x6c, 0x73, 0x2f, 0x76, 0x33, 0x3b, 0x74, 0x6c, 0x73, 0x76, 0x33, + 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/tls.pb.validate.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/tls.pb.validate.go index 6468ff227c3c8..1c9c85d6cacb5 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/tls.pb.validate.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/tls.pb.validate.go @@ -98,6 +98,10 @@ func (m *UpstreamTlsContext) validate(all bool) error { errors = append(errors, err) } + // no validation rules for AutoHostSni + + // no validation rules for AutoSniSanValidation + // no validation rules for AllowRenegotiation if all { diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/tls_spiffe_validator_config.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/tls_spiffe_validator_config.pb.go index 7e9ee89672ea2..8f120346b8e3c 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/tls_spiffe_validator_config.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/tls_spiffe_validator_config.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/extensions/transport_sockets/tls/v3/tls_spiffe_validator_config.proto package tlsv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/tls_vtproto.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/tls_vtproto.pb.go index 287129049b4d5..66ae6ecf8cc66 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/tls_vtproto.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/extensions/transport_sockets/tls/v3/tls_vtproto.pb.go @@ -51,6 +51,26 @@ func (m *UpstreamTlsContext) MarshalToSizedBufferVTStrict(dAtA []byte) (int, err i -= len(m.unknownFields) copy(dAtA[i:], m.unknownFields) } + if m.AutoSniSanValidation { + i-- + if m.AutoSniSanValidation { + dAtA[i] = 1 + } else { + dAtA[i] = 0 + } + i-- + dAtA[i] = 0x38 + } + if m.AutoHostSni { + i-- + if m.AutoHostSni { + dAtA[i] = 1 + } else { + dAtA[i] = 0 + } + i-- + dAtA[i] = 0x30 + } if m.EnforceRsaKeyUsage != nil { size, err := (*wrapperspb.BoolValue)(m.EnforceRsaKeyUsage).MarshalToSizedBufferVTStrict(dAtA[:i]) if err != nil { @@ -920,6 +940,12 @@ func (m *UpstreamTlsContext) SizeVT() (n int) { l = (*wrapperspb.BoolValue)(m.EnforceRsaKeyUsage).SizeVT() n += 1 + l + protohelpers.SizeOfVarint(uint64(l)) } + if m.AutoHostSni { + n += 2 + } + if m.AutoSniSanValidation { + n += 2 + } n += len(m.unknownFields) return n } diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/service/discovery/v3/ads.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/service/discovery/v3/ads.pb.go index 6f09930e96889..c550492bca2c3 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/service/discovery/v3/ads.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/service/discovery/v3/ads.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/service/discovery/v3/ads.proto package discoveryv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/service/discovery/v3/ads_grpc.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/service/discovery/v3/ads_grpc.pb.go index 7a7f1af970ab6..c1ac198a66096 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/service/discovery/v3/ads_grpc.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/service/discovery/v3/ads_grpc.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go-grpc. DO NOT EDIT. // versions: // - protoc-gen-go-grpc v1.3.0 -// - protoc v5.26.1 +// - protoc v5.29.1 // source: envoy/service/discovery/v3/ads.proto package discoveryv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/service/discovery/v3/discovery.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/service/discovery/v3/discovery.pb.go index a9b5f69358985..8d1f5147fb8f5 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/service/discovery/v3/discovery.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/service/discovery/v3/discovery.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/service/discovery/v3/discovery.proto package discoveryv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/service/load_stats/v3/lrs.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/service/load_stats/v3/lrs.pb.go index 6b47a93c6b001..96d1e14d03e57 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/service/load_stats/v3/lrs.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/service/load_stats/v3/lrs.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/service/load_stats/v3/lrs.proto package load_statsv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/service/load_stats/v3/lrs_grpc.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/service/load_stats/v3/lrs_grpc.pb.go index 4eb34c17332b7..77ae40373e4b2 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/service/load_stats/v3/lrs_grpc.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/service/load_stats/v3/lrs_grpc.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go-grpc. DO NOT EDIT. // versions: // - protoc-gen-go-grpc v1.3.0 -// - protoc v5.26.1 +// - protoc v5.29.1 // source: envoy/service/load_stats/v3/lrs.proto package load_statsv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/service/status/v3/csds.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/service/status/v3/csds.pb.go index 4635ca02842c3..a1360147355ef 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/service/status/v3/csds.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/service/status/v3/csds.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/service/status/v3/csds.proto package statusv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/service/status/v3/csds_grpc.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/service/status/v3/csds_grpc.pb.go index abe9abebdfadf..4c3cd0fcd7a4f 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/service/status/v3/csds_grpc.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/service/status/v3/csds_grpc.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go-grpc. DO NOT EDIT. // versions: // - protoc-gen-go-grpc v1.3.0 -// - protoc v5.26.1 +// - protoc v5.29.1 // source: envoy/service/status/v3/csds.proto package statusv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/http/v3/cookie.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/http/v3/cookie.pb.go index 8afb4e8d127fd..9f39238f138de 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/http/v3/cookie.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/http/v3/cookie.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/http/v3/cookie.proto package httpv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/http/v3/path_transformation.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/http/v3/path_transformation.pb.go index dda21b56bd0bd..96c1792781739 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/http/v3/path_transformation.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/http/v3/path_transformation.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/http/v3/path_transformation.proto package httpv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/filter_state.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/filter_state.pb.go index db3bd5994f742..94416015ce973 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/filter_state.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/filter_state.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/matcher/v3/filter_state.proto package matcherv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/http_inputs.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/http_inputs.pb.go index a2f9c73adc4bb..d5c62c8f7798e 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/http_inputs.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/http_inputs.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/matcher/v3/http_inputs.proto package matcherv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/metadata.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/metadata.pb.go index 14a093334b62d..294a9aa819896 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/metadata.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/metadata.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/matcher/v3/metadata.proto package matcherv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/node.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/node.pb.go index d6083cb277318..bed86c2decd22 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/node.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/node.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/matcher/v3/node.proto package matcherv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/number.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/number.pb.go index 2ad4bccfad0ea..48be6889a7852 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/number.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/number.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/matcher/v3/number.proto package matcherv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/path.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/path.pb.go index aac680dbe13d8..b61cc8a64ae8d 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/path.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/path.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/matcher/v3/path.proto package matcherv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/regex.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/regex.pb.go index 383bb267c39d9..5f8b0fd0137fa 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/regex.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/regex.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/matcher/v3/regex.proto package matcherv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/status_code_input.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/status_code_input.pb.go index 3da1aae4ebc3b..87fc85bf79695 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/status_code_input.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/status_code_input.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/matcher/v3/status_code_input.proto package matcherv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/string.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/string.pb.go index 2ebed90845d0e..3a6ee4dc4b0ae 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/string.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/string.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/matcher/v3/string.proto package matcherv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/struct.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/struct.pb.go index ef844bc7f8415..6946825142b93 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/struct.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/struct.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/matcher/v3/struct.proto package matcherv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/value.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/value.pb.go index 7ba125cf30828..525db41572672 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/value.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3/value.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/matcher/v3/value.proto package matcherv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/metadata/v3/metadata.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/metadata/v3/metadata.pb.go index 7a6ac07a53313..ff173cf102475 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/metadata/v3/metadata.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/metadata/v3/metadata.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/metadata/v3/metadata.proto package metadatav3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/tracing/v3/custom_tag.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/tracing/v3/custom_tag.pb.go index 388e4749e2192..0b9b6cd9398c0 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/tracing/v3/custom_tag.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/tracing/v3/custom_tag.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/tracing/v3/custom_tag.proto package tracingv3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/hash_policy.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/hash_policy.pb.go index af620911fdec8..c38b6f2c16443 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/hash_policy.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/hash_policy.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/v3/hash_policy.proto package typev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/http.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/http.pb.go index 74f4e24dfe041..d5caf17b6369b 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/http.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/http.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/v3/http.proto package typev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/http_status.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/http_status.pb.go index f7e952b3a1359..42e48e3fae687 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/http_status.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/http_status.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/v3/http_status.proto package typev3 @@ -29,62 +29,118 @@ type StatusCode int32 const ( // Empty - This code not part of the HTTP status code specification, but it is needed for proto // `enum` type. - StatusCode_Empty StatusCode = 0 - StatusCode_Continue StatusCode = 100 - StatusCode_OK StatusCode = 200 - StatusCode_Created StatusCode = 201 - StatusCode_Accepted StatusCode = 202 - StatusCode_NonAuthoritativeInformation StatusCode = 203 - StatusCode_NoContent StatusCode = 204 - StatusCode_ResetContent StatusCode = 205 - StatusCode_PartialContent StatusCode = 206 - StatusCode_MultiStatus StatusCode = 207 - StatusCode_AlreadyReported StatusCode = 208 - StatusCode_IMUsed StatusCode = 226 - StatusCode_MultipleChoices StatusCode = 300 - StatusCode_MovedPermanently StatusCode = 301 - StatusCode_Found StatusCode = 302 - StatusCode_SeeOther StatusCode = 303 - StatusCode_NotModified StatusCode = 304 - StatusCode_UseProxy StatusCode = 305 - StatusCode_TemporaryRedirect StatusCode = 307 - StatusCode_PermanentRedirect StatusCode = 308 - StatusCode_BadRequest StatusCode = 400 - StatusCode_Unauthorized StatusCode = 401 - StatusCode_PaymentRequired StatusCode = 402 - StatusCode_Forbidden StatusCode = 403 - StatusCode_NotFound StatusCode = 404 - StatusCode_MethodNotAllowed StatusCode = 405 - StatusCode_NotAcceptable StatusCode = 406 - StatusCode_ProxyAuthenticationRequired StatusCode = 407 - StatusCode_RequestTimeout StatusCode = 408 - StatusCode_Conflict StatusCode = 409 - StatusCode_Gone StatusCode = 410 - StatusCode_LengthRequired StatusCode = 411 - StatusCode_PreconditionFailed StatusCode = 412 - StatusCode_PayloadTooLarge StatusCode = 413 - StatusCode_URITooLong StatusCode = 414 - StatusCode_UnsupportedMediaType StatusCode = 415 - StatusCode_RangeNotSatisfiable StatusCode = 416 - StatusCode_ExpectationFailed StatusCode = 417 - StatusCode_MisdirectedRequest StatusCode = 421 - StatusCode_UnprocessableEntity StatusCode = 422 - StatusCode_Locked StatusCode = 423 - StatusCode_FailedDependency StatusCode = 424 - StatusCode_UpgradeRequired StatusCode = 426 - StatusCode_PreconditionRequired StatusCode = 428 - StatusCode_TooManyRequests StatusCode = 429 - StatusCode_RequestHeaderFieldsTooLarge StatusCode = 431 - StatusCode_InternalServerError StatusCode = 500 - StatusCode_NotImplemented StatusCode = 501 - StatusCode_BadGateway StatusCode = 502 - StatusCode_ServiceUnavailable StatusCode = 503 - StatusCode_GatewayTimeout StatusCode = 504 - StatusCode_HTTPVersionNotSupported StatusCode = 505 - StatusCode_VariantAlsoNegotiates StatusCode = 506 - StatusCode_InsufficientStorage StatusCode = 507 - StatusCode_LoopDetected StatusCode = 508 - StatusCode_NotExtended StatusCode = 510 + StatusCode_Empty StatusCode = 0 + // Continue - “100“ status code. + StatusCode_Continue StatusCode = 100 + // OK - “200“ status code. + StatusCode_OK StatusCode = 200 + // Created - “201“ status code. + StatusCode_Created StatusCode = 201 + // Accepted - “202“ status code. + StatusCode_Accepted StatusCode = 202 + // NonAuthoritativeInformation - “203“ status code. + StatusCode_NonAuthoritativeInformation StatusCode = 203 + // NoContent - “204“ status code. + StatusCode_NoContent StatusCode = 204 + // ResetContent - “205“ status code. + StatusCode_ResetContent StatusCode = 205 + // PartialContent - “206“ status code. + StatusCode_PartialContent StatusCode = 206 + // MultiStatus - “207“ status code. + StatusCode_MultiStatus StatusCode = 207 + // AlreadyReported - “208“ status code. + StatusCode_AlreadyReported StatusCode = 208 + // IMUsed - “226“ status code. + StatusCode_IMUsed StatusCode = 226 + // MultipleChoices - “300“ status code. + StatusCode_MultipleChoices StatusCode = 300 + // MovedPermanently - “301“ status code. + StatusCode_MovedPermanently StatusCode = 301 + // Found - “302“ status code. + StatusCode_Found StatusCode = 302 + // SeeOther - “303“ status code. + StatusCode_SeeOther StatusCode = 303 + // NotModified - “304“ status code. + StatusCode_NotModified StatusCode = 304 + // UseProxy - “305“ status code. + StatusCode_UseProxy StatusCode = 305 + // TemporaryRedirect - “307“ status code. + StatusCode_TemporaryRedirect StatusCode = 307 + // PermanentRedirect - “308“ status code. + StatusCode_PermanentRedirect StatusCode = 308 + // BadRequest - “400“ status code. + StatusCode_BadRequest StatusCode = 400 + // Unauthorized - “401“ status code. + StatusCode_Unauthorized StatusCode = 401 + // PaymentRequired - “402“ status code. + StatusCode_PaymentRequired StatusCode = 402 + // Forbidden - “403“ status code. + StatusCode_Forbidden StatusCode = 403 + // NotFound - “404“ status code. + StatusCode_NotFound StatusCode = 404 + // MethodNotAllowed - “405“ status code. + StatusCode_MethodNotAllowed StatusCode = 405 + // NotAcceptable - “406“ status code. + StatusCode_NotAcceptable StatusCode = 406 + // ProxyAuthenticationRequired - “407“ status code. + StatusCode_ProxyAuthenticationRequired StatusCode = 407 + // RequestTimeout - “408“ status code. + StatusCode_RequestTimeout StatusCode = 408 + // Conflict - “409“ status code. + StatusCode_Conflict StatusCode = 409 + // Gone - “410“ status code. + StatusCode_Gone StatusCode = 410 + // LengthRequired - “411“ status code. + StatusCode_LengthRequired StatusCode = 411 + // PreconditionFailed - “412“ status code. + StatusCode_PreconditionFailed StatusCode = 412 + // PayloadTooLarge - “413“ status code. + StatusCode_PayloadTooLarge StatusCode = 413 + // URITooLong - “414“ status code. + StatusCode_URITooLong StatusCode = 414 + // UnsupportedMediaType - “415“ status code. + StatusCode_UnsupportedMediaType StatusCode = 415 + // RangeNotSatisfiable - “416“ status code. + StatusCode_RangeNotSatisfiable StatusCode = 416 + // ExpectationFailed - “417“ status code. + StatusCode_ExpectationFailed StatusCode = 417 + // MisdirectedRequest - “421“ status code. + StatusCode_MisdirectedRequest StatusCode = 421 + // UnprocessableEntity - “422“ status code. + StatusCode_UnprocessableEntity StatusCode = 422 + // Locked - “423“ status code. + StatusCode_Locked StatusCode = 423 + // FailedDependency - “424“ status code. + StatusCode_FailedDependency StatusCode = 424 + // UpgradeRequired - “426“ status code. + StatusCode_UpgradeRequired StatusCode = 426 + // PreconditionRequired - “428“ status code. + StatusCode_PreconditionRequired StatusCode = 428 + // TooManyRequests - “429“ status code. + StatusCode_TooManyRequests StatusCode = 429 + // RequestHeaderFieldsTooLarge - “431“ status code. + StatusCode_RequestHeaderFieldsTooLarge StatusCode = 431 + // InternalServerError - “500“ status code. + StatusCode_InternalServerError StatusCode = 500 + // NotImplemented - “501“ status code. + StatusCode_NotImplemented StatusCode = 501 + // BadGateway - “502“ status code. + StatusCode_BadGateway StatusCode = 502 + // ServiceUnavailable - “503“ status code. + StatusCode_ServiceUnavailable StatusCode = 503 + // GatewayTimeout - “504“ status code. + StatusCode_GatewayTimeout StatusCode = 504 + // HTTPVersionNotSupported - “505“ status code. + StatusCode_HTTPVersionNotSupported StatusCode = 505 + // VariantAlsoNegotiates - “506“ status code. + StatusCode_VariantAlsoNegotiates StatusCode = 506 + // InsufficientStorage - “507“ status code. + StatusCode_InsufficientStorage StatusCode = 507 + // LoopDetected - “508“ status code. + StatusCode_LoopDetected StatusCode = 508 + // NotExtended - “510“ status code. + StatusCode_NotExtended StatusCode = 510 + // NetworkAuthenticationRequired - “511“ status code. StatusCode_NetworkAuthenticationRequired StatusCode = 511 ) diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/percent.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/percent.pb.go index 45eb66186d077..674f41c7f7ab9 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/percent.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/percent.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/v3/percent.proto package typev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/range.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/range.pb.go index 63be48f3c76be..d424f036157a6 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/range.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/range.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/v3/range.proto package typev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/ratelimit_strategy.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/ratelimit_strategy.pb.go index e7663f294fcaa..9762302cc63f7 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/ratelimit_strategy.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/ratelimit_strategy.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/v3/ratelimit_strategy.proto package typev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/ratelimit_unit.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/ratelimit_unit.pb.go index 3686888888a72..29f655d34cb60 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/ratelimit_unit.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/ratelimit_unit.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/v3/ratelimit_unit.proto package typev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/semantic_version.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/semantic_version.pb.go index 630e6567c4190..0ac0a4065567b 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/semantic_version.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/semantic_version.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/v3/semantic_version.proto package typev3 diff --git a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/token_bucket.pb.go b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/token_bucket.pb.go index 9c21f2454106f..aa62b0a4a4f31 100644 --- a/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/token_bucket.pb.go +++ b/vendor/github.com/envoyproxy/go-control-plane/envoy/type/v3/token_bucket.pb.go @@ -1,7 +1,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.30.0 -// protoc v5.26.1 +// protoc v5.29.1 // source: envoy/type/v3/token_bucket.proto package typev3 diff --git a/vendor/github.com/fsouza/fake-gcs-server/fakestorage/bucket.go b/vendor/github.com/fsouza/fake-gcs-server/fakestorage/bucket.go index 4026f1a4a0deb..93c67e537e798 100644 --- a/vendor/github.com/fsouza/fake-gcs-server/fakestorage/bucket.go +++ b/vendor/github.com/fsouza/fake-gcs-server/fakestorage/bucket.go @@ -16,7 +16,8 @@ import ( "github.com/gorilla/mux" ) -var bucketRegexp = regexp.MustCompile(`^[a-zA-Z0-9][a-zA-Z0-9._-]*[a-zA-Z0-9]$`) +// https://cloud.google.com/storage/docs/buckets#naming +var bucketRegexp = regexp.MustCompile(`^[a-z0-9][a-z0-9._-]*[a-z0-9]$`) // CreateBucket creates a bucket inside the server, so any API calls that // require the bucket name will recognize this bucket. diff --git a/vendor/github.com/fsouza/fake-gcs-server/fakestorage/object.go b/vendor/github.com/fsouza/fake-gcs-server/fakestorage/object.go index b229a452331e6..441c4ceaced6a 100644 --- a/vendor/github.com/fsouza/fake-gcs-server/fakestorage/object.go +++ b/vendor/github.com/fsouza/fake-gcs-server/fakestorage/object.go @@ -32,9 +32,11 @@ type ObjectAttrs struct { BucketName string Name string Size int64 + StorageClass string ContentType string ContentEncoding string ContentDisposition string + ContentLanguage string CacheControl string // Crc32c checksum of Content. calculated by server when it's upload methods are used. Crc32c string @@ -59,9 +61,11 @@ type jsonObject struct { BucketName string `json:"bucket"` Name string `json:"name"` Size int64 `json:"size,string"` + StorageClass string `json:"storageClass"` ContentType string `json:"contentType"` ContentEncoding string `json:"contentEncoding"` ContentDisposition string `json:"contentDisposition"` + ContentLanguage string `json:"contentLanguage"` Crc32c string `json:"crc32c,omitempty"` Md5Hash string `json:"md5Hash,omitempty"` Etag string `json:"etag,omitempty"` @@ -79,9 +83,11 @@ func (o ObjectAttrs) MarshalJSON() ([]byte, error) { temp := jsonObject{ BucketName: o.BucketName, Name: o.Name, + StorageClass: o.StorageClass, ContentType: o.ContentType, ContentEncoding: o.ContentEncoding, ContentDisposition: o.ContentDisposition, + ContentLanguage: o.ContentLanguage, Size: o.Size, Crc32c: o.Crc32c, Md5Hash: o.Md5Hash, @@ -108,9 +114,11 @@ func (o *ObjectAttrs) UnmarshalJSON(data []byte) error { } o.BucketName = temp.BucketName o.Name = temp.Name + o.StorageClass = temp.StorageClass o.ContentType = temp.ContentType o.ContentEncoding = temp.ContentEncoding o.ContentDisposition = temp.ContentDisposition + o.ContentLanguage = temp.ContentLanguage o.Size = temp.Size o.Crc32c = temp.Crc32c o.Md5Hash = temp.Md5Hash @@ -315,6 +323,7 @@ type ListOptions struct { StartOffset string EndOffset string IncludeTrailingDelimiter bool + MaxResults int } // ListObjects returns a sorted list of objects that match the given criteria, @@ -365,6 +374,9 @@ func (s *Server) ListObjectsWithOptions(bucketName string, options ListOptions) respPrefixes = append(respPrefixes, p) } sort.Strings(respPrefixes) + if options.MaxResults != 0 && len(respObjects) > options.MaxResults { + respObjects = respObjects[:options.MaxResults] + } return respObjects, respPrefixes, nil } @@ -394,9 +406,11 @@ func toBackendObjects(objects []StreamingObject) []backend.StreamingObject { ObjectAttrs: backend.ObjectAttrs{ BucketName: o.BucketName, Name: o.Name, + StorageClass: o.StorageClass, ContentType: o.ContentType, ContentEncoding: o.ContentEncoding, ContentDisposition: o.ContentDisposition, + ContentLanguage: o.ContentLanguage, CacheControl: o.CacheControl, ACL: o.ACL, Created: getCurrentIfZero(o.Created).Format(timestampFormat), @@ -420,9 +434,11 @@ func bufferedObjectsToBackendObjects(objects []Object) []backend.StreamingObject ObjectAttrs: backend.ObjectAttrs{ BucketName: o.BucketName, Name: o.Name, + StorageClass: o.StorageClass, ContentType: o.ContentType, ContentEncoding: o.ContentEncoding, ContentDisposition: o.ContentDisposition, + ContentLanguage: o.ContentLanguage, ACL: o.ACL, Created: getCurrentIfZero(o.Created).Format(timestampFormat), Deleted: o.Deleted.Format(timestampFormat), @@ -449,9 +465,11 @@ func fromBackendObjects(objects []backend.StreamingObject) []StreamingObject { BucketName: o.BucketName, Name: o.Name, Size: o.Size, + StorageClass: o.StorageClass, ContentType: o.ContentType, ContentEncoding: o.ContentEncoding, ContentDisposition: o.ContentDisposition, + ContentLanguage: o.ContentLanguage, CacheControl: o.CacheControl, Crc32c: o.Crc32c, Md5Hash: o.Md5Hash, @@ -477,9 +495,11 @@ func fromBackendObjectsAttrs(objectAttrs []backend.ObjectAttrs) []ObjectAttrs { BucketName: o.BucketName, Name: o.Name, Size: o.Size, + StorageClass: o.StorageClass, ContentType: o.ContentType, ContentEncoding: o.ContentEncoding, ContentDisposition: o.ContentDisposition, + ContentLanguage: o.ContentLanguage, CacheControl: o.CacheControl, Crc32c: o.Crc32c, Md5Hash: o.Md5Hash, @@ -557,6 +577,14 @@ func (s *Server) objectWithGenerationOnValidGeneration(bucketName, objectName, g func (s *Server) listObjects(r *http.Request) jsonResponse { bucketName := unescapeMuxVars(mux.Vars(r))["bucketName"] + var maxResults int + var err error + if maxResultsStr := r.URL.Query().Get("maxResults"); maxResultsStr != "" { + maxResults, err = strconv.Atoi(maxResultsStr) + if err != nil { + return jsonResponse{status: http.StatusBadRequest} + } + } objs, prefixes, err := s.ListObjectsWithOptions(bucketName, ListOptions{ Prefix: r.URL.Query().Get("prefix"), Delimiter: r.URL.Query().Get("delimiter"), @@ -564,6 +592,7 @@ func (s *Server) listObjects(r *http.Request) jsonResponse { StartOffset: r.URL.Query().Get("startOffset"), EndOffset: r.URL.Query().Get("endOffset"), IncludeTrailingDelimiter: r.URL.Query().Get("includeTrailingDelimiter") == "true", + MaxResults: maxResults, }) if err != nil { return jsonResponse{status: http.StatusNotFound} @@ -710,6 +739,59 @@ func (s *Server) listObjectACL(r *http.Request) jsonResponse { return jsonResponse{data: newACLListResponse(obj.ObjectAttrs)} } +func (s *Server) deleteObjectACL(r *http.Request) jsonResponse { + vars := unescapeMuxVars(mux.Vars(r)) + + obj, err := s.GetObjectStreaming(vars["bucketName"], vars["objectName"]) + if err != nil { + return jsonResponse{status: http.StatusNotFound} + } + defer obj.Close() + entity := vars["entity"] + + var newAcls []storage.ACLRule + for _, aclRule := range obj.ObjectAttrs.ACL { + if entity != string(aclRule.Entity) { + newAcls = append(newAcls, aclRule) + } + } + + obj.ACL = newAcls + obj, err = s.createObject(obj, backend.NoConditions{}) + if err != nil { + return errToJsonResponse(err) + } + defer obj.Close() + + return jsonResponse{status: http.StatusOK} +} + +func (s *Server) getObjectACL(r *http.Request) jsonResponse { + vars := unescapeMuxVars(mux.Vars(r)) + + obj, err := s.backend.GetObject(vars["bucketName"], vars["objectName"]) + if err != nil { + return jsonResponse{status: http.StatusNotFound} + } + defer obj.Close() + entity := vars["entity"] + + for _, aclRule := range obj.ObjectAttrs.ACL { + if entity == string(aclRule.Entity) { + oac := &objectAccessControl{ + Bucket: obj.BucketName, + Entity: string(aclRule.Entity), + Object: obj.Name, + Role: string(aclRule.Role), + Etag: "RVRhZw==", + Kind: "storage#objectAccessControl", + } + return jsonResponse{data: oac} + } + } + return jsonResponse{status: http.StatusNotFound} +} + func (s *Server) setObjectACL(r *http.Request) jsonResponse { vars := unescapeMuxVars(mux.Vars(r)) @@ -783,6 +865,9 @@ func (s *Server) rewriteObject(r *http.Request) jsonResponse { if metadata.ContentDisposition == "" { metadata.ContentDisposition = obj.ContentDisposition } + if metadata.ContentLanguage == "" { + metadata.ContentLanguage = obj.ContentLanguage + } dstBucket := vars["destinationBucket"] newObject := StreamingObject{ @@ -793,6 +878,7 @@ func (s *Server) rewriteObject(r *http.Request) jsonResponse { ContentType: metadata.ContentType, ContentEncoding: metadata.ContentEncoding, ContentDisposition: metadata.ContentDisposition, + ContentLanguage: metadata.ContentLanguage, Metadata: metadata.Metadata, }, Content: obj.Content, @@ -912,6 +998,9 @@ func (s *Server) downloadObject(w http.ResponseWriter, r *http.Request) { if obj.ContentDisposition != "" { w.Header().Set("Content-Disposition", obj.ContentDisposition) } + if obj.ContentLanguage != "" { + w.Header().Set("Content-Language", obj.ContentLanguage) + } // X-Goog-Stored-Content-Encoding must be set to the original encoding, // defaulting to "identity" if no encoding was set. storedContentEncoding := "identity" @@ -943,7 +1032,7 @@ func (s *Server) handleRange(obj StreamingObject, r *http.Request) (ranged bool, // Length: 40, Range: bytes=50- case start >= obj.Size: // This IS a ranged request, but it ISN'T satisfiable. - return true, 0, 0, false + return true, 0, -1, false // Negative range, ignore range and return all content. // Examples: // Length: 40, Range: bytes=30-20 @@ -1037,6 +1126,7 @@ func (s *Server) patchObject(r *http.Request) jsonResponse { ContentType string ContentEncoding string ContentDisposition string + ContentLanguage string Metadata map[string]string `json:"metadata"` CustomTime string Acl []acls @@ -1054,6 +1144,7 @@ func (s *Server) patchObject(r *http.Request) jsonResponse { attrsToUpdate.ContentType = payload.ContentType attrsToUpdate.ContentEncoding = payload.ContentEncoding attrsToUpdate.ContentDisposition = payload.ContentDisposition + attrsToUpdate.ContentLanguage = payload.ContentLanguage attrsToUpdate.Metadata = payload.Metadata attrsToUpdate.CustomTime = payload.CustomTime @@ -1092,6 +1183,7 @@ func (s *Server) updateObject(r *http.Request) jsonResponse { Metadata map[string]string `json:"metadata"` ContentType string `json:"contentType"` ContentDisposition string `json:"contentDisposition"` + ContentLanguage string `json:"contentLanguage"` CustomTime string Acl []acls } @@ -1109,6 +1201,7 @@ func (s *Server) updateObject(r *http.Request) jsonResponse { attrsToUpdate.CustomTime = payload.CustomTime attrsToUpdate.ContentType = payload.ContentType attrsToUpdate.ContentDisposition = payload.ContentDisposition + attrsToUpdate.ContentLanguage = payload.ContentLanguage if len(payload.Acl) > 0 { attrsToUpdate.ACL = []storage.ACLRule{} for _, aclData := range payload.Acl { @@ -1142,6 +1235,7 @@ func (s *Server) composeObject(r *http.Request) jsonResponse { Bucket string ContentType string ContentDisposition string + ContentLanguage string Metadata map[string]string } } diff --git a/vendor/github.com/fsouza/fake-gcs-server/fakestorage/response.go b/vendor/github.com/fsouza/fake-gcs-server/fakestorage/response.go index f40dcd3fe9dd7..8957af37fa5ac 100644 --- a/vendor/github.com/fsouza/fake-gcs-server/fakestorage/response.go +++ b/vendor/github.com/fsouza/fake-gcs-server/fakestorage/response.go @@ -119,6 +119,7 @@ type objectResponse struct { ContentType string `json:"contentType,omitempty"` ContentEncoding string `json:"contentEncoding,omitempty"` ContentDisposition string `json:"contentDisposition,omitempty"` + ContentLanguage string `json:"contentLanguage,omitempty"` Crc32c string `json:"crc32c,omitempty"` ACL []*objectAccessControl `json:"acl,omitempty"` Md5Hash string `json:"md5Hash,omitempty"` @@ -146,6 +147,10 @@ func newProjectedObjectResponse(obj ObjectAttrs, externalURL string, projection func newObjectResponse(obj ObjectAttrs, externalURL string) objectResponse { acl := getAccessControlsListFromObject(obj) + storageClass := obj.StorageClass + if storageClass == "" { + storageClass = "STANDARD" + } return objectResponse{ Kind: "storage#object", @@ -156,11 +161,12 @@ func newObjectResponse(obj ObjectAttrs, externalURL string) objectResponse { ContentType: obj.ContentType, ContentEncoding: obj.ContentEncoding, ContentDisposition: obj.ContentDisposition, + ContentLanguage: obj.ContentLanguage, Crc32c: obj.Crc32c, Md5Hash: obj.Md5Hash, Etag: obj.Etag, ACL: acl, - StorageClass: "STANDARD", + StorageClass: storageClass, Metadata: obj.Metadata, TimeCreated: formatTime(obj.Created), TimeDeleted: formatTime(obj.Deleted), diff --git a/vendor/github.com/fsouza/fake-gcs-server/fakestorage/server.go b/vendor/github.com/fsouza/fake-gcs-server/fakestorage/server.go index 4283ccf030dc0..230eb847fc43a 100644 --- a/vendor/github.com/fsouza/fake-gcs-server/fakestorage/server.go +++ b/vendor/github.com/fsouza/fake-gcs-server/fakestorage/server.go @@ -267,12 +267,16 @@ func (s *Server) buildMuxer() { r.Path("/b/").Methods(http.MethodPost).HandlerFunc(jsonToHTTPHandler(s.createBucketByPost)) r.Path("/b/{bucketName}").Methods(http.MethodGet).HandlerFunc(jsonToHTTPHandler(s.getBucket)) r.Path("/b/{bucketName}").Methods(http.MethodPatch).HandlerFunc(jsonToHTTPHandler(s.updateBucket)) + r.Path("/b/{bucketName}").Methods(http.MethodPost).Headers("X-HTTP-Method-Override", "PATCH").HandlerFunc(jsonToHTTPHandler(s.updateBucket)) r.Path("/b/{bucketName}").Methods(http.MethodDelete).HandlerFunc(jsonToHTTPHandler(s.deleteBucket)) r.Path("/b/{bucketName}/o").Methods(http.MethodGet).HandlerFunc(jsonToHTTPHandler(s.listObjects)) r.Path("/b/{bucketName}/o/").Methods(http.MethodGet).HandlerFunc(jsonToHTTPHandler(s.listObjects)) r.Path("/b/{bucketName}/o/{objectName:.+}").Methods(http.MethodPatch).HandlerFunc(jsonToHTTPHandler(s.patchObject)) + r.Path("/b/{bucketName}/o/{objectName:.+}").Methods(http.MethodPost).Headers("X-HTTP-Method-Override", "PATCH").HandlerFunc(jsonToHTTPHandler(s.patchObject)) r.Path("/b/{bucketName}/o/{objectName:.+}/acl").Methods(http.MethodGet).HandlerFunc(jsonToHTTPHandler(s.listObjectACL)) r.Path("/b/{bucketName}/o/{objectName:.+}/acl").Methods(http.MethodPost).HandlerFunc(jsonToHTTPHandler(s.setObjectACL)) + r.Path("/b/{bucketName}/o/{objectName:.+}/acl/{entity}").Methods(http.MethodDelete).HandlerFunc(jsonToHTTPHandler(s.deleteObjectACL)) + r.Path("/b/{bucketName}/o/{objectName:.+}/acl/{entity}").Methods(http.MethodGet).HandlerFunc(jsonToHTTPHandler(s.getObjectACL)) r.Path("/b/{bucketName}/o/{objectName:.+}/acl/{entity}").Methods(http.MethodPut).HandlerFunc(jsonToHTTPHandler(s.setObjectACL)) r.Path("/b/{bucketName}/o/{objectName:.+}").Methods(http.MethodGet, http.MethodHead).HandlerFunc(s.getObject) r.Path("/b/{bucketName}/o/{objectName:.+}").Methods(http.MethodDelete).HandlerFunc(jsonToHTTPHandler(s.deleteObject)) @@ -304,6 +308,8 @@ func (s *Server) buildMuxer() { handler.Path("/upload/storage/v1/b/{bucketName}/o/").Methods(http.MethodPost).HandlerFunc(jsonToHTTPHandler(s.insertObject)) handler.Path("/upload/storage/v1/b/{bucketName}/o").Methods(http.MethodPut).HandlerFunc(jsonToHTTPHandler(s.uploadFileContent)) handler.Path("/upload/storage/v1/b/{bucketName}/o/").Methods(http.MethodPut).HandlerFunc(jsonToHTTPHandler(s.uploadFileContent)) + handler.Path("/upload/storage/v1/b/{bucketName}/o").Methods(http.MethodDelete).HandlerFunc(jsonToHTTPHandler(s.deleteResumableUpload)) + handler.Path("/upload/storage/v1/b/{bucketName}/o/").Methods(http.MethodDelete).HandlerFunc(jsonToHTTPHandler(s.deleteResumableUpload)) handler.Path("/upload/resumable/{uploadId}").Methods(http.MethodPut, http.MethodPost).HandlerFunc(jsonToHTTPHandler(s.uploadFileContent)) // Batch endpoint diff --git a/vendor/github.com/fsouza/fake-gcs-server/fakestorage/upload.go b/vendor/github.com/fsouza/fake-gcs-server/fakestorage/upload.go index e9181df46f47a..1438068f98c33 100644 --- a/vendor/github.com/fsouza/fake-gcs-server/fakestorage/upload.go +++ b/vendor/github.com/fsouza/fake-gcs-server/fakestorage/upload.go @@ -54,9 +54,11 @@ type multipartMetadata struct { ContentType string `json:"contentType"` ContentEncoding string `json:"contentEncoding"` ContentDisposition string `json:"contentDisposition"` + ContentLanguage string `json:"ContentLanguage"` CacheControl string `json:"cacheControl"` CustomTime time.Time `json:"customTime,omitempty"` Name string `json:"name"` + StorageClass string `json:"storageClass"` Metadata map[string]string `json:"metadata"` } @@ -378,10 +380,12 @@ func (s *Server) multipartUpload(bucketName string, r *http.Request) jsonRespons ObjectAttrs: ObjectAttrs{ BucketName: bucketName, Name: objName, + StorageClass: metadata.StorageClass, ContentType: contentType, CacheControl: metadata.CacheControl, ContentEncoding: metadata.ContentEncoding, ContentDisposition: metadata.ContentDisposition, + ContentLanguage: metadata.ContentLanguage, CustomTime: metadata.CustomTime, ACL: getObjectACL(predefinedACL), Metadata: metadata.Metadata, @@ -630,6 +634,10 @@ func parseContentRange(r string) (parsed contentRange, err error) { return parsed, nil } +func (s *Server) deleteResumableUpload(r *http.Request) jsonResponse { + return jsonResponse{status: 499} +} + func loadMetadata(rc io.ReadCloser) (*multipartMetadata, error) { defer rc.Close() var m multipartMetadata diff --git a/vendor/github.com/fsouza/fake-gcs-server/internal/backend/fs.go b/vendor/github.com/fsouza/fake-gcs-server/internal/backend/fs.go index c96867d802df6..b372ab84021ca 100644 --- a/vendor/github.com/fsouza/fake-gcs-server/internal/backend/fs.go +++ b/vendor/github.com/fsouza/fake-gcs-server/internal/backend/fs.go @@ -448,12 +448,14 @@ func (s *storageFS) ComposeObject(bucketName string, objectNames []string, desti sourceObjects = append(sourceObjects, obj) } + now := time.Now().Format(timestampFormat) dest := StreamingObject{ ObjectAttrs: ObjectAttrs{ BucketName: bucketName, Name: destinationName, ContentType: contentType, - Created: time.Now().String(), + Created: now, + Updated: now, }, } diff --git a/vendor/github.com/fsouza/fake-gcs-server/internal/backend/memory.go b/vendor/github.com/fsouza/fake-gcs-server/internal/backend/memory.go index c32f06abf2cd4..2e95eb3ed5fa5 100644 --- a/vendor/github.com/fsouza/fake-gcs-server/internal/backend/memory.go +++ b/vendor/github.com/fsouza/fake-gcs-server/internal/backend/memory.go @@ -361,12 +361,14 @@ func (s *storageMemory) ComposeObject(bucketName string, objectNames []string, d var dest Object streamingDest, err := s.GetObject(bucketName, destinationName) if err != nil { + now := time.Now().Format(timestampFormat) dest = Object{ ObjectAttrs: ObjectAttrs{ BucketName: bucketName, Name: destinationName, ContentType: contentType, - Created: time.Now().String(), + Created: now, + Updated: now, }, } } else { diff --git a/vendor/github.com/fsouza/fake-gcs-server/internal/backend/object.go b/vendor/github.com/fsouza/fake-gcs-server/internal/backend/object.go index 63bf8d6d147c3..aa2379c4e8dc7 100644 --- a/vendor/github.com/fsouza/fake-gcs-server/internal/backend/object.go +++ b/vendor/github.com/fsouza/fake-gcs-server/internal/backend/object.go @@ -18,9 +18,11 @@ type ObjectAttrs struct { BucketName string `json:"-"` Name string `json:"-"` Size int64 `json:"-"` + StorageClass string ContentType string ContentEncoding string ContentDisposition string + ContentLanguage string CacheControl string Crc32c string Md5Hash string diff --git a/vendor/github.com/fsouza/fake-gcs-server/internal/backend/time_openbsd.go b/vendor/github.com/fsouza/fake-gcs-server/internal/backend/time_openbsd.go new file mode 100644 index 0000000000000..15076c2d7dae2 --- /dev/null +++ b/vendor/github.com/fsouza/fake-gcs-server/internal/backend/time_openbsd.go @@ -0,0 +1,15 @@ +//go:build openbsd + +package backend + +import ( + "os" + "syscall" +) + +func createTimeFromFileInfo(input os.FileInfo) syscall.Timespec { + if statT, ok := input.Sys().(*syscall.Stat_t); ok { + return statT.Ctim + } + return syscall.Timespec{} +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/compile.go b/vendor/github.com/goccy/go-json/internal/decoder/compile.go index fab6437647bb5..8ad50936c0c44 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/compile.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/compile.go @@ -5,6 +5,7 @@ import ( "fmt" "reflect" "strings" + "sync" "sync/atomic" "unicode" "unsafe" @@ -17,22 +18,27 @@ var ( typeAddr *runtime.TypeAddr cachedDecoderMap unsafe.Pointer // map[uintptr]decoder cachedDecoder []Decoder + initOnce sync.Once ) -func init() { - typeAddr = runtime.AnalyzeTypeAddr() - if typeAddr == nil { - typeAddr = &runtime.TypeAddr{} - } - cachedDecoder = make([]Decoder, typeAddr.AddrRange>>typeAddr.AddrShift+1) +func initDecoder() { + initOnce.Do(func() { + typeAddr = runtime.AnalyzeTypeAddr() + if typeAddr == nil { + typeAddr = &runtime.TypeAddr{} + } + cachedDecoder = make([]Decoder, typeAddr.AddrRange>>typeAddr.AddrShift+1) + }) } func loadDecoderMap() map[uintptr]Decoder { + initDecoder() p := atomic.LoadPointer(&cachedDecoderMap) return *(*map[uintptr]Decoder)(unsafe.Pointer(&p)) } func storeDecoder(typ uintptr, dec Decoder, m map[uintptr]Decoder) { + initDecoder() newDecoderMap := make(map[uintptr]Decoder, len(m)+1) newDecoderMap[typ] = dec diff --git a/vendor/github.com/goccy/go-json/internal/decoder/compile_norace.go b/vendor/github.com/goccy/go-json/internal/decoder/compile_norace.go index eb7e2b1345d7f..025ca85b5e22b 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/compile_norace.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/compile_norace.go @@ -10,6 +10,7 @@ import ( ) func CompileToGetDecoder(typ *runtime.Type) (Decoder, error) { + initDecoder() typeptr := uintptr(unsafe.Pointer(typ)) if typeptr > typeAddr.MaxTypeAddr { return compileToGetDecoderSlowPath(typeptr, typ) diff --git a/vendor/github.com/goccy/go-json/internal/decoder/compile_race.go b/vendor/github.com/goccy/go-json/internal/decoder/compile_race.go index 49cdda4a172f2..023b817c3681b 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/compile_race.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/compile_race.go @@ -13,6 +13,7 @@ import ( var decMu sync.RWMutex func CompileToGetDecoder(typ *runtime.Type) (Decoder, error) { + initDecoder() typeptr := uintptr(unsafe.Pointer(typ)) if typeptr > typeAddr.MaxTypeAddr { return compileToGetDecoderSlowPath(typeptr, typ) diff --git a/vendor/github.com/goccy/go-json/internal/encoder/compiler.go b/vendor/github.com/goccy/go-json/internal/encoder/compiler.go index 37b7aa38e26a1..b107636890af4 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/compiler.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/compiler.go @@ -5,6 +5,7 @@ import ( "encoding" "encoding/json" "reflect" + "sync" "sync/atomic" "unsafe" @@ -24,14 +25,17 @@ var ( cachedOpcodeSets []*OpcodeSet cachedOpcodeMap unsafe.Pointer // map[uintptr]*OpcodeSet typeAddr *runtime.TypeAddr + initEncoderOnce sync.Once ) -func init() { - typeAddr = runtime.AnalyzeTypeAddr() - if typeAddr == nil { - typeAddr = &runtime.TypeAddr{} - } - cachedOpcodeSets = make([]*OpcodeSet, typeAddr.AddrRange>>typeAddr.AddrShift+1) +func initEncoder() { + initEncoderOnce.Do(func() { + typeAddr = runtime.AnalyzeTypeAddr() + if typeAddr == nil { + typeAddr = &runtime.TypeAddr{} + } + cachedOpcodeSets = make([]*OpcodeSet, typeAddr.AddrRange>>typeAddr.AddrShift+1) + }) } func loadOpcodeMap() map[uintptr]*OpcodeSet { diff --git a/vendor/github.com/goccy/go-json/internal/encoder/compiler_norace.go b/vendor/github.com/goccy/go-json/internal/encoder/compiler_norace.go index 20c93cbf70988..b6f45a49b0e78 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/compiler_norace.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/compiler_norace.go @@ -4,6 +4,7 @@ package encoder func CompileToGetCodeSet(ctx *RuntimeContext, typeptr uintptr) (*OpcodeSet, error) { + initEncoder() if typeptr > typeAddr.MaxTypeAddr || typeptr < typeAddr.BaseTypeAddr { codeSet, err := compileToGetCodeSetSlowPath(typeptr) if err != nil { diff --git a/vendor/github.com/goccy/go-json/internal/encoder/compiler_race.go b/vendor/github.com/goccy/go-json/internal/encoder/compiler_race.go index 13ba23fdff8e5..47b482f7fb664 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/compiler_race.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/compiler_race.go @@ -10,6 +10,7 @@ import ( var setsMu sync.RWMutex func CompileToGetCodeSet(ctx *RuntimeContext, typeptr uintptr) (*OpcodeSet, error) { + initEncoder() if typeptr > typeAddr.MaxTypeAddr || typeptr < typeAddr.BaseTypeAddr { codeSet, err := compileToGetCodeSetSlowPath(typeptr) if err != nil { diff --git a/vendor/github.com/goccy/go-json/internal/encoder/encoder.go b/vendor/github.com/goccy/go-json/internal/encoder/encoder.go index 14eb6a0d643b9..b436f5b21ffed 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/encoder.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/encoder.go @@ -406,6 +406,11 @@ func AppendMarshalJSON(ctx *RuntimeContext, code *Opcode, b []byte, v interface{ rv = newV } } + + if rv.Kind() == reflect.Ptr && rv.IsNil() { + return AppendNull(ctx, b), nil + } + v = rv.Interface() var bb []byte if (code.Flags & MarshalerContextFlags) != 0 { diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md index 21508edbdb3c8..f06ba51c56b7d 100644 --- a/vendor/github.com/klauspost/cpuid/v2/README.md +++ b/vendor/github.com/klauspost/cpuid/v2/README.md @@ -281,6 +281,7 @@ Exit Code 1 | AMXBF16 | Tile computational operations on BFLOAT16 numbers | | AMXINT8 | Tile computational operations on 8-bit integers | | AMXFP16 | Tile computational operations on FP16 numbers | +| AMXFP8 | Tile computational operations on FP8 numbers | | AMXTILE | Tile architecture | | APX_F | Intel APX | | AVX | AVX functions | diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go index 53bc18ca71959..db99eb62f7b08 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go @@ -55,6 +55,12 @@ const ( Qualcomm Marvell + QEMU + QNX + ACRN + SRE + Apple + lastVendor ) @@ -75,6 +81,7 @@ const ( AMXBF16 // Tile computational operations on BFLOAT16 numbers AMXFP16 // Tile computational operations on FP16 numbers AMXINT8 // Tile computational operations on 8-bit integers + AMXFP8 // Tile computational operations on FP8 numbers AMXTILE // Tile architecture APX_F // Intel APX AVX // AVX functions @@ -296,20 +303,22 @@ const ( // CPUInfo contains information about the detected system CPU. type CPUInfo struct { - BrandName string // Brand name reported by the CPU - VendorID Vendor // Comparable CPU vendor ID - VendorString string // Raw vendor string. - featureSet flagSet // Features of the CPU - PhysicalCores int // Number of physical processor cores in your CPU. Will be 0 if undetectable. - ThreadsPerCore int // Number of threads per physical core. Will be 1 if undetectable. - LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable. - Family int // CPU family number - Model int // CPU model number - Stepping int // CPU stepping info - CacheLine int // Cache line size in bytes. Will be 0 if undetectable. - Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed. - BoostFreq int64 // Max clock speed, if known, 0 otherwise - Cache struct { + BrandName string // Brand name reported by the CPU + VendorID Vendor // Comparable CPU vendor ID + VendorString string // Raw vendor string. + HypervisorVendorID Vendor // Hypervisor vendor + HypervisorVendorString string // Raw hypervisor vendor string + featureSet flagSet // Features of the CPU + PhysicalCores int // Number of physical processor cores in your CPU. Will be 0 if undetectable. + ThreadsPerCore int // Number of threads per physical core. Will be 1 if undetectable. + LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable. + Family int // CPU family number + Model int // CPU model number + Stepping int // CPU stepping info + CacheLine int // Cache line size in bytes. Will be 0 if undetectable. + Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed. + BoostFreq int64 // Max clock speed, if known, 0 otherwise + Cache struct { L1I int // L1 Instruction Cache (per core or shared). Will be -1 if undetected L1D int // L1 Data Cache (per core or shared). Will be -1 if undetected L2 int // L2 Cache (per core or shared). Will be -1 if undetected @@ -318,8 +327,9 @@ type CPUInfo struct { SGX SGXSupport AMDMemEncryption AMDMemEncryptionSupport AVX10Level uint8 - maxFunc uint32 - maxExFunc uint32 + + maxFunc uint32 + maxExFunc uint32 } var cpuid func(op uint32) (eax, ebx, ecx, edx uint32) @@ -503,7 +513,7 @@ func (c CPUInfo) FeatureSet() []string { // Uses the RDTSCP instruction. The value 0 is returned // if the CPU does not support the instruction. func (c CPUInfo) RTCounter() uint64 { - if !c.Supports(RDTSCP) { + if !c.Has(RDTSCP) { return 0 } a, _, _, d := rdtscpAsm() @@ -515,13 +525,22 @@ func (c CPUInfo) RTCounter() uint64 { // about the current cpu/core the code is running on. // If the RDTSCP instruction isn't supported on the CPU, the value 0 is returned. func (c CPUInfo) Ia32TscAux() uint32 { - if !c.Supports(RDTSCP) { + if !c.Has(RDTSCP) { return 0 } _, _, ecx, _ := rdtscpAsm() return ecx } +// SveLengths returns arm SVE vector and predicate lengths. +// Will return 0, 0 if SVE is not enabled or otherwise unable to detect. +func (c CPUInfo) SveLengths() (vl, pl uint64) { + if !c.Has(SVE) { + return 0, 0 + } + return getVectorLength() +} + // LogicalCPU will return the Logical CPU the code is currently executing on. // This is likely to change when the OS re-schedules the running thread // to another CPU. @@ -781,11 +800,16 @@ func threadsPerCore() int { _, b, _, _ := cpuidex(0xb, 0) if b&0xffff == 0 { if vend == AMD { - // Workaround for AMD returning 0, assume 2 if >= Zen 2 - // It will be more correct than not. + // if >= Zen 2 0x8000001e EBX 15-8 bits means threads per core. + // The number of threads per core is ThreadsPerCore+1 + // See PPR for AMD Family 17h Models 00h-0Fh (page 82) fam, _, _ := familyModel() _, _, _, d := cpuid(1) if (d&(1<<28)) != 0 && fam >= 23 { + if maxExtendedFunction() >= 0x8000001e { + _, b, _, _ := cpuid(0x8000001e) + return int((b>>8)&0xff) + 1 + } return 2 } } @@ -877,7 +901,9 @@ var vendorMapping = map[string]Vendor{ "GenuineTMx86": Transmeta, "Geode by NSC": NSC, "VIA VIA VIA ": VIA, - "KVMKVMKVMKVM": KVM, + "KVMKVMKVM": KVM, + "Linux KVM Hv": KVM, + "TCGTCGTCGTCG": QEMU, "Microsoft Hv": MSVM, "VMwareVMware": VMware, "XenVMMXenVMM": XenHVM, @@ -887,6 +913,10 @@ var vendorMapping = map[string]Vendor{ "SiS SiS SiS ": SiS, "RiseRiseRise": SiS, "Genuine RDC": RDC, + "QNXQVMBSQG": QNX, + "ACRNACRNACRN": ACRN, + "SRESRESRESRE": SRE, + "Apple VZ": Apple, } func vendorID() (Vendor, string) { @@ -899,6 +929,17 @@ func vendorID() (Vendor, string) { return vend, v } +func hypervisorVendorID() (Vendor, string) { + // https://lwn.net/Articles/301888/ + _, b, c, d := cpuid(0x40000000) + v := string(valAsString(b, c, d)) + vend, ok := vendorMapping[v] + if !ok { + return VendorUnknown, v + } + return vend, v +} + func cacheLine() int { if maxFunctionID() < 0x1 { return 0 @@ -1271,6 +1312,7 @@ func support() flagSet { fs.setIf(ebx&(1<<31) != 0, AVX512VL) // ecx fs.setIf(ecx&(1<<1) != 0, AVX512VBMI) + fs.setIf(ecx&(1<<3) != 0, AMXFP8) fs.setIf(ecx&(1<<6) != 0, AVX512VBMI2) fs.setIf(ecx&(1<<11) != 0, AVX512VNNI) fs.setIf(ecx&(1<<12) != 0, AVX512BITALG) diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s b/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s index b31d6aec43f61..b196f78eb447f 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s @@ -24,3 +24,13 @@ TEXT ·getInstAttributes(SB), 7, $0 MOVD R1, instAttrReg1+8(FP) RET +TEXT ·getVectorLength(SB), 7, $0 + WORD $0xd2800002 // mov x2, #0 + WORD $0x04225022 // addvl x2, x2, #1 + WORD $0xd37df042 // lsl x2, x2, #3 + WORD $0xd2800003 // mov x3, #0 + WORD $0x04635023 // addpl x3, x3, #1 + WORD $0xd37df063 // lsl x3, x3, #3 + MOVD R2, vl+0(FP) + MOVD R3, pl+8(FP) + RET diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go index 9a53504a042df..566743d2204b8 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go @@ -10,6 +10,7 @@ import "runtime" func getMidr() (midr uint64) func getProcFeatures() (procFeatures uint64) func getInstAttributes() (instAttrReg0, instAttrReg1 uint64) +func getVectorLength() (vl, pl uint64) func initCPU() { cpuid = func(uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 } @@ -24,7 +25,7 @@ func addInfo(c *CPUInfo, safe bool) { detectOS(c) // ARM64 disabled since it may crash if interrupt is not intercepted by OS. - if safe && !c.Supports(ARMCPUID) && runtime.GOOS != "freebsd" { + if safe && !c.Has(ARMCPUID) && runtime.GOOS != "freebsd" { return } midr := getMidr() diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_ref.go b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go index 9636c2bc17c63..574f9389c07e4 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_ref.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go @@ -10,6 +10,8 @@ func initCPU() { cpuidex = func(x, y uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 } xgetbv = func(uint32) (a, b uint32) { return 0, 0 } rdtscpAsm = func() (a, b, c, d uint32) { return 0, 0, 0, 0 } + } func addInfo(info *CPUInfo, safe bool) {} +func getVectorLength() (vl, pl uint64) { return 0, 0 } diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go index 799b400c2ecee..f924c9d8399ab 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go @@ -32,7 +32,10 @@ func addInfo(c *CPUInfo, safe bool) { c.LogicalCores = logicalCores() c.PhysicalCores = physicalCores() c.VendorID, c.VendorString = vendorID() + c.HypervisorVendorID, c.HypervisorVendorString = hypervisorVendorID() c.AVX10Level = c.supportAVX10() c.cacheSize() c.frequencies() } + +func getVectorLength() (vl, pl uint64) { return 0, 0 } diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go index 3a25603103992..e7f874a7e8d24 100644 --- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go +++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go @@ -15,224 +15,225 @@ func _() { _ = x[AMXBF16-5] _ = x[AMXFP16-6] _ = x[AMXINT8-7] - _ = x[AMXTILE-8] - _ = x[APX_F-9] - _ = x[AVX-10] - _ = x[AVX10-11] - _ = x[AVX10_128-12] - _ = x[AVX10_256-13] - _ = x[AVX10_512-14] - _ = x[AVX2-15] - _ = x[AVX512BF16-16] - _ = x[AVX512BITALG-17] - _ = x[AVX512BW-18] - _ = x[AVX512CD-19] - _ = x[AVX512DQ-20] - _ = x[AVX512ER-21] - _ = x[AVX512F-22] - _ = x[AVX512FP16-23] - _ = x[AVX512IFMA-24] - _ = x[AVX512PF-25] - _ = x[AVX512VBMI-26] - _ = x[AVX512VBMI2-27] - _ = x[AVX512VL-28] - _ = x[AVX512VNNI-29] - _ = x[AVX512VP2INTERSECT-30] - _ = x[AVX512VPOPCNTDQ-31] - _ = x[AVXIFMA-32] - _ = x[AVXNECONVERT-33] - _ = x[AVXSLOW-34] - _ = x[AVXVNNI-35] - _ = x[AVXVNNIINT8-36] - _ = x[AVXVNNIINT16-37] - _ = x[BHI_CTRL-38] - _ = x[BMI1-39] - _ = x[BMI2-40] - _ = x[CETIBT-41] - _ = x[CETSS-42] - _ = x[CLDEMOTE-43] - _ = x[CLMUL-44] - _ = x[CLZERO-45] - _ = x[CMOV-46] - _ = x[CMPCCXADD-47] - _ = x[CMPSB_SCADBS_SHORT-48] - _ = x[CMPXCHG8-49] - _ = x[CPBOOST-50] - _ = x[CPPC-51] - _ = x[CX16-52] - _ = x[EFER_LMSLE_UNS-53] - _ = x[ENQCMD-54] - _ = x[ERMS-55] - _ = x[F16C-56] - _ = x[FLUSH_L1D-57] - _ = x[FMA3-58] - _ = x[FMA4-59] - _ = x[FP128-60] - _ = x[FP256-61] - _ = x[FSRM-62] - _ = x[FXSR-63] - _ = x[FXSROPT-64] - _ = x[GFNI-65] - _ = x[HLE-66] - _ = x[HRESET-67] - _ = x[HTT-68] - _ = x[HWA-69] - _ = x[HYBRID_CPU-70] - _ = x[HYPERVISOR-71] - _ = x[IA32_ARCH_CAP-72] - _ = x[IA32_CORE_CAP-73] - _ = x[IBPB-74] - _ = x[IBPB_BRTYPE-75] - _ = x[IBRS-76] - _ = x[IBRS_PREFERRED-77] - _ = x[IBRS_PROVIDES_SMP-78] - _ = x[IBS-79] - _ = x[IBSBRNTRGT-80] - _ = x[IBSFETCHSAM-81] - _ = x[IBSFFV-82] - _ = x[IBSOPCNT-83] - _ = x[IBSOPCNTEXT-84] - _ = x[IBSOPSAM-85] - _ = x[IBSRDWROPCNT-86] - _ = x[IBSRIPINVALIDCHK-87] - _ = x[IBS_FETCH_CTLX-88] - _ = x[IBS_OPDATA4-89] - _ = x[IBS_OPFUSE-90] - _ = x[IBS_PREVENTHOST-91] - _ = x[IBS_ZEN4-92] - _ = x[IDPRED_CTRL-93] - _ = x[INT_WBINVD-94] - _ = x[INVLPGB-95] - _ = x[KEYLOCKER-96] - _ = x[KEYLOCKERW-97] - _ = x[LAHF-98] - _ = x[LAM-99] - _ = x[LBRVIRT-100] - _ = x[LZCNT-101] - _ = x[MCAOVERFLOW-102] - _ = x[MCDT_NO-103] - _ = x[MCOMMIT-104] - _ = x[MD_CLEAR-105] - _ = x[MMX-106] - _ = x[MMXEXT-107] - _ = x[MOVBE-108] - _ = x[MOVDIR64B-109] - _ = x[MOVDIRI-110] - _ = x[MOVSB_ZL-111] - _ = x[MOVU-112] - _ = x[MPX-113] - _ = x[MSRIRC-114] - _ = x[MSRLIST-115] - _ = x[MSR_PAGEFLUSH-116] - _ = x[NRIPS-117] - _ = x[NX-118] - _ = x[OSXSAVE-119] - _ = x[PCONFIG-120] - _ = x[POPCNT-121] - _ = x[PPIN-122] - _ = x[PREFETCHI-123] - _ = x[PSFD-124] - _ = x[RDPRU-125] - _ = x[RDRAND-126] - _ = x[RDSEED-127] - _ = x[RDTSCP-128] - _ = x[RRSBA_CTRL-129] - _ = x[RTM-130] - _ = x[RTM_ALWAYS_ABORT-131] - _ = x[SBPB-132] - _ = x[SERIALIZE-133] - _ = x[SEV-134] - _ = x[SEV_64BIT-135] - _ = x[SEV_ALTERNATIVE-136] - _ = x[SEV_DEBUGSWAP-137] - _ = x[SEV_ES-138] - _ = x[SEV_RESTRICTED-139] - _ = x[SEV_SNP-140] - _ = x[SGX-141] - _ = x[SGXLC-142] - _ = x[SHA-143] - _ = x[SME-144] - _ = x[SME_COHERENT-145] - _ = x[SPEC_CTRL_SSBD-146] - _ = x[SRBDS_CTRL-147] - _ = x[SRSO_MSR_FIX-148] - _ = x[SRSO_NO-149] - _ = x[SRSO_USER_KERNEL_NO-150] - _ = x[SSE-151] - _ = x[SSE2-152] - _ = x[SSE3-153] - _ = x[SSE4-154] - _ = x[SSE42-155] - _ = x[SSE4A-156] - _ = x[SSSE3-157] - _ = x[STIBP-158] - _ = x[STIBP_ALWAYSON-159] - _ = x[STOSB_SHORT-160] - _ = x[SUCCOR-161] - _ = x[SVM-162] - _ = x[SVMDA-163] - _ = x[SVMFBASID-164] - _ = x[SVML-165] - _ = x[SVMNP-166] - _ = x[SVMPF-167] - _ = x[SVMPFT-168] - _ = x[SYSCALL-169] - _ = x[SYSEE-170] - _ = x[TBM-171] - _ = x[TDX_GUEST-172] - _ = x[TLB_FLUSH_NESTED-173] - _ = x[TME-174] - _ = x[TOPEXT-175] - _ = x[TSCRATEMSR-176] - _ = x[TSXLDTRK-177] - _ = x[VAES-178] - _ = x[VMCBCLEAN-179] - _ = x[VMPL-180] - _ = x[VMSA_REGPROT-181] - _ = x[VMX-182] - _ = x[VPCLMULQDQ-183] - _ = x[VTE-184] - _ = x[WAITPKG-185] - _ = x[WBNOINVD-186] - _ = x[WRMSRNS-187] - _ = x[X87-188] - _ = x[XGETBV1-189] - _ = x[XOP-190] - _ = x[XSAVE-191] - _ = x[XSAVEC-192] - _ = x[XSAVEOPT-193] - _ = x[XSAVES-194] - _ = x[AESARM-195] - _ = x[ARMCPUID-196] - _ = x[ASIMD-197] - _ = x[ASIMDDP-198] - _ = x[ASIMDHP-199] - _ = x[ASIMDRDM-200] - _ = x[ATOMICS-201] - _ = x[CRC32-202] - _ = x[DCPOP-203] - _ = x[EVTSTRM-204] - _ = x[FCMA-205] - _ = x[FP-206] - _ = x[FPHP-207] - _ = x[GPA-208] - _ = x[JSCVT-209] - _ = x[LRCPC-210] - _ = x[PMULL-211] - _ = x[SHA1-212] - _ = x[SHA2-213] - _ = x[SHA3-214] - _ = x[SHA512-215] - _ = x[SM3-216] - _ = x[SM4-217] - _ = x[SVE-218] - _ = x[lastID-219] + _ = x[AMXFP8-8] + _ = x[AMXTILE-9] + _ = x[APX_F-10] + _ = x[AVX-11] + _ = x[AVX10-12] + _ = x[AVX10_128-13] + _ = x[AVX10_256-14] + _ = x[AVX10_512-15] + _ = x[AVX2-16] + _ = x[AVX512BF16-17] + _ = x[AVX512BITALG-18] + _ = x[AVX512BW-19] + _ = x[AVX512CD-20] + _ = x[AVX512DQ-21] + _ = x[AVX512ER-22] + _ = x[AVX512F-23] + _ = x[AVX512FP16-24] + _ = x[AVX512IFMA-25] + _ = x[AVX512PF-26] + _ = x[AVX512VBMI-27] + _ = x[AVX512VBMI2-28] + _ = x[AVX512VL-29] + _ = x[AVX512VNNI-30] + _ = x[AVX512VP2INTERSECT-31] + _ = x[AVX512VPOPCNTDQ-32] + _ = x[AVXIFMA-33] + _ = x[AVXNECONVERT-34] + _ = x[AVXSLOW-35] + _ = x[AVXVNNI-36] + _ = x[AVXVNNIINT8-37] + _ = x[AVXVNNIINT16-38] + _ = x[BHI_CTRL-39] + _ = x[BMI1-40] + _ = x[BMI2-41] + _ = x[CETIBT-42] + _ = x[CETSS-43] + _ = x[CLDEMOTE-44] + _ = x[CLMUL-45] + _ = x[CLZERO-46] + _ = x[CMOV-47] + _ = x[CMPCCXADD-48] + _ = x[CMPSB_SCADBS_SHORT-49] + _ = x[CMPXCHG8-50] + _ = x[CPBOOST-51] + _ = x[CPPC-52] + _ = x[CX16-53] + _ = x[EFER_LMSLE_UNS-54] + _ = x[ENQCMD-55] + _ = x[ERMS-56] + _ = x[F16C-57] + _ = x[FLUSH_L1D-58] + _ = x[FMA3-59] + _ = x[FMA4-60] + _ = x[FP128-61] + _ = x[FP256-62] + _ = x[FSRM-63] + _ = x[FXSR-64] + _ = x[FXSROPT-65] + _ = x[GFNI-66] + _ = x[HLE-67] + _ = x[HRESET-68] + _ = x[HTT-69] + _ = x[HWA-70] + _ = x[HYBRID_CPU-71] + _ = x[HYPERVISOR-72] + _ = x[IA32_ARCH_CAP-73] + _ = x[IA32_CORE_CAP-74] + _ = x[IBPB-75] + _ = x[IBPB_BRTYPE-76] + _ = x[IBRS-77] + _ = x[IBRS_PREFERRED-78] + _ = x[IBRS_PROVIDES_SMP-79] + _ = x[IBS-80] + _ = x[IBSBRNTRGT-81] + _ = x[IBSFETCHSAM-82] + _ = x[IBSFFV-83] + _ = x[IBSOPCNT-84] + _ = x[IBSOPCNTEXT-85] + _ = x[IBSOPSAM-86] + _ = x[IBSRDWROPCNT-87] + _ = x[IBSRIPINVALIDCHK-88] + _ = x[IBS_FETCH_CTLX-89] + _ = x[IBS_OPDATA4-90] + _ = x[IBS_OPFUSE-91] + _ = x[IBS_PREVENTHOST-92] + _ = x[IBS_ZEN4-93] + _ = x[IDPRED_CTRL-94] + _ = x[INT_WBINVD-95] + _ = x[INVLPGB-96] + _ = x[KEYLOCKER-97] + _ = x[KEYLOCKERW-98] + _ = x[LAHF-99] + _ = x[LAM-100] + _ = x[LBRVIRT-101] + _ = x[LZCNT-102] + _ = x[MCAOVERFLOW-103] + _ = x[MCDT_NO-104] + _ = x[MCOMMIT-105] + _ = x[MD_CLEAR-106] + _ = x[MMX-107] + _ = x[MMXEXT-108] + _ = x[MOVBE-109] + _ = x[MOVDIR64B-110] + _ = x[MOVDIRI-111] + _ = x[MOVSB_ZL-112] + _ = x[MOVU-113] + _ = x[MPX-114] + _ = x[MSRIRC-115] + _ = x[MSRLIST-116] + _ = x[MSR_PAGEFLUSH-117] + _ = x[NRIPS-118] + _ = x[NX-119] + _ = x[OSXSAVE-120] + _ = x[PCONFIG-121] + _ = x[POPCNT-122] + _ = x[PPIN-123] + _ = x[PREFETCHI-124] + _ = x[PSFD-125] + _ = x[RDPRU-126] + _ = x[RDRAND-127] + _ = x[RDSEED-128] + _ = x[RDTSCP-129] + _ = x[RRSBA_CTRL-130] + _ = x[RTM-131] + _ = x[RTM_ALWAYS_ABORT-132] + _ = x[SBPB-133] + _ = x[SERIALIZE-134] + _ = x[SEV-135] + _ = x[SEV_64BIT-136] + _ = x[SEV_ALTERNATIVE-137] + _ = x[SEV_DEBUGSWAP-138] + _ = x[SEV_ES-139] + _ = x[SEV_RESTRICTED-140] + _ = x[SEV_SNP-141] + _ = x[SGX-142] + _ = x[SGXLC-143] + _ = x[SHA-144] + _ = x[SME-145] + _ = x[SME_COHERENT-146] + _ = x[SPEC_CTRL_SSBD-147] + _ = x[SRBDS_CTRL-148] + _ = x[SRSO_MSR_FIX-149] + _ = x[SRSO_NO-150] + _ = x[SRSO_USER_KERNEL_NO-151] + _ = x[SSE-152] + _ = x[SSE2-153] + _ = x[SSE3-154] + _ = x[SSE4-155] + _ = x[SSE42-156] + _ = x[SSE4A-157] + _ = x[SSSE3-158] + _ = x[STIBP-159] + _ = x[STIBP_ALWAYSON-160] + _ = x[STOSB_SHORT-161] + _ = x[SUCCOR-162] + _ = x[SVM-163] + _ = x[SVMDA-164] + _ = x[SVMFBASID-165] + _ = x[SVML-166] + _ = x[SVMNP-167] + _ = x[SVMPF-168] + _ = x[SVMPFT-169] + _ = x[SYSCALL-170] + _ = x[SYSEE-171] + _ = x[TBM-172] + _ = x[TDX_GUEST-173] + _ = x[TLB_FLUSH_NESTED-174] + _ = x[TME-175] + _ = x[TOPEXT-176] + _ = x[TSCRATEMSR-177] + _ = x[TSXLDTRK-178] + _ = x[VAES-179] + _ = x[VMCBCLEAN-180] + _ = x[VMPL-181] + _ = x[VMSA_REGPROT-182] + _ = x[VMX-183] + _ = x[VPCLMULQDQ-184] + _ = x[VTE-185] + _ = x[WAITPKG-186] + _ = x[WBNOINVD-187] + _ = x[WRMSRNS-188] + _ = x[X87-189] + _ = x[XGETBV1-190] + _ = x[XOP-191] + _ = x[XSAVE-192] + _ = x[XSAVEC-193] + _ = x[XSAVEOPT-194] + _ = x[XSAVES-195] + _ = x[AESARM-196] + _ = x[ARMCPUID-197] + _ = x[ASIMD-198] + _ = x[ASIMDDP-199] + _ = x[ASIMDHP-200] + _ = x[ASIMDRDM-201] + _ = x[ATOMICS-202] + _ = x[CRC32-203] + _ = x[DCPOP-204] + _ = x[EVTSTRM-205] + _ = x[FCMA-206] + _ = x[FP-207] + _ = x[FPHP-208] + _ = x[GPA-209] + _ = x[JSCVT-210] + _ = x[LRCPC-211] + _ = x[PMULL-212] + _ = x[SHA1-213] + _ = x[SHA2-214] + _ = x[SHA3-215] + _ = x[SHA512-216] + _ = x[SM3-217] + _ = x[SM4-218] + _ = x[SVE-219] + _ = x[lastID-220] _ = x[firstID-0] } -const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" +const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" -var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 323, 331, 335, 339, 345, 350, 358, 363, 369, 373, 382, 400, 408, 415, 419, 423, 437, 443, 447, 451, 460, 464, 468, 473, 478, 482, 486, 493, 497, 500, 506, 509, 512, 522, 532, 545, 558, 562, 573, 577, 591, 608, 611, 621, 632, 638, 646, 657, 665, 677, 693, 707, 718, 728, 743, 751, 762, 772, 779, 788, 798, 802, 805, 812, 817, 828, 835, 842, 850, 853, 859, 864, 873, 880, 888, 892, 895, 901, 908, 921, 926, 928, 935, 942, 948, 952, 961, 965, 970, 976, 982, 988, 998, 1001, 1017, 1021, 1030, 1033, 1042, 1057, 1070, 1076, 1090, 1097, 1100, 1105, 1108, 1111, 1123, 1137, 1147, 1159, 1166, 1185, 1188, 1192, 1196, 1200, 1205, 1210, 1215, 1220, 1234, 1245, 1251, 1254, 1259, 1268, 1272, 1277, 1282, 1288, 1295, 1300, 1303, 1312, 1328, 1331, 1337, 1347, 1355, 1359, 1368, 1372, 1384, 1387, 1397, 1400, 1407, 1415, 1422, 1425, 1432, 1435, 1440, 1446, 1454, 1460, 1466, 1474, 1479, 1486, 1493, 1501, 1508, 1513, 1518, 1525, 1529, 1531, 1535, 1538, 1543, 1548, 1553, 1557, 1561, 1565, 1571, 1574, 1577, 1580, 1586} +var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 73, 76, 81, 90, 99, 108, 112, 122, 134, 142, 150, 158, 166, 173, 183, 193, 201, 211, 222, 230, 240, 258, 273, 280, 292, 299, 306, 317, 329, 337, 341, 345, 351, 356, 364, 369, 375, 379, 388, 406, 414, 421, 425, 429, 443, 449, 453, 457, 466, 470, 474, 479, 484, 488, 492, 499, 503, 506, 512, 515, 518, 528, 538, 551, 564, 568, 579, 583, 597, 614, 617, 627, 638, 644, 652, 663, 671, 683, 699, 713, 724, 734, 749, 757, 768, 778, 785, 794, 804, 808, 811, 818, 823, 834, 841, 848, 856, 859, 865, 870, 879, 886, 894, 898, 901, 907, 914, 927, 932, 934, 941, 948, 954, 958, 967, 971, 976, 982, 988, 994, 1004, 1007, 1023, 1027, 1036, 1039, 1048, 1063, 1076, 1082, 1096, 1103, 1106, 1111, 1114, 1117, 1129, 1143, 1153, 1165, 1172, 1191, 1194, 1198, 1202, 1206, 1211, 1216, 1221, 1226, 1240, 1251, 1257, 1260, 1265, 1274, 1278, 1283, 1288, 1294, 1301, 1306, 1309, 1318, 1334, 1337, 1343, 1353, 1361, 1365, 1374, 1378, 1390, 1393, 1403, 1406, 1413, 1421, 1428, 1431, 1438, 1441, 1446, 1452, 1460, 1466, 1472, 1480, 1485, 1492, 1499, 1507, 1514, 1519, 1524, 1531, 1535, 1537, 1541, 1544, 1549, 1554, 1559, 1563, 1567, 1571, 1577, 1580, 1583, 1586, 1592} func (i FeatureID) String() string { if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { @@ -270,12 +271,17 @@ func _() { _ = x[AMCC-23] _ = x[Qualcomm-24] _ = x[Marvell-25] - _ = x[lastVendor-26] + _ = x[QEMU-26] + _ = x[QNX-27] + _ = x[ACRN-28] + _ = x[SRE-29] + _ = x[Apple-30] + _ = x[lastVendor-31] } -const _Vendor_name = "VendorUnknownIntelAMDVIATransmetaNSCKVMMSVMVMwareXenHVMBhyveHygonSiSRDCAmpereARMBroadcomCaviumDECFujitsuInfineonMotorolaNVIDIAAMCCQualcommMarvelllastVendor" +const _Vendor_name = "VendorUnknownIntelAMDVIATransmetaNSCKVMMSVMVMwareXenHVMBhyveHygonSiSRDCAmpereARMBroadcomCaviumDECFujitsuInfineonMotorolaNVIDIAAMCCQualcommMarvellQEMUQNXACRNSREApplelastVendor" -var _Vendor_index = [...]uint8{0, 13, 18, 21, 24, 33, 36, 39, 43, 49, 55, 60, 65, 68, 71, 77, 80, 88, 94, 97, 104, 112, 120, 126, 130, 138, 145, 155} +var _Vendor_index = [...]uint8{0, 13, 18, 21, 24, 33, 36, 39, 43, 49, 55, 60, 65, 68, 71, 77, 80, 88, 94, 97, 104, 112, 120, 126, 130, 138, 145, 149, 152, 156, 159, 164, 174} func (i Vendor) String() string { if i < 0 || i >= Vendor(len(_Vendor_index)-1) { diff --git a/vendor/go.opentelemetry.io/contrib/detectors/gcp/version.go b/vendor/go.opentelemetry.io/contrib/detectors/gcp/version.go index 1acc898319839..b2c2fe0fa80a2 100644 --- a/vendor/go.opentelemetry.io/contrib/detectors/gcp/version.go +++ b/vendor/go.opentelemetry.io/contrib/detectors/gcp/version.go @@ -5,7 +5,7 @@ package gcp // import "go.opentelemetry.io/contrib/detectors/gcp" // Version is the current release version of the GCP resource detector. func Version() string { - return "1.29.0" + return "1.33.0" // This string is updated by the pre_release.sh script during release } diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/config.go b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/config.go index 18436eaedffd8..9e87fb4bb192d 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/config.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/config.go @@ -51,11 +51,11 @@ type config struct { tracer trace.Tracer meter metric.Meter - rpcDuration metric.Float64Histogram - rpcRequestSize metric.Int64Histogram - rpcResponseSize metric.Int64Histogram - rpcRequestsPerRPC metric.Int64Histogram - rpcResponsesPerRPC metric.Int64Histogram + rpcDuration metric.Float64Histogram + rpcInBytes metric.Int64Histogram + rpcOutBytes metric.Int64Histogram + rpcInMessages metric.Int64Histogram + rpcOutMessages metric.Int64Histogram } // Option applies an option value for a config. @@ -96,46 +96,64 @@ func newConfig(opts []Option, role string) *config { } } - c.rpcRequestSize, err = c.meter.Int64Histogram("rpc."+role+".request.size", + rpcRequestSize, err := c.meter.Int64Histogram("rpc."+role+".request.size", metric.WithDescription("Measures size of RPC request messages (uncompressed)."), metric.WithUnit("By")) if err != nil { otel.Handle(err) - if c.rpcRequestSize == nil { - c.rpcRequestSize = noop.Int64Histogram{} + if rpcRequestSize == nil { + rpcRequestSize = noop.Int64Histogram{} } } - c.rpcResponseSize, err = c.meter.Int64Histogram("rpc."+role+".response.size", + rpcResponseSize, err := c.meter.Int64Histogram("rpc."+role+".response.size", metric.WithDescription("Measures size of RPC response messages (uncompressed)."), metric.WithUnit("By")) if err != nil { otel.Handle(err) - if c.rpcResponseSize == nil { - c.rpcResponseSize = noop.Int64Histogram{} + if rpcResponseSize == nil { + rpcResponseSize = noop.Int64Histogram{} } } - c.rpcRequestsPerRPC, err = c.meter.Int64Histogram("rpc."+role+".requests_per_rpc", + rpcRequestsPerRPC, err := c.meter.Int64Histogram("rpc."+role+".requests_per_rpc", metric.WithDescription("Measures the number of messages received per RPC. Should be 1 for all non-streaming RPCs."), metric.WithUnit("{count}")) if err != nil { otel.Handle(err) - if c.rpcRequestsPerRPC == nil { - c.rpcRequestsPerRPC = noop.Int64Histogram{} + if rpcRequestsPerRPC == nil { + rpcRequestsPerRPC = noop.Int64Histogram{} } } - c.rpcResponsesPerRPC, err = c.meter.Int64Histogram("rpc."+role+".responses_per_rpc", + rpcResponsesPerRPC, err := c.meter.Int64Histogram("rpc."+role+".responses_per_rpc", metric.WithDescription("Measures the number of messages received per RPC. Should be 1 for all non-streaming RPCs."), metric.WithUnit("{count}")) if err != nil { otel.Handle(err) - if c.rpcResponsesPerRPC == nil { - c.rpcResponsesPerRPC = noop.Int64Histogram{} + if rpcResponsesPerRPC == nil { + rpcResponsesPerRPC = noop.Int64Histogram{} } } + switch role { + case "client": + c.rpcInBytes = rpcResponseSize + c.rpcInMessages = rpcResponsesPerRPC + c.rpcOutBytes = rpcRequestSize + c.rpcOutMessages = rpcRequestsPerRPC + case "server": + c.rpcInBytes = rpcRequestSize + c.rpcInMessages = rpcRequestsPerRPC + c.rpcOutBytes = rpcResponseSize + c.rpcOutMessages = rpcResponsesPerRPC + default: + c.rpcInBytes = noop.Int64Histogram{} + c.rpcInMessages = noop.Int64Histogram{} + c.rpcOutBytes = noop.Int64Histogram{} + c.rpcOutMessages = noop.Int64Histogram{} + } + return c } diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/stats_handler.go b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/stats_handler.go index fbcbfb84e047e..c01cb897cd307 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/stats_handler.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/stats_handler.go @@ -13,21 +13,22 @@ import ( "google.golang.org/grpc/stats" "google.golang.org/grpc/status" - "go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/internal" "go.opentelemetry.io/otel/attribute" "go.opentelemetry.io/otel/codes" "go.opentelemetry.io/otel/metric" semconv "go.opentelemetry.io/otel/semconv/v1.17.0" "go.opentelemetry.io/otel/trace" + + "go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/internal" ) type gRPCContextKey struct{} type gRPCContext struct { - messagesReceived int64 - messagesSent int64 - metricAttrs []attribute.KeyValue - record bool + inMessages int64 + outMessages int64 + metricAttrs []attribute.KeyValue + record bool } type serverHandler struct { @@ -150,8 +151,8 @@ func (c *config) handleRPC(ctx context.Context, rs stats.RPCStats, isServer bool case *stats.Begin: case *stats.InPayload: if gctx != nil { - messageId = atomic.AddInt64(&gctx.messagesReceived, 1) - c.rpcRequestSize.Record(ctx, int64(rs.Length), metric.WithAttributeSet(attribute.NewSet(metricAttrs...))) + messageId = atomic.AddInt64(&gctx.inMessages, 1) + c.rpcInBytes.Record(ctx, int64(rs.Length), metric.WithAttributeSet(attribute.NewSet(metricAttrs...))) } if c.ReceivedEvent { @@ -166,8 +167,8 @@ func (c *config) handleRPC(ctx context.Context, rs stats.RPCStats, isServer bool } case *stats.OutPayload: if gctx != nil { - messageId = atomic.AddInt64(&gctx.messagesSent, 1) - c.rpcResponseSize.Record(ctx, int64(rs.Length), metric.WithAttributeSet(attribute.NewSet(metricAttrs...))) + messageId = atomic.AddInt64(&gctx.outMessages, 1) + c.rpcOutBytes.Record(ctx, int64(rs.Length), metric.WithAttributeSet(attribute.NewSet(metricAttrs...))) } if c.SentEvent { @@ -213,8 +214,8 @@ func (c *config) handleRPC(ctx context.Context, rs stats.RPCStats, isServer bool c.rpcDuration.Record(ctx, elapsedTime, recordOpts...) if gctx != nil { - c.rpcRequestsPerRPC.Record(ctx, atomic.LoadInt64(&gctx.messagesReceived), recordOpts...) - c.rpcResponsesPerRPC.Record(ctx, atomic.LoadInt64(&gctx.messagesSent), recordOpts...) + c.rpcInMessages.Record(ctx, atomic.LoadInt64(&gctx.inMessages), recordOpts...) + c.rpcOutMessages.Record(ctx, atomic.LoadInt64(&gctx.outMessages), recordOpts...) } default: return diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/version.go b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/version.go index 04f425edfefea..25a3a86296af1 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/version.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/version.go @@ -5,7 +5,7 @@ package otelgrpc // import "go.opentelemetry.io/contrib/instrumentation/google.g // Version is the current release version of the gRPC instrumentation. func Version() string { - return "0.54.0" + return "0.58.0" // This string is updated by the pre_release.sh script during release } diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/client.go b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/client.go index 6aae83bfd2080..b25641c55d348 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/client.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/client.go @@ -18,7 +18,7 @@ var DefaultClient = &http.Client{Transport: NewTransport(http.DefaultTransport)} // Get is a convenient replacement for http.Get that adds a span around the request. func Get(ctx context.Context, targetURL string) (resp *http.Response, err error) { - req, err := http.NewRequestWithContext(ctx, "GET", targetURL, nil) + req, err := http.NewRequestWithContext(ctx, http.MethodGet, targetURL, nil) if err != nil { return nil, err } @@ -27,7 +27,7 @@ func Get(ctx context.Context, targetURL string) (resp *http.Response, err error) // Head is a convenient replacement for http.Head that adds a span around the request. func Head(ctx context.Context, targetURL string) (resp *http.Response, err error) { - req, err := http.NewRequestWithContext(ctx, "HEAD", targetURL, nil) + req, err := http.NewRequestWithContext(ctx, http.MethodHead, targetURL, nil) if err != nil { return nil, err } @@ -36,7 +36,7 @@ func Head(ctx context.Context, targetURL string) (resp *http.Response, err error // Post is a convenient replacement for http.Post that adds a span around the request. func Post(ctx context.Context, targetURL, contentType string, body io.Reader) (resp *http.Response, err error) { - req, err := http.NewRequestWithContext(ctx, "POST", targetURL, body) + req, err := http.NewRequestWithContext(ctx, http.MethodPost, targetURL, body) if err != nil { return nil, err } diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/common.go b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/common.go index 5d6e6156b7beb..a83a026274a11 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/common.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/common.go @@ -18,13 +18,6 @@ const ( WriteErrorKey = attribute.Key("http.write_error") // if an error occurred while writing a reply, the string of the error (io.EOF is not recorded) ) -// Client HTTP metrics. -const ( - clientRequestSize = "http.client.request.size" // Outgoing request bytes total - clientResponseSize = "http.client.response.size" // Outgoing response bytes total - clientDuration = "http.client.duration" // Outgoing end to end duration, milliseconds -) - // Filter is a predicate used to determine whether a given http.request should // be traced. A Filter must return true if the request should be traced. type Filter func(*http.Request) bool diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/handler.go b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/handler.go index 33580a35b774b..e555a475f13d9 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/handler.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/handler.go @@ -81,12 +81,6 @@ func (h *middleware) configure(c *config) { h.semconv = semconv.NewHTTPServer(c.Meter) } -func handleErr(err error) { - if err != nil { - otel.Handle(err) - } -} - // serveHTTP sets up tracing and calls the given next http.Handler with the span // context injected into the request context. func (h *middleware) serveHTTP(w http.ResponseWriter, r *http.Request, next http.Handler) { @@ -123,6 +117,11 @@ func (h *middleware) serveHTTP(w http.ResponseWriter, r *http.Request, next http } } + if startTime := StartTimeFromContext(ctx); !startTime.IsZero() { + opts = append(opts, trace.WithTimestamp(startTime)) + requestStartTime = startTime + } + ctx, span := tracer.Start(ctx, h.spanNameFormatter(h.operation, r), opts...) defer span.End() @@ -190,14 +189,18 @@ func (h *middleware) serveHTTP(w http.ResponseWriter, r *http.Request, next http // Use floating point division here for higher precision (instead of Millisecond method). elapsedTime := float64(time.Since(requestStartTime)) / float64(time.Millisecond) - h.semconv.RecordMetrics(ctx, semconv.MetricData{ - ServerName: h.server, - Req: r, - StatusCode: statusCode, - AdditionalAttributes: labeler.Get(), - RequestSize: bw.BytesRead(), - ResponseSize: bytesWritten, - ElapsedTime: elapsedTime, + h.semconv.RecordMetrics(ctx, semconv.ServerMetricData{ + ServerName: h.server, + ResponseSize: bytesWritten, + MetricAttributes: semconv.MetricAttributes{ + Req: r, + StatusCode: statusCode, + AdditionalAttributes: labeler.Get(), + }, + MetricData: semconv.MetricData{ + RequestSize: bw.BytesRead(), + ElapsedTime: elapsedTime, + }, }) } diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/request/resp_writer_wrapper.go b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/request/resp_writer_wrapper.go index aea171fb260b5..fbc344cbdda36 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/request/resp_writer_wrapper.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/request/resp_writer_wrapper.go @@ -44,7 +44,9 @@ func (w *RespWriterWrapper) Write(p []byte) (int, error) { w.mu.Lock() defer w.mu.Unlock() - w.writeHeader(http.StatusOK) + if !w.wroteHeader { + w.writeHeader(http.StatusOK) + } n, err := w.ResponseWriter.Write(p) n1 := int64(n) @@ -80,7 +82,12 @@ func (w *RespWriterWrapper) writeHeader(statusCode int) { // Flush implements [http.Flusher]. func (w *RespWriterWrapper) Flush() { - w.WriteHeader(http.StatusOK) + w.mu.Lock() + defer w.mu.Unlock() + + if !w.wroteHeader { + w.writeHeader(http.StatusOK) + } if f, ok := w.ResponseWriter.(http.Flusher); ok { f.Flush() diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/env.go b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/env.go index 9cae4cab86af1..3b036f8a37b24 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/env.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/env.go @@ -9,6 +9,7 @@ import ( "net/http" "os" "strings" + "sync" "go.opentelemetry.io/otel/attribute" "go.opentelemetry.io/otel/codes" @@ -50,9 +51,9 @@ type HTTPServer struct { // The req Host will be used to determine the server instead. func (s HTTPServer) RequestTraceAttrs(server string, req *http.Request) []attribute.KeyValue { if s.duplicate { - return append(oldHTTPServer{}.RequestTraceAttrs(server, req), newHTTPServer{}.RequestTraceAttrs(server, req)...) + return append(OldHTTPServer{}.RequestTraceAttrs(server, req), CurrentHTTPServer{}.RequestTraceAttrs(server, req)...) } - return oldHTTPServer{}.RequestTraceAttrs(server, req) + return OldHTTPServer{}.RequestTraceAttrs(server, req) } // ResponseTraceAttrs returns trace attributes for telemetry from an HTTP response. @@ -60,14 +61,14 @@ func (s HTTPServer) RequestTraceAttrs(server string, req *http.Request) []attrib // If any of the fields in the ResponseTelemetry are not set the attribute will be omitted. func (s HTTPServer) ResponseTraceAttrs(resp ResponseTelemetry) []attribute.KeyValue { if s.duplicate { - return append(oldHTTPServer{}.ResponseTraceAttrs(resp), newHTTPServer{}.ResponseTraceAttrs(resp)...) + return append(OldHTTPServer{}.ResponseTraceAttrs(resp), CurrentHTTPServer{}.ResponseTraceAttrs(resp)...) } - return oldHTTPServer{}.ResponseTraceAttrs(resp) + return OldHTTPServer{}.ResponseTraceAttrs(resp) } // Route returns the attribute for the route. func (s HTTPServer) Route(route string) attribute.KeyValue { - return oldHTTPServer{}.Route(route) + return OldHTTPServer{}.Route(route) } // Status returns a span status code and message for an HTTP status code @@ -83,29 +84,46 @@ func (s HTTPServer) Status(code int) (codes.Code, string) { return codes.Unset, "" } -type MetricData struct { - ServerName string +type ServerMetricData struct { + ServerName string + ResponseSize int64 + + MetricData + MetricAttributes +} + +type MetricAttributes struct { Req *http.Request StatusCode int AdditionalAttributes []attribute.KeyValue +} - RequestSize int64 - ResponseSize int64 - ElapsedTime float64 +type MetricData struct { + RequestSize int64 + ElapsedTime float64 +} + +var metricAddOptionPool = &sync.Pool{ + New: func() interface{} { + return &[]metric.AddOption{} + }, } -func (s HTTPServer) RecordMetrics(ctx context.Context, md MetricData) { +func (s HTTPServer) RecordMetrics(ctx context.Context, md ServerMetricData) { if s.requestBytesCounter == nil || s.responseBytesCounter == nil || s.serverLatencyMeasure == nil { - // This will happen if an HTTPServer{} is used insted of NewHTTPServer. + // This will happen if an HTTPServer{} is used instead of NewHTTPServer. return } - attributes := oldHTTPServer{}.MetricAttributes(md.ServerName, md.Req, md.StatusCode, md.AdditionalAttributes) + attributes := OldHTTPServer{}.MetricAttributes(md.ServerName, md.Req, md.StatusCode, md.AdditionalAttributes) o := metric.WithAttributeSet(attribute.NewSet(attributes...)) - addOpts := []metric.AddOption{o} // Allocate vararg slice once. - s.requestBytesCounter.Add(ctx, md.RequestSize, addOpts...) - s.responseBytesCounter.Add(ctx, md.ResponseSize, addOpts...) + addOpts := metricAddOptionPool.Get().(*[]metric.AddOption) + *addOpts = append(*addOpts, o) + s.requestBytesCounter.Add(ctx, md.RequestSize, *addOpts...) + s.responseBytesCounter.Add(ctx, md.ResponseSize, *addOpts...) s.serverLatencyMeasure.Record(ctx, md.ElapsedTime, o) + *addOpts = (*addOpts)[:0] + metricAddOptionPool.Put(addOpts) // TODO: Duplicate Metrics } @@ -116,34 +134,43 @@ func NewHTTPServer(meter metric.Meter) HTTPServer { server := HTTPServer{ duplicate: duplicate, } - server.requestBytesCounter, server.responseBytesCounter, server.serverLatencyMeasure = oldHTTPServer{}.createMeasures(meter) + server.requestBytesCounter, server.responseBytesCounter, server.serverLatencyMeasure = OldHTTPServer{}.createMeasures(meter) return server } type HTTPClient struct { duplicate bool + + // old metrics + requestBytesCounter metric.Int64Counter + responseBytesCounter metric.Int64Counter + latencyMeasure metric.Float64Histogram } -func NewHTTPClient() HTTPClient { +func NewHTTPClient(meter metric.Meter) HTTPClient { env := strings.ToLower(os.Getenv("OTEL_SEMCONV_STABILITY_OPT_IN")) - return HTTPClient{duplicate: env == "http/dup"} + client := HTTPClient{ + duplicate: env == "http/dup", + } + client.requestBytesCounter, client.responseBytesCounter, client.latencyMeasure = OldHTTPClient{}.createMeasures(meter) + return client } // RequestTraceAttrs returns attributes for an HTTP request made by a client. func (c HTTPClient) RequestTraceAttrs(req *http.Request) []attribute.KeyValue { if c.duplicate { - return append(oldHTTPClient{}.RequestTraceAttrs(req), newHTTPClient{}.RequestTraceAttrs(req)...) + return append(OldHTTPClient{}.RequestTraceAttrs(req), CurrentHTTPClient{}.RequestTraceAttrs(req)...) } - return oldHTTPClient{}.RequestTraceAttrs(req) + return OldHTTPClient{}.RequestTraceAttrs(req) } // ResponseTraceAttrs returns metric attributes for an HTTP request made by a client. func (c HTTPClient) ResponseTraceAttrs(resp *http.Response) []attribute.KeyValue { if c.duplicate { - return append(oldHTTPClient{}.ResponseTraceAttrs(resp), newHTTPClient{}.ResponseTraceAttrs(resp)...) + return append(OldHTTPClient{}.ResponseTraceAttrs(resp), CurrentHTTPClient{}.ResponseTraceAttrs(resp)...) } - return oldHTTPClient{}.ResponseTraceAttrs(resp) + return OldHTTPClient{}.ResponseTraceAttrs(resp) } func (c HTTPClient) Status(code int) (codes.Code, string) { @@ -158,8 +185,53 @@ func (c HTTPClient) Status(code int) (codes.Code, string) { func (c HTTPClient) ErrorType(err error) attribute.KeyValue { if c.duplicate { - return newHTTPClient{}.ErrorType(err) + return CurrentHTTPClient{}.ErrorType(err) } return attribute.KeyValue{} } + +type MetricOpts struct { + measurement metric.MeasurementOption + addOptions metric.AddOption +} + +func (o MetricOpts) MeasurementOption() metric.MeasurementOption { + return o.measurement +} + +func (o MetricOpts) AddOptions() metric.AddOption { + return o.addOptions +} + +func (c HTTPClient) MetricOptions(ma MetricAttributes) MetricOpts { + attributes := OldHTTPClient{}.MetricAttributes(ma.Req, ma.StatusCode, ma.AdditionalAttributes) + // TODO: Duplicate Metrics + set := metric.WithAttributeSet(attribute.NewSet(attributes...)) + return MetricOpts{ + measurement: set, + addOptions: set, + } +} + +func (s HTTPClient) RecordMetrics(ctx context.Context, md MetricData, opts MetricOpts) { + if s.requestBytesCounter == nil || s.latencyMeasure == nil { + // This will happen if an HTTPClient{} is used instead of NewHTTPClient(). + return + } + + s.requestBytesCounter.Add(ctx, md.RequestSize, opts.AddOptions()) + s.latencyMeasure.Record(ctx, md.ElapsedTime, opts.MeasurementOption()) + + // TODO: Duplicate Metrics +} + +func (s HTTPClient) RecordResponseSize(ctx context.Context, responseData int64, opts metric.AddOption) { + if s.responseBytesCounter == nil { + // This will happen if an HTTPClient{} is used instead of NewHTTPClient(). + return + } + + s.responseBytesCounter.Add(ctx, responseData, opts) + // TODO: Duplicate Metrics +} diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/httpconv.go b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/httpconv.go index 745b8c67bc40c..dc9ec7bc39edd 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/httpconv.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/httpconv.go @@ -14,7 +14,7 @@ import ( semconvNew "go.opentelemetry.io/otel/semconv/v1.26.0" ) -type newHTTPServer struct{} +type CurrentHTTPServer struct{} // TraceRequest returns trace attributes for an HTTP request received by a // server. @@ -32,18 +32,18 @@ type newHTTPServer struct{} // // If the primary server name is not known, server should be an empty string. // The req Host will be used to determine the server instead. -func (n newHTTPServer) RequestTraceAttrs(server string, req *http.Request) []attribute.KeyValue { +func (n CurrentHTTPServer) RequestTraceAttrs(server string, req *http.Request) []attribute.KeyValue { count := 3 // ServerAddress, Method, Scheme var host string var p int if server == "" { - host, p = splitHostPort(req.Host) + host, p = SplitHostPort(req.Host) } else { // Prioritize the primary server name. - host, p = splitHostPort(server) + host, p = SplitHostPort(server) if p < 0 { - _, p = splitHostPort(req.Host) + _, p = SplitHostPort(req.Host) } } @@ -59,7 +59,7 @@ func (n newHTTPServer) RequestTraceAttrs(server string, req *http.Request) []att scheme := n.scheme(req.TLS != nil) - if peer, peerPort := splitHostPort(req.RemoteAddr); peer != "" { + if peer, peerPort := SplitHostPort(req.RemoteAddr); peer != "" { // The Go HTTP server sets RemoteAddr to "IP:port", this will not be a // file-path that would be interpreted with a sock family. count++ @@ -104,7 +104,7 @@ func (n newHTTPServer) RequestTraceAttrs(server string, req *http.Request) []att attrs = append(attrs, methodOriginal) } - if peer, peerPort := splitHostPort(req.RemoteAddr); peer != "" { + if peer, peerPort := SplitHostPort(req.RemoteAddr); peer != "" { // The Go HTTP server sets RemoteAddr to "IP:port", this will not be a // file-path that would be interpreted with a sock family. attrs = append(attrs, semconvNew.NetworkPeerAddress(peer)) @@ -135,7 +135,7 @@ func (n newHTTPServer) RequestTraceAttrs(server string, req *http.Request) []att return attrs } -func (n newHTTPServer) method(method string) (attribute.KeyValue, attribute.KeyValue) { +func (n CurrentHTTPServer) method(method string) (attribute.KeyValue, attribute.KeyValue) { if method == "" { return semconvNew.HTTPRequestMethodGet, attribute.KeyValue{} } @@ -150,7 +150,7 @@ func (n newHTTPServer) method(method string) (attribute.KeyValue, attribute.KeyV return semconvNew.HTTPRequestMethodGet, orig } -func (n newHTTPServer) scheme(https bool) attribute.KeyValue { // nolint:revive +func (n CurrentHTTPServer) scheme(https bool) attribute.KeyValue { // nolint:revive if https { return semconvNew.URLScheme("https") } @@ -160,7 +160,7 @@ func (n newHTTPServer) scheme(https bool) attribute.KeyValue { // nolint:revive // TraceResponse returns trace attributes for telemetry from an HTTP response. // // If any of the fields in the ResponseTelemetry are not set the attribute will be omitted. -func (n newHTTPServer) ResponseTraceAttrs(resp ResponseTelemetry) []attribute.KeyValue { +func (n CurrentHTTPServer) ResponseTraceAttrs(resp ResponseTelemetry) []attribute.KeyValue { var count int if resp.ReadBytes > 0 { @@ -195,14 +195,14 @@ func (n newHTTPServer) ResponseTraceAttrs(resp ResponseTelemetry) []attribute.Ke } // Route returns the attribute for the route. -func (n newHTTPServer) Route(route string) attribute.KeyValue { +func (n CurrentHTTPServer) Route(route string) attribute.KeyValue { return semconvNew.HTTPRoute(route) } -type newHTTPClient struct{} +type CurrentHTTPClient struct{} // RequestTraceAttrs returns trace attributes for an HTTP request made by a client. -func (n newHTTPClient) RequestTraceAttrs(req *http.Request) []attribute.KeyValue { +func (n CurrentHTTPClient) RequestTraceAttrs(req *http.Request) []attribute.KeyValue { /* below attributes are returned: - http.request.method @@ -222,7 +222,7 @@ func (n newHTTPClient) RequestTraceAttrs(req *http.Request) []attribute.KeyValue var requestHost string var requestPort int for _, hostport := range []string{urlHost, req.Header.Get("Host")} { - requestHost, requestPort = splitHostPort(hostport) + requestHost, requestPort = SplitHostPort(hostport) if requestHost != "" || requestPort > 0 { break } @@ -284,7 +284,7 @@ func (n newHTTPClient) RequestTraceAttrs(req *http.Request) []attribute.KeyValue } // ResponseTraceAttrs returns trace attributes for an HTTP response made by a client. -func (n newHTTPClient) ResponseTraceAttrs(resp *http.Response) []attribute.KeyValue { +func (n CurrentHTTPClient) ResponseTraceAttrs(resp *http.Response) []attribute.KeyValue { /* below attributes are returned: - http.response.status_code @@ -311,7 +311,7 @@ func (n newHTTPClient) ResponseTraceAttrs(resp *http.Response) []attribute.KeyVa return attrs } -func (n newHTTPClient) ErrorType(err error) attribute.KeyValue { +func (n CurrentHTTPClient) ErrorType(err error) attribute.KeyValue { t := reflect.TypeOf(err) var value string if t.PkgPath() == "" && t.Name() == "" { @@ -328,7 +328,7 @@ func (n newHTTPClient) ErrorType(err error) attribute.KeyValue { return semconvNew.ErrorTypeKey.String(value) } -func (n newHTTPClient) method(method string) (attribute.KeyValue, attribute.KeyValue) { +func (n CurrentHTTPClient) method(method string) (attribute.KeyValue, attribute.KeyValue) { if method == "" { return semconvNew.HTTPRequestMethodGet, attribute.KeyValue{} } diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/util.go b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/util.go index e6e14924f5790..93e8d0f94c115 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/util.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/util.go @@ -14,14 +14,14 @@ import ( semconvNew "go.opentelemetry.io/otel/semconv/v1.26.0" ) -// splitHostPort splits a network address hostport of the form "host", +// SplitHostPort splits a network address hostport of the form "host", // "host%zone", "[host]", "[host%zone], "host:port", "host%zone:port", // "[host]:port", "[host%zone]:port", or ":port" into host or host%zone and // port. // // An empty host is returned if it is not provided or unparsable. A negative // port is returned if it is not provided or unparsable. -func splitHostPort(hostport string) (host string, port int) { +func SplitHostPort(hostport string) (host string, port int) { port = -1 if strings.HasPrefix(hostport, "[") { diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/v1.20.0.go b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/v1.20.0.go index c999b05e675b2..c042249dd7249 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/v1.20.0.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv/v1.20.0.go @@ -17,7 +17,7 @@ import ( semconv "go.opentelemetry.io/otel/semconv/v1.20.0" ) -type oldHTTPServer struct{} +type OldHTTPServer struct{} // RequestTraceAttrs returns trace attributes for an HTTP request received by a // server. @@ -35,14 +35,14 @@ type oldHTTPServer struct{} // // If the primary server name is not known, server should be an empty string. // The req Host will be used to determine the server instead. -func (o oldHTTPServer) RequestTraceAttrs(server string, req *http.Request) []attribute.KeyValue { +func (o OldHTTPServer) RequestTraceAttrs(server string, req *http.Request) []attribute.KeyValue { return semconvutil.HTTPServerRequest(server, req) } // ResponseTraceAttrs returns trace attributes for telemetry from an HTTP response. // // If any of the fields in the ResponseTelemetry are not set the attribute will be omitted. -func (o oldHTTPServer) ResponseTraceAttrs(resp ResponseTelemetry) []attribute.KeyValue { +func (o OldHTTPServer) ResponseTraceAttrs(resp ResponseTelemetry) []attribute.KeyValue { attributes := []attribute.KeyValue{} if resp.ReadBytes > 0 { @@ -67,7 +67,7 @@ func (o oldHTTPServer) ResponseTraceAttrs(resp ResponseTelemetry) []attribute.Ke } // Route returns the attribute for the route. -func (o oldHTTPServer) Route(route string) attribute.KeyValue { +func (o OldHTTPServer) Route(route string) attribute.KeyValue { return semconv.HTTPRoute(route) } @@ -84,7 +84,7 @@ const ( serverDuration = "http.server.duration" // Incoming end to end duration, milliseconds ) -func (h oldHTTPServer) createMeasures(meter metric.Meter) (metric.Int64Counter, metric.Int64Counter, metric.Float64Histogram) { +func (h OldHTTPServer) createMeasures(meter metric.Meter) (metric.Int64Counter, metric.Int64Counter, metric.Float64Histogram) { if meter == nil { return noop.Int64Counter{}, noop.Int64Counter{}, noop.Float64Histogram{} } @@ -113,17 +113,17 @@ func (h oldHTTPServer) createMeasures(meter metric.Meter) (metric.Int64Counter, return requestBytesCounter, responseBytesCounter, serverLatencyMeasure } -func (o oldHTTPServer) MetricAttributes(server string, req *http.Request, statusCode int, additionalAttributes []attribute.KeyValue) []attribute.KeyValue { +func (o OldHTTPServer) MetricAttributes(server string, req *http.Request, statusCode int, additionalAttributes []attribute.KeyValue) []attribute.KeyValue { n := len(additionalAttributes) + 3 var host string var p int if server == "" { - host, p = splitHostPort(req.Host) + host, p = SplitHostPort(req.Host) } else { // Prioritize the primary server name. - host, p = splitHostPort(server) + host, p = SplitHostPort(server) if p < 0 { - _, p = splitHostPort(req.Host) + _, p = SplitHostPort(req.Host) } } hostPort := requiredHTTPPort(req.TLS != nil, p) @@ -144,7 +144,7 @@ func (o oldHTTPServer) MetricAttributes(server string, req *http.Request, status attributes := slices.Grow(additionalAttributes, n) attributes = append(attributes, - o.methodMetric(req.Method), + standardizeHTTPMethodMetric(req.Method), o.scheme(req.TLS != nil), semconv.NetHostName(host)) @@ -164,29 +164,111 @@ func (o oldHTTPServer) MetricAttributes(server string, req *http.Request, status return attributes } -func (o oldHTTPServer) methodMetric(method string) attribute.KeyValue { - method = strings.ToUpper(method) - switch method { - case http.MethodConnect, http.MethodDelete, http.MethodGet, http.MethodHead, http.MethodOptions, http.MethodPatch, http.MethodPost, http.MethodPut, http.MethodTrace: - default: - method = "_OTHER" - } - return semconv.HTTPMethod(method) -} - -func (o oldHTTPServer) scheme(https bool) attribute.KeyValue { // nolint:revive +func (o OldHTTPServer) scheme(https bool) attribute.KeyValue { // nolint:revive if https { return semconv.HTTPSchemeHTTPS } return semconv.HTTPSchemeHTTP } -type oldHTTPClient struct{} +type OldHTTPClient struct{} -func (o oldHTTPClient) RequestTraceAttrs(req *http.Request) []attribute.KeyValue { +func (o OldHTTPClient) RequestTraceAttrs(req *http.Request) []attribute.KeyValue { return semconvutil.HTTPClientRequest(req) } -func (o oldHTTPClient) ResponseTraceAttrs(resp *http.Response) []attribute.KeyValue { +func (o OldHTTPClient) ResponseTraceAttrs(resp *http.Response) []attribute.KeyValue { return semconvutil.HTTPClientResponse(resp) } + +func (o OldHTTPClient) MetricAttributes(req *http.Request, statusCode int, additionalAttributes []attribute.KeyValue) []attribute.KeyValue { + /* The following semantic conventions are returned if present: + http.method string + http.status_code int + net.peer.name string + net.peer.port int + */ + + n := 2 // method, peer name. + var h string + if req.URL != nil { + h = req.URL.Host + } + var requestHost string + var requestPort int + for _, hostport := range []string{h, req.Header.Get("Host")} { + requestHost, requestPort = SplitHostPort(hostport) + if requestHost != "" || requestPort > 0 { + break + } + } + + port := requiredHTTPPort(req.URL != nil && req.URL.Scheme == "https", requestPort) + if port > 0 { + n++ + } + + if statusCode > 0 { + n++ + } + + attributes := slices.Grow(additionalAttributes, n) + attributes = append(attributes, + standardizeHTTPMethodMetric(req.Method), + semconv.NetPeerName(requestHost), + ) + + if port > 0 { + attributes = append(attributes, semconv.NetPeerPort(port)) + } + + if statusCode > 0 { + attributes = append(attributes, semconv.HTTPStatusCode(statusCode)) + } + return attributes +} + +// Client HTTP metrics. +const ( + clientRequestSize = "http.client.request.size" // Incoming request bytes total + clientResponseSize = "http.client.response.size" // Incoming response bytes total + clientDuration = "http.client.duration" // Incoming end to end duration, milliseconds +) + +func (o OldHTTPClient) createMeasures(meter metric.Meter) (metric.Int64Counter, metric.Int64Counter, metric.Float64Histogram) { + if meter == nil { + return noop.Int64Counter{}, noop.Int64Counter{}, noop.Float64Histogram{} + } + requestBytesCounter, err := meter.Int64Counter( + clientRequestSize, + metric.WithUnit("By"), + metric.WithDescription("Measures the size of HTTP request messages."), + ) + handleErr(err) + + responseBytesCounter, err := meter.Int64Counter( + clientResponseSize, + metric.WithUnit("By"), + metric.WithDescription("Measures the size of HTTP response messages."), + ) + handleErr(err) + + latencyMeasure, err := meter.Float64Histogram( + clientDuration, + metric.WithUnit("ms"), + metric.WithDescription("Measures the duration of outbound HTTP requests."), + ) + handleErr(err) + + return requestBytesCounter, responseBytesCounter, latencyMeasure +} + +func standardizeHTTPMethodMetric(method string) attribute.KeyValue { + method = strings.ToUpper(method) + switch method { + case http.MethodConnect, http.MethodDelete, http.MethodGet, http.MethodHead, http.MethodOptions, http.MethodPatch, http.MethodPost, http.MethodPut, http.MethodTrace: + default: + method = "_OTHER" + } + return semconv.HTTPMethod(method) +} diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/start_time_context.go b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/start_time_context.go new file mode 100644 index 0000000000000..9476ef01b0155 --- /dev/null +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/start_time_context.go @@ -0,0 +1,29 @@ +// Copyright The OpenTelemetry Authors +// SPDX-License-Identifier: Apache-2.0 + +package otelhttp // import "go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp" + +import ( + "context" + "time" +) + +type startTimeContextKeyType int + +const startTimeContextKey startTimeContextKeyType = 0 + +// ContextWithStartTime returns a new context with the provided start time. The +// start time will be used for metrics and traces emitted by the +// instrumentation. Only one labeller can be injected into the context. +// Injecting it multiple times will override the previous calls. +func ContextWithStartTime(parent context.Context, start time.Time) context.Context { + return context.WithValue(parent, startTimeContextKey, start) +} + +// StartTimeFromContext retrieves a time.Time from the provided context if one +// is available. If no start time was found in the provided context, a new, +// zero start time is returned and the second return value is false. +func StartTimeFromContext(ctx context.Context) time.Time { + t, _ := ctx.Value(startTimeContextKey).(time.Time) + return t +} diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/transport.go b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/transport.go index b4119d3438b7d..39681ad4b0980 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/transport.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/transport.go @@ -13,11 +13,9 @@ import ( "go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/request" "go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv" - "go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconvutil" "go.opentelemetry.io/otel" "go.opentelemetry.io/otel/attribute" "go.opentelemetry.io/otel/codes" - "go.opentelemetry.io/otel/metric" "go.opentelemetry.io/otel/propagation" "go.opentelemetry.io/otel/trace" @@ -29,7 +27,6 @@ type Transport struct { rt http.RoundTripper tracer trace.Tracer - meter metric.Meter propagators propagation.TextMapPropagator spanStartOptions []trace.SpanStartOption filters []Filter @@ -37,10 +34,7 @@ type Transport struct { clientTrace func(context.Context) *httptrace.ClientTrace metricAttributesFn func(*http.Request) []attribute.KeyValue - semconv semconv.HTTPClient - requestBytesCounter metric.Int64Counter - responseBytesCounter metric.Int64Counter - latencyMeasure metric.Float64Histogram + semconv semconv.HTTPClient } var _ http.RoundTripper = &Transport{} @@ -57,8 +51,7 @@ func NewTransport(base http.RoundTripper, opts ...Option) *Transport { } t := Transport{ - rt: base, - semconv: semconv.NewHTTPClient(), + rt: base, } defaultOpts := []Option{ @@ -68,46 +61,21 @@ func NewTransport(base http.RoundTripper, opts ...Option) *Transport { c := newConfig(append(defaultOpts, opts...)...) t.applyConfig(c) - t.createMeasures() return &t } func (t *Transport) applyConfig(c *config) { t.tracer = c.Tracer - t.meter = c.Meter t.propagators = c.Propagators t.spanStartOptions = c.SpanStartOptions t.filters = c.Filters t.spanNameFormatter = c.SpanNameFormatter t.clientTrace = c.ClientTrace + t.semconv = semconv.NewHTTPClient(c.Meter) t.metricAttributesFn = c.MetricAttributesFn } -func (t *Transport) createMeasures() { - var err error - t.requestBytesCounter, err = t.meter.Int64Counter( - clientRequestSize, - metric.WithUnit("By"), - metric.WithDescription("Measures the size of HTTP request messages."), - ) - handleErr(err) - - t.responseBytesCounter, err = t.meter.Int64Counter( - clientResponseSize, - metric.WithUnit("By"), - metric.WithDescription("Measures the size of HTTP response messages."), - ) - handleErr(err) - - t.latencyMeasure, err = t.meter.Float64Histogram( - clientDuration, - metric.WithUnit("ms"), - metric.WithDescription("Measures the duration of outbound HTTP requests."), - ) - handleErr(err) -} - func defaultTransportFormatter(_ string, r *http.Request) string { return "HTTP " + r.Method } @@ -177,16 +145,15 @@ func (t *Transport) RoundTrip(r *http.Request) (*http.Response, error) { } // metrics - metricAttrs := append(append(labeler.Get(), semconvutil.HTTPClientRequestMetrics(r)...), t.metricAttributesFromRequest(r)...) - if res.StatusCode > 0 { - metricAttrs = append(metricAttrs, semconv.HTTPStatusCode(res.StatusCode)) - } - o := metric.WithAttributeSet(attribute.NewSet(metricAttrs...)) + metricOpts := t.semconv.MetricOptions(semconv.MetricAttributes{ + Req: r, + StatusCode: res.StatusCode, + AdditionalAttributes: append(labeler.Get(), t.metricAttributesFromRequest(r)...), + }) - t.requestBytesCounter.Add(ctx, bw.BytesRead(), o) // For handling response bytes we leverage a callback when the client reads the http response readRecordFunc := func(n int64) { - t.responseBytesCounter.Add(ctx, n, o) + t.semconv.RecordResponseSize(ctx, n, metricOpts.AddOptions()) } // traces @@ -198,9 +165,12 @@ func (t *Transport) RoundTrip(r *http.Request) (*http.Response, error) { // Use floating point division here for higher precision (instead of Millisecond method). elapsedTime := float64(time.Since(requestStartTime)) / float64(time.Millisecond) - t.latencyMeasure.Record(ctx, elapsedTime, o) + t.semconv.RecordMetrics(ctx, semconv.MetricData{ + RequestSize: bw.BytesRead(), + ElapsedTime: elapsedTime, + }, metricOpts) - return res, err + return res, nil } func (t *Transport) metricAttributesFromRequest(r *http.Request) []attribute.KeyValue { diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/version.go b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/version.go index 502c1bdafc791..353e43b91fd88 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/version.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/version.go @@ -5,7 +5,7 @@ package otelhttp // import "go.opentelemetry.io/contrib/instrumentation/net/http // Version is the current release version of the otelhttp instrumentation. func Version() string { - return "0.54.0" + return "0.58.0" // This string is updated by the pre_release.sh script during release } diff --git a/vendor/go.opentelemetry.io/otel/sdk/instrumentation/scope.go b/vendor/go.opentelemetry.io/otel/sdk/instrumentation/scope.go index 728115045bb4e..34852a47b2195 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/instrumentation/scope.go +++ b/vendor/go.opentelemetry.io/otel/sdk/instrumentation/scope.go @@ -3,6 +3,8 @@ package instrumentation // import "go.opentelemetry.io/otel/sdk/instrumentation" +import "go.opentelemetry.io/otel/attribute" + // Scope represents the instrumentation scope. type Scope struct { // Name is the name of the instrumentation scope. This should be the @@ -12,4 +14,6 @@ type Scope struct { Version string // SchemaURL of the telemetry emitted by the scope. SchemaURL string + // Attributes of the telemetry emitted by the scope. + Attributes attribute.Set } diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/config.go b/vendor/go.opentelemetry.io/otel/sdk/metric/config.go index bbe7bf671fd0f..203cd9d65080b 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/config.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/config.go @@ -5,17 +5,22 @@ package metric // import "go.opentelemetry.io/otel/sdk/metric" import ( "context" - "fmt" + "errors" + "os" + "strings" "sync" + "go.opentelemetry.io/otel" + "go.opentelemetry.io/otel/sdk/metric/exemplar" "go.opentelemetry.io/otel/sdk/resource" ) // config contains configuration options for a MeterProvider. type config struct { - res *resource.Resource - readers []Reader - views []View + res *resource.Resource + readers []Reader + views []View + exemplarFilter exemplar.Filter } // readerSignals returns a force-flush and shutdown function for a @@ -39,25 +44,13 @@ func (c config) readerSignals() (forceFlush, shutdown func(context.Context) erro // value. func unify(funcs []func(context.Context) error) func(context.Context) error { return func(ctx context.Context) error { - var errs []error + var err error for _, f := range funcs { - if err := f(ctx); err != nil { - errs = append(errs, err) + if e := f(ctx); e != nil { + err = errors.Join(err, e) } } - return unifyErrors(errs) - } -} - -// unifyErrors combines multiple errors into a single error. -func unifyErrors(errs []error) error { - switch len(errs) { - case 0: - return nil - case 1: - return errs[0] - default: - return fmt.Errorf("%v", errs) + return err } } @@ -75,7 +68,13 @@ func unifyShutdown(funcs []func(context.Context) error) func(context.Context) er // newConfig returns a config configured with options. func newConfig(options []Option) config { - conf := config{res: resource.Default()} + conf := config{ + res: resource.Default(), + exemplarFilter: exemplar.TraceBasedFilter, + } + for _, o := range meterProviderOptionsFromEnv() { + conf = o.apply(conf) + } for _, o := range options { conf = o.apply(conf) } @@ -103,7 +102,11 @@ func (o optionFunc) apply(conf config) config { // go.opentelemetry.io/otel/sdk/resource package will be used. func WithResource(res *resource.Resource) Option { return optionFunc(func(conf config) config { - conf.res = res + var err error + conf.res, err = resource.Merge(resource.Environment(), res) + if err != nil { + otel.Handle(err) + } return conf }) } @@ -135,3 +138,35 @@ func WithView(views ...View) Option { return cfg }) } + +// WithExemplarFilter configures the exemplar filter. +// +// The exemplar filter determines which measurements are offered to the +// exemplar reservoir, but the exemplar reservoir makes the final decision of +// whether to store an exemplar. +// +// By default, the [exemplar.SampledFilter] +// is used. Exemplars can be entirely disabled by providing the +// [exemplar.AlwaysOffFilter]. +func WithExemplarFilter(filter exemplar.Filter) Option { + return optionFunc(func(cfg config) config { + cfg.exemplarFilter = filter + return cfg + }) +} + +func meterProviderOptionsFromEnv() []Option { + var opts []Option + // https://github.com/open-telemetry/opentelemetry-specification/blob/d4b241f451674e8f611bb589477680341006ad2b/specification/configuration/sdk-environment-variables.md#exemplar + const filterEnvKey = "OTEL_METRICS_EXEMPLAR_FILTER" + + switch strings.ToLower(strings.TrimSpace(os.Getenv(filterEnvKey))) { + case "always_on": + opts = append(opts, WithExemplarFilter(exemplar.AlwaysOnFilter)) + case "always_off": + opts = append(opts, WithExemplarFilter(exemplar.AlwaysOffFilter)) + case "trace_based": + opts = append(opts, WithExemplarFilter(exemplar.TraceBasedFilter)) + } + return opts +} diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar.go b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar.go index 82619da78ec15..0335b8ae48e23 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar.go @@ -4,51 +4,49 @@ package metric // import "go.opentelemetry.io/otel/sdk/metric" import ( - "os" "runtime" - "slices" - "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" - "go.opentelemetry.io/otel/sdk/metric/internal/x" + "go.opentelemetry.io/otel/attribute" + "go.opentelemetry.io/otel/sdk/metric/exemplar" + "go.opentelemetry.io/otel/sdk/metric/internal/aggregate" ) -// reservoirFunc returns the appropriately configured exemplar reservoir -// creation func based on the passed InstrumentKind and user defined -// environment variables. -// -// Note: This will only return non-nil values when the experimental exemplar -// feature is enabled and the OTEL_METRICS_EXEMPLAR_FILTER environment variable -// is not set to always_off. -func reservoirFunc[N int64 | float64](agg Aggregation) func() exemplar.FilteredReservoir[N] { - if !x.Exemplars.Enabled() { - return nil - } - // https://github.com/open-telemetry/opentelemetry-specification/blob/d4b241f451674e8f611bb589477680341006ad2b/specification/configuration/sdk-environment-variables.md#exemplar - const filterEnvKey = "OTEL_METRICS_EXEMPLAR_FILTER" +// ExemplarReservoirProviderSelector selects the +// [exemplar.ReservoirProvider] to use +// based on the [Aggregation] of the metric. +type ExemplarReservoirProviderSelector func(Aggregation) exemplar.ReservoirProvider - var filter exemplar.Filter - - switch os.Getenv(filterEnvKey) { - case "always_on": - filter = exemplar.AlwaysOnFilter - case "always_off": - return exemplar.Drop - case "trace_based": - fallthrough - default: - filter = exemplar.SampledFilter +// reservoirFunc returns the appropriately configured exemplar reservoir +// creation func based on the passed InstrumentKind and filter configuration. +func reservoirFunc[N int64 | float64](provider exemplar.ReservoirProvider, filter exemplar.Filter) func(attribute.Set) aggregate.FilteredExemplarReservoir[N] { + return func(attrs attribute.Set) aggregate.FilteredExemplarReservoir[N] { + return aggregate.NewFilteredExemplarReservoir[N](filter, provider(attrs)) } +} +// DefaultExemplarReservoirProviderSelector returns the default +// [exemplar.ReservoirProvider] for the +// provided [Aggregation]. +// +// For explicit bucket histograms with more than 1 bucket, it uses the +// [exemplar.HistogramReservoirProvider]. +// For exponential histograms, it uses the +// [exemplar.FixedSizeReservoirProvider] +// with a size of min(20, max_buckets). +// For all other aggregations, it uses the +// [exemplar.FixedSizeReservoirProvider] +// with a size equal to the number of CPUs. +// +// Exemplar default reservoirs MAY change in a minor version bump. No +// guarantees are made on the shape or statistical properties of returned +// exemplars. +func DefaultExemplarReservoirProviderSelector(agg Aggregation) exemplar.ReservoirProvider { // https://github.com/open-telemetry/opentelemetry-specification/blob/d4b241f451674e8f611bb589477680341006ad2b/specification/metrics/sdk.md#exemplar-defaults // Explicit bucket histogram aggregation with more than 1 bucket will // use AlignedHistogramBucketExemplarReservoir. a, ok := agg.(AggregationExplicitBucketHistogram) if ok && len(a.Boundaries) > 0 { - cp := slices.Clone(a.Boundaries) - return func() exemplar.FilteredReservoir[N] { - bounds := cp - return exemplar.NewFilteredReservoir[N](filter, exemplar.Histogram(bounds)) - } + return exemplar.HistogramReservoirProvider(a.Boundaries) } var n int @@ -75,7 +73,5 @@ func reservoirFunc[N int64 | float64](agg Aggregation) func() exemplar.FilteredR } } - return func() exemplar.FilteredReservoir[N] { - return exemplar.NewFilteredReservoir[N](filter, exemplar.FixedSize(n)) - } + return exemplar.FixedSizeReservoirProvider(n) } diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/README.md b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/README.md new file mode 100644 index 0000000000000..d1025f5eb894d --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/README.md @@ -0,0 +1,3 @@ +# Metric SDK Exemplars + +[![PkgGoDev](https://pkg.go.dev/badge/go.opentelemetry.io/otel/sdk/metric/exemplar)](https://pkg.go.dev/go.opentelemetry.io/otel/sdk/metric/exemplar) diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/doc.go b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/doc.go similarity index 93% rename from vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/doc.go rename to vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/doc.go index 5394f48e0dfb9..9f238937688db 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/doc.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/doc.go @@ -3,4 +3,4 @@ // Package exemplar provides an implementation of the OpenTelemetry exemplar // reservoir to be used in metric collection pipelines. -package exemplar // import "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" +package exemplar // import "go.opentelemetry.io/otel/sdk/metric/exemplar" diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/exemplar.go b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/exemplar.go similarity index 98% rename from vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/exemplar.go rename to vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/exemplar.go index fcaa6a4697ca8..1ab69467868ac 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/exemplar.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/exemplar.go @@ -1,7 +1,7 @@ // Copyright The OpenTelemetry Authors // SPDX-License-Identifier: Apache-2.0 -package exemplar // import "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" +package exemplar // import "go.opentelemetry.io/otel/sdk/metric/exemplar" import ( "time" diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/filter.go b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/filter.go similarity index 75% rename from vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/filter.go rename to vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/filter.go index 152a069a09e94..b595e2acef3d6 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/filter.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/filter.go @@ -1,7 +1,7 @@ // Copyright The OpenTelemetry Authors // SPDX-License-Identifier: Apache-2.0 -package exemplar // import "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" +package exemplar // import "go.opentelemetry.io/otel/sdk/metric/exemplar" import ( "context" @@ -16,10 +16,10 @@ import ( // Reservoir in making a sampling decision. type Filter func(context.Context) bool -// SampledFilter is a [Filter] that will only offer measurements +// TraceBasedFilter is a [Filter] that will only offer measurements // if the passed context associated with the measurement contains a sampled // [go.opentelemetry.io/otel/trace.SpanContext]. -func SampledFilter(ctx context.Context) bool { +func TraceBasedFilter(ctx context.Context) bool { return trace.SpanContextFromContext(ctx).IsSampled() } @@ -27,3 +27,8 @@ func SampledFilter(ctx context.Context) bool { func AlwaysOnFilter(ctx context.Context) bool { return true } + +// AlwaysOffFilter is a [Filter] that never offers measurements. +func AlwaysOffFilter(ctx context.Context) bool { + return false +} diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/rand.go b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/fixed_size_reservoir.go similarity index 73% rename from vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/rand.go rename to vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/fixed_size_reservoir.go index 199a2608f7180..d4aab0aad4f83 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/rand.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/fixed_size_reservoir.go @@ -1,31 +1,69 @@ // Copyright The OpenTelemetry Authors // SPDX-License-Identifier: Apache-2.0 -package exemplar // import "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" +package exemplar // import "go.opentelemetry.io/otel/sdk/metric/exemplar" import ( "context" "math" "math/rand" - "sync" "time" "go.opentelemetry.io/otel/attribute" ) -var ( +// FixedSizeReservoirProvider returns a provider of [FixedSizeReservoir]. +func FixedSizeReservoirProvider(k int) ReservoirProvider { + return func(_ attribute.Set) Reservoir { + return NewFixedSizeReservoir(k) + } +} + +// NewFixedSizeReservoir returns a [FixedSizeReservoir] that samples at most +// k exemplars. If there are k or less measurements made, the Reservoir will +// sample each one. If there are more than k, the Reservoir will then randomly +// sample all additional measurement with a decreasing probability. +func NewFixedSizeReservoir(k int) *FixedSizeReservoir { + return newFixedSizeReservoir(newStorage(k)) +} + +var _ Reservoir = &FixedSizeReservoir{} + +// FixedSizeReservoir is a [Reservoir] that samples at most k exemplars. If +// there are k or less measurements made, the Reservoir will sample each one. +// If there are more than k, the Reservoir will then randomly sample all +// additional measurement with a decreasing probability. +type FixedSizeReservoir struct { + *storage + + // count is the number of measurement seen. + count int64 + // next is the next count that will store a measurement at a random index + // once the reservoir has been filled. + next int64 + // w is the largest random number in a distribution that is used to compute + // the next next. + w float64 + // rng is used to make sampling decisions. // // Do not use crypto/rand. There is no reason for the decrease in performance // given this is not a security sensitive decision. - rng = rand.New(rand.NewSource(time.Now().UnixNano())) - // Ensure concurrent safe accecess to rng and its underlying source. - rngMu sync.Mutex -) + rng *rand.Rand +} -// random returns, as a float64, a uniform pseudo-random number in the open -// interval (0.0,1.0). -func random() float64 { +func newFixedSizeReservoir(s *storage) *FixedSizeReservoir { + r := &FixedSizeReservoir{ + storage: s, + rng: rand.New(rand.NewSource(time.Now().UnixNano())), + } + r.reset() + return r +} + +// randomFloat64 returns, as a float64, a uniform pseudo-random number in the +// open interval (0.0,1.0). +func (r *FixedSizeReservoir) randomFloat64() float64 { // TODO: This does not return a uniform number. rng.Float64 returns a // uniformly random int in [0,2^53) that is divided by 2^53. Meaning it // returns multiples of 2^-53, and not all floating point numbers between 0 @@ -43,40 +81,25 @@ func random() float64 { // // There are likely many other methods to explore here as well. - rngMu.Lock() - defer rngMu.Unlock() - - f := rng.Float64() + f := r.rng.Float64() for f == 0 { - f = rng.Float64() + f = r.rng.Float64() } return f } -// FixedSize returns a [Reservoir] that samples at most k exemplars. If there -// are k or less measurements made, the Reservoir will sample each one. If -// there are more than k, the Reservoir will then randomly sample all -// additional measurement with a decreasing probability. -func FixedSize(k int) Reservoir { - r := &randRes{storage: newStorage(k)} - r.reset() - return r -} - -type randRes struct { - *storage - - // count is the number of measurement seen. - count int64 - // next is the next count that will store a measurement at a random index - // once the reservoir has been filled. - next int64 - // w is the largest random number in a distribution that is used to compute - // the next next. - w float64 -} - -func (r *randRes) Offer(ctx context.Context, t time.Time, n Value, a []attribute.KeyValue) { +// Offer accepts the parameters associated with a measurement. The +// parameters will be stored as an exemplar if the Reservoir decides to +// sample the measurement. +// +// The passed ctx needs to contain any baggage or span that were active +// when the measurement was made. This information may be used by the +// Reservoir in making a sampling decision. +// +// The time t is the time when the measurement was made. The v and a +// parameters are the value and dropped (filtered) attributes of the +// measurement respectively. +func (r *FixedSizeReservoir) Offer(ctx context.Context, t time.Time, n Value, a []attribute.KeyValue) { // The following algorithm is "Algorithm L" from Li, Kim-Hung (4 December // 1994). "Reservoir-Sampling Algorithms of Time Complexity // O(n(1+log(N/n)))". ACM Transactions on Mathematical Software. 20 (4): @@ -123,7 +146,7 @@ func (r *randRes) Offer(ctx context.Context, t time.Time, n Value, a []attribute } else { if r.count == r.next { // Overwrite a random existing measurement with the one offered. - idx := int(rng.Int63n(int64(cap(r.store)))) + idx := int(r.rng.Int63n(int64(cap(r.store)))) r.store[idx] = newMeasurement(ctx, t, n, a) r.advance() } @@ -132,7 +155,7 @@ func (r *randRes) Offer(ctx context.Context, t time.Time, n Value, a []attribute } // reset resets r to the initial state. -func (r *randRes) reset() { +func (r *FixedSizeReservoir) reset() { // This resets the number of exemplars known. r.count = 0 // Random index inserts should only happen after the storage is full. @@ -147,14 +170,14 @@ func (r *randRes) reset() { // This maps the uniform random number in (0,1) to a geometric distribution // over the same interval. The mean of the distribution is inversely // proportional to the storage capacity. - r.w = math.Exp(math.Log(random()) / float64(cap(r.store))) + r.w = math.Exp(math.Log(r.randomFloat64()) / float64(cap(r.store))) r.advance() } // advance updates the count at which the offered measurement will overwrite an // existing exemplar. -func (r *randRes) advance() { +func (r *FixedSizeReservoir) advance() { // Calculate the next value in the random number series. // // The current value of r.w is based on the max of a distribution of random @@ -167,7 +190,7 @@ func (r *randRes) advance() { // therefore the next r.w will be based on the same distribution (i.e. // `max(u_1,u_2,...,u_k)`). Therefore, we can sample the next r.w by // computing the next random number `u` and take r.w as `w * u^(1/k)`. - r.w *= math.Exp(math.Log(random()) / float64(cap(r.store))) + r.w *= math.Exp(math.Log(r.randomFloat64()) / float64(cap(r.store))) // Use the new random number in the series to calculate the count of the // next measurement that will be stored. // @@ -178,10 +201,13 @@ func (r *randRes) advance() { // // Important to note, the new r.next will always be at least 1 more than // the last r.next. - r.next += int64(math.Log(random())/math.Log(1-r.w)) + 1 + r.next += int64(math.Log(r.randomFloat64())/math.Log(1-r.w)) + 1 } -func (r *randRes) Collect(dest *[]Exemplar) { +// Collect returns all the held exemplars. +// +// The Reservoir state is preserved after this call. +func (r *FixedSizeReservoir) Collect(dest *[]Exemplar) { r.storage.Collect(dest) // Call reset here even though it will reset r.count and restart the random // number series. This will persist any old exemplars as long as no new diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/histogram_reservoir.go b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/histogram_reservoir.go new file mode 100644 index 0000000000000..3b76cf305a426 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/histogram_reservoir.go @@ -0,0 +1,70 @@ +// Copyright The OpenTelemetry Authors +// SPDX-License-Identifier: Apache-2.0 + +package exemplar // import "go.opentelemetry.io/otel/sdk/metric/exemplar" + +import ( + "context" + "slices" + "sort" + "time" + + "go.opentelemetry.io/otel/attribute" +) + +// HistogramReservoirProvider is a provider of [HistogramReservoir]. +func HistogramReservoirProvider(bounds []float64) ReservoirProvider { + cp := slices.Clone(bounds) + slices.Sort(cp) + return func(_ attribute.Set) Reservoir { + return NewHistogramReservoir(cp) + } +} + +// NewHistogramReservoir returns a [HistogramReservoir] that samples the last +// measurement that falls within a histogram bucket. The histogram bucket +// upper-boundaries are define by bounds. +// +// The passed bounds must be sorted before calling this function. +func NewHistogramReservoir(bounds []float64) *HistogramReservoir { + return &HistogramReservoir{ + bounds: bounds, + storage: newStorage(len(bounds) + 1), + } +} + +var _ Reservoir = &HistogramReservoir{} + +// HistogramReservoir is a [Reservoir] that samples the last measurement that +// falls within a histogram bucket. The histogram bucket upper-boundaries are +// define by bounds. +type HistogramReservoir struct { + *storage + + // bounds are bucket bounds in ascending order. + bounds []float64 +} + +// Offer accepts the parameters associated with a measurement. The +// parameters will be stored as an exemplar if the Reservoir decides to +// sample the measurement. +// +// The passed ctx needs to contain any baggage or span that were active +// when the measurement was made. This information may be used by the +// Reservoir in making a sampling decision. +// +// The time t is the time when the measurement was made. The v and a +// parameters are the value and dropped (filtered) attributes of the +// measurement respectively. +func (r *HistogramReservoir) Offer(ctx context.Context, t time.Time, v Value, a []attribute.KeyValue) { + var x float64 + switch v.Type() { + case Int64ValueType: + x = float64(v.Int64()) + case Float64ValueType: + x = v.Float64() + default: + panic("unknown value type") + } + r.store[sort.SearchFloat64s(r.bounds, x)] = newMeasurement(ctx, t, v, a) +} diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/reservoir.go b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/reservoir.go similarity index 73% rename from vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/reservoir.go rename to vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/reservoir.go index 80fa59554f201..ba5cd1a6b3d7e 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/reservoir.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/reservoir.go @@ -1,7 +1,7 @@ // Copyright The OpenTelemetry Authors // SPDX-License-Identifier: Apache-2.0 -package exemplar // import "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" +package exemplar // import "go.opentelemetry.io/otel/sdk/metric/exemplar" import ( "context" @@ -30,3 +30,11 @@ type Reservoir interface { // The Reservoir state is preserved after this call. Collect(dest *[]Exemplar) } + +// ReservoirProvider creates new [Reservoir]s. +// +// The attributes provided are attributes which are kept by the aggregation, and +// are exclusive with attributes passed to Offer. The combination of these +// attributes and the attributes passed to Offer is the complete set of +// attributes a measurement was made with. +type ReservoirProvider func(attr attribute.Set) Reservoir diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/storage.go b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/storage.go similarity index 94% rename from vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/storage.go rename to vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/storage.go index 10b2976f7969a..0e2e26dfb18db 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/storage.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/storage.go @@ -1,7 +1,7 @@ // Copyright The OpenTelemetry Authors // SPDX-License-Identifier: Apache-2.0 -package exemplar // import "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" +package exemplar // import "go.opentelemetry.io/otel/sdk/metric/exemplar" import ( "context" @@ -35,7 +35,7 @@ func (r *storage) Collect(dest *[]Exemplar) { continue } - m.Exemplar(&(*dest)[n]) + m.exemplar(&(*dest)[n]) n++ } *dest = (*dest)[:n] @@ -66,8 +66,8 @@ func newMeasurement(ctx context.Context, ts time.Time, v Value, droppedAttr []at } } -// Exemplar returns m as an [Exemplar]. -func (m measurement) Exemplar(dest *Exemplar) { +// exemplar returns m as an [Exemplar]. +func (m measurement) exemplar(dest *Exemplar) { dest.FilteredAttributes = m.FilteredAttributes dest.Time = m.Time dest.Value = m.Value diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/value.go b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/value.go similarity index 91% rename from vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/value.go rename to vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/value.go index 1957d6b1e3a37..590b089a806cc 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/value.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/exemplar/value.go @@ -1,7 +1,7 @@ // Copyright The OpenTelemetry Authors // SPDX-License-Identifier: Apache-2.0 -package exemplar // import "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" +package exemplar // import "go.opentelemetry.io/otel/sdk/metric/exemplar" import "math" @@ -28,7 +28,8 @@ type Value struct { func NewValue[N int64 | float64](value N) Value { switch v := any(value).(type) { case int64: - return Value{t: Int64ValueType, val: uint64(v)} + // This can be later converted back to int64 (overflow not checked). + return Value{t: Int64ValueType, val: uint64(v)} // nolint:gosec case float64: return Value{t: Float64ValueType, val: math.Float64bits(v)} } diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/exporter.go b/vendor/go.opentelemetry.io/otel/sdk/metric/exporter.go index 1a3cccb67755e..1969cb42cf441 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/exporter.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/exporter.go @@ -5,14 +5,14 @@ package metric // import "go.opentelemetry.io/otel/sdk/metric" import ( "context" - "fmt" + "errors" "go.opentelemetry.io/otel/sdk/metric/metricdata" ) // ErrExporterShutdown is returned if Export or Shutdown are called after an // Exporter has been Shutdown. -var ErrExporterShutdown = fmt.Errorf("exporter is shutdown") +var ErrExporterShutdown = errors.New("exporter is shutdown") // Exporter handles the delivery of metric data to external receivers. This is // the final component in the metric push pipeline. diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/instrument.go b/vendor/go.opentelemetry.io/otel/sdk/metric/instrument.go index b52a330b3bc10..c33e1a28cb41b 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/instrument.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/instrument.go @@ -16,6 +16,7 @@ import ( "go.opentelemetry.io/otel/metric/embedded" "go.opentelemetry.io/otel/sdk/instrumentation" "go.opentelemetry.io/otel/sdk/metric/internal/aggregate" + "go.opentelemetry.io/otel/sdk/metric/internal/x" ) var zeroScope instrumentation.Scope @@ -144,6 +145,12 @@ type Stream struct { // Use NewAllowKeysFilter from "go.opentelemetry.io/otel/attribute" to // provide an allow-list of attribute keys here. AttributeFilter attribute.Filter + // ExemplarReservoirProvider selects the + // [go.opentelemetry.io/otel/sdk/metric/exemplar.ReservoirProvider] based + // on the [Aggregation]. + // + // If unspecified, [DefaultExemplarReservoirProviderSelector] is used. + ExemplarReservoirProviderSelector ExemplarReservoirProviderSelector } // instID are the identifying properties of a instrument. @@ -184,6 +191,7 @@ var ( _ metric.Int64UpDownCounter = (*int64Inst)(nil) _ metric.Int64Histogram = (*int64Inst)(nil) _ metric.Int64Gauge = (*int64Inst)(nil) + _ x.EnabledInstrument = (*int64Inst)(nil) ) func (i *int64Inst) Add(ctx context.Context, val int64, opts ...metric.AddOption) { @@ -196,6 +204,10 @@ func (i *int64Inst) Record(ctx context.Context, val int64, opts ...metric.Record i.aggregate(ctx, val, c.Attributes()) } +func (i *int64Inst) Enabled(_ context.Context) bool { + return len(i.measures) != 0 +} + func (i *int64Inst) aggregate(ctx context.Context, val int64, s attribute.Set) { // nolint:revive // okay to shadow pkg with method. for _, in := range i.measures { in(ctx, val, s) @@ -216,6 +228,7 @@ var ( _ metric.Float64UpDownCounter = (*float64Inst)(nil) _ metric.Float64Histogram = (*float64Inst)(nil) _ metric.Float64Gauge = (*float64Inst)(nil) + _ x.EnabledInstrument = (*float64Inst)(nil) ) func (i *float64Inst) Add(ctx context.Context, val float64, opts ...metric.AddOption) { @@ -228,14 +241,18 @@ func (i *float64Inst) Record(ctx context.Context, val float64, opts ...metric.Re i.aggregate(ctx, val, c.Attributes()) } +func (i *float64Inst) Enabled(_ context.Context) bool { + return len(i.measures) != 0 +} + func (i *float64Inst) aggregate(ctx context.Context, val float64, s attribute.Set) { for _, in := range i.measures { in(ctx, val, s) } } -// observablID is a comparable unique identifier of an observable. -type observablID[N int64 | float64] struct { +// observableID is a comparable unique identifier of an observable. +type observableID[N int64 | float64] struct { name string description string kind InstrumentKind @@ -287,7 +304,7 @@ func newInt64Observable(m *meter, kind InstrumentKind, name, desc, u string) int type observable[N int64 | float64] struct { metric.Observable - observablID[N] + observableID[N] meter *meter measures measures[N] @@ -296,7 +313,7 @@ type observable[N int64 | float64] struct { func newObservable[N int64 | float64](m *meter, kind InstrumentKind, name, desc, u string) *observable[N] { return &observable[N]{ - observablID: observablID[N]{ + observableID: observableID[N]{ name: name, description: desc, kind: kind, diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/aggregate.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/aggregate.go index b18ee719bd19a..fde2193338960 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/aggregate.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/aggregate.go @@ -8,7 +8,6 @@ import ( "time" "go.opentelemetry.io/otel/attribute" - "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" "go.opentelemetry.io/otel/sdk/metric/metricdata" ) @@ -38,8 +37,8 @@ type Builder[N int64 | float64] struct { // create new exemplar reservoirs for a new seen attribute set. // // If this is not provided a default factory function that returns an - // exemplar.Drop reservoir will be used. - ReservoirFunc func() exemplar.FilteredReservoir[N] + // dropReservoir reservoir will be used. + ReservoirFunc func(attribute.Set) FilteredExemplarReservoir[N] // AggregationLimit is the cardinality limit of measurement attributes. Any // measurement for new attributes once the limit has been reached will be // aggregated into a single aggregate for the "otel.metric.overflow" @@ -50,12 +49,12 @@ type Builder[N int64 | float64] struct { AggregationLimit int } -func (b Builder[N]) resFunc() func() exemplar.FilteredReservoir[N] { +func (b Builder[N]) resFunc() func(attribute.Set) FilteredExemplarReservoir[N] { if b.ReservoirFunc != nil { return b.ReservoirFunc } - return exemplar.Drop + return dropReservoir } type fltrMeasure[N int64 | float64] func(ctx context.Context, value N, fltrAttr attribute.Set, droppedAttr []attribute.KeyValue) diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/drop.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/drop.go new file mode 100644 index 0000000000000..8396faaa4aec0 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/drop.go @@ -0,0 +1,27 @@ +// Copyright The OpenTelemetry Authors +// SPDX-License-Identifier: Apache-2.0 + +package aggregate // import "go.opentelemetry.io/otel/sdk/metric/internal/aggregate" + +import ( + "context" + + "go.opentelemetry.io/otel/attribute" + "go.opentelemetry.io/otel/sdk/metric/exemplar" +) + +// dropReservoir returns a [FilteredReservoir] that drops all measurements it is offered. +func dropReservoir[N int64 | float64](attribute.Set) FilteredExemplarReservoir[N] { + return &dropRes[N]{} +} + +type dropRes[N int64 | float64] struct{} + +// Offer does nothing, all measurements offered will be dropped. +func (r *dropRes[N]) Offer(context.Context, N, []attribute.KeyValue) {} + +// Collect resets dest. No exemplars will ever be returned. +func (r *dropRes[N]) Collect(dest *[]exemplar.Exemplar) { + clear(*dest) // Erase elements to let GC collect objects + *dest = (*dest)[:0] +} diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/exemplar.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/exemplar.go index 170ae8e58e2a2..25d709948e9c9 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/exemplar.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/exemplar.go @@ -6,7 +6,7 @@ package aggregate // import "go.opentelemetry.io/otel/sdk/metric/internal/aggreg import ( "sync" - "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" + "go.opentelemetry.io/otel/sdk/metric/exemplar" "go.opentelemetry.io/otel/sdk/metric/metricdata" ) @@ -17,6 +17,7 @@ var exemplarPool = sync.Pool{ func collectExemplars[N int64 | float64](out *[]metricdata.Exemplar[N], f func(*[]exemplar.Exemplar)) { dest := exemplarPool.Get().(*[]exemplar.Exemplar) defer func() { + clear(*dest) // Erase elements to let GC collect objects. *dest = (*dest)[:0] exemplarPool.Put(dest) }() diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/exponential_histogram.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/exponential_histogram.go index 707342408acd2..336ea91d1bf4c 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/exponential_histogram.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/exponential_histogram.go @@ -12,7 +12,6 @@ import ( "go.opentelemetry.io/otel" "go.opentelemetry.io/otel/attribute" - "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" "go.opentelemetry.io/otel/sdk/metric/metricdata" ) @@ -31,7 +30,7 @@ const ( // expoHistogramDataPoint is a single data point in an exponential histogram. type expoHistogramDataPoint[N int64 | float64] struct { attrs attribute.Set - res exemplar.FilteredReservoir[N] + res FilteredExemplarReservoir[N] count uint64 min N @@ -51,16 +50,16 @@ type expoHistogramDataPoint[N int64 | float64] struct { func newExpoHistogramDataPoint[N int64 | float64](attrs attribute.Set, maxSize int, maxScale int32, noMinMax, noSum bool) *expoHistogramDataPoint[N] { f := math.MaxFloat64 - max := N(f) // if N is int64, max will overflow to -9223372036854775808 - min := N(-f) + ma := N(f) // if N is int64, max will overflow to -9223372036854775808 + mi := N(-f) if N(maxInt64) > N(f) { - max = N(maxInt64) - min = N(minInt64) + ma = N(maxInt64) + mi = N(minInt64) } return &expoHistogramDataPoint[N]{ attrs: attrs, - min: max, - max: min, + min: ma, + max: mi, maxSize: maxSize, noMinMax: noMinMax, noSum: noSum, @@ -284,7 +283,7 @@ func (b *expoBuckets) downscale(delta int32) { // newExponentialHistogram returns an Aggregator that summarizes a set of // measurements as an exponential histogram. Each histogram is scoped by attributes // and the aggregation cycle the measurements were made in. -func newExponentialHistogram[N int64 | float64](maxSize, maxScale int32, noMinMax, noSum bool, limit int, r func() exemplar.FilteredReservoir[N]) *expoHistogram[N] { +func newExponentialHistogram[N int64 | float64](maxSize, maxScale int32, noMinMax, noSum bool, limit int, r func(attribute.Set) FilteredExemplarReservoir[N]) *expoHistogram[N] { return &expoHistogram[N]{ noSum: noSum, noMinMax: noMinMax, @@ -307,7 +306,7 @@ type expoHistogram[N int64 | float64] struct { maxSize int maxScale int32 - newRes func() exemplar.FilteredReservoir[N] + newRes func(attribute.Set) FilteredExemplarReservoir[N] limit limiter[*expoHistogramDataPoint[N]] values map[attribute.Distinct]*expoHistogramDataPoint[N] valuesMu sync.Mutex @@ -328,7 +327,7 @@ func (e *expoHistogram[N]) measure(ctx context.Context, value N, fltrAttr attrib v, ok := e.values[attr.Equivalent()] if !ok { v = newExpoHistogramDataPoint[N](attr, e.maxSize, e.maxScale, e.noMinMax, e.noSum) - v.res = e.newRes() + v.res = e.newRes(attr) e.values[attr.Equivalent()] = v } diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/filtered_reservoir.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/filtered_reservoir.go new file mode 100644 index 0000000000000..691a910608d3f --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/filtered_reservoir.go @@ -0,0 +1,50 @@ +// Copyright The OpenTelemetry Authors +// SPDX-License-Identifier: Apache-2.0 + +package aggregate // import "go.opentelemetry.io/otel/sdk/metric/internal/aggregate" + +import ( + "context" + "time" + + "go.opentelemetry.io/otel/attribute" + "go.opentelemetry.io/otel/sdk/metric/exemplar" +) + +// FilteredExemplarReservoir wraps a [exemplar.Reservoir] with a filter. +type FilteredExemplarReservoir[N int64 | float64] interface { + // Offer accepts the parameters associated with a measurement. The + // parameters will be stored as an exemplar if the filter decides to + // sample the measurement. + // + // The passed ctx needs to contain any baggage or span that were active + // when the measurement was made. This information may be used by the + // Reservoir in making a sampling decision. + Offer(ctx context.Context, val N, attr []attribute.KeyValue) + // Collect returns all the held exemplars in the reservoir. + Collect(dest *[]exemplar.Exemplar) +} + +// filteredExemplarReservoir handles the pre-sampled exemplar of measurements made. +type filteredExemplarReservoir[N int64 | float64] struct { + filter exemplar.Filter + reservoir exemplar.Reservoir +} + +// NewFilteredExemplarReservoir creates a [FilteredExemplarReservoir] which only offers values +// that are allowed by the filter. +func NewFilteredExemplarReservoir[N int64 | float64](f exemplar.Filter, r exemplar.Reservoir) FilteredExemplarReservoir[N] { + return &filteredExemplarReservoir[N]{ + filter: f, + reservoir: r, + } +} + +func (f *filteredExemplarReservoir[N]) Offer(ctx context.Context, val N, attr []attribute.KeyValue) { + if f.filter(ctx) { + // only record the current time if we are sampling this measurement. + f.reservoir.Offer(ctx, time.Now(), exemplar.NewValue(val), attr) + } +} + +func (f *filteredExemplarReservoir[N]) Collect(dest *[]exemplar.Exemplar) { f.reservoir.Collect(dest) } diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/histogram.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/histogram.go index ade0941f5f5db..d577ae2c198f4 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/histogram.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/histogram.go @@ -11,13 +11,12 @@ import ( "time" "go.opentelemetry.io/otel/attribute" - "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" "go.opentelemetry.io/otel/sdk/metric/metricdata" ) type buckets[N int64 | float64] struct { attrs attribute.Set - res exemplar.FilteredReservoir[N] + res FilteredExemplarReservoir[N] counts []uint64 count uint64 @@ -48,13 +47,13 @@ type histValues[N int64 | float64] struct { noSum bool bounds []float64 - newRes func() exemplar.FilteredReservoir[N] + newRes func(attribute.Set) FilteredExemplarReservoir[N] limit limiter[*buckets[N]] values map[attribute.Distinct]*buckets[N] valuesMu sync.Mutex } -func newHistValues[N int64 | float64](bounds []float64, noSum bool, limit int, r func() exemplar.FilteredReservoir[N]) *histValues[N] { +func newHistValues[N int64 | float64](bounds []float64, noSum bool, limit int, r func(attribute.Set) FilteredExemplarReservoir[N]) *histValues[N] { // The responsibility of keeping all buckets correctly associated with the // passed boundaries is ultimately this type's responsibility. Make a copy // here so we can always guarantee this. Or, in the case of failure, have @@ -94,7 +93,7 @@ func (s *histValues[N]) measure(ctx context.Context, value N, fltrAttr attribute // // buckets = (-∞, 0], (0, 5.0], (5.0, 10.0], (10.0, +∞) b = newBuckets[N](attr, len(s.bounds)+1) - b.res = s.newRes() + b.res = s.newRes(attr) // Ensure min and max are recorded values (not zero), for new buckets. b.min, b.max = value, value @@ -109,7 +108,7 @@ func (s *histValues[N]) measure(ctx context.Context, value N, fltrAttr attribute // newHistogram returns an Aggregator that summarizes a set of measurements as // an histogram. -func newHistogram[N int64 | float64](boundaries []float64, noMinMax, noSum bool, limit int, r func() exemplar.FilteredReservoir[N]) *histogram[N] { +func newHistogram[N int64 | float64](boundaries []float64, noMinMax, noSum bool, limit int, r func(attribute.Set) FilteredExemplarReservoir[N]) *histogram[N] { return &histogram[N]{ histValues: newHistValues[N](boundaries, noSum, limit, r), noMinMax: noMinMax, diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/lastvalue.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/lastvalue.go index c359368403e5b..d3a93f085c94e 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/lastvalue.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/lastvalue.go @@ -9,7 +9,6 @@ import ( "time" "go.opentelemetry.io/otel/attribute" - "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" "go.opentelemetry.io/otel/sdk/metric/metricdata" ) @@ -17,10 +16,10 @@ import ( type datapoint[N int64 | float64] struct { attrs attribute.Set value N - res exemplar.FilteredReservoir[N] + res FilteredExemplarReservoir[N] } -func newLastValue[N int64 | float64](limit int, r func() exemplar.FilteredReservoir[N]) *lastValue[N] { +func newLastValue[N int64 | float64](limit int, r func(attribute.Set) FilteredExemplarReservoir[N]) *lastValue[N] { return &lastValue[N]{ newRes: r, limit: newLimiter[datapoint[N]](limit), @@ -33,7 +32,7 @@ func newLastValue[N int64 | float64](limit int, r func() exemplar.FilteredReserv type lastValue[N int64 | float64] struct { sync.Mutex - newRes func() exemplar.FilteredReservoir[N] + newRes func(attribute.Set) FilteredExemplarReservoir[N] limit limiter[datapoint[N]] values map[attribute.Distinct]datapoint[N] start time.Time @@ -46,7 +45,7 @@ func (s *lastValue[N]) measure(ctx context.Context, value N, fltrAttr attribute. attr := s.limit.Attributes(fltrAttr, s.values) d, ok := s.values[attr.Equivalent()] if !ok { - d.res = s.newRes() + d.res = s.newRes(attr) } d.attrs = attr @@ -115,7 +114,7 @@ func (s *lastValue[N]) copyDpts(dest *[]metricdata.DataPoint[N], t time.Time) in // newPrecomputedLastValue returns an aggregator that summarizes a set of // observations as the last one made. -func newPrecomputedLastValue[N int64 | float64](limit int, r func() exemplar.FilteredReservoir[N]) *precomputedLastValue[N] { +func newPrecomputedLastValue[N int64 | float64](limit int, r func(attribute.Set) FilteredExemplarReservoir[N]) *precomputedLastValue[N] { return &precomputedLastValue[N]{lastValue: newLastValue[N](limit, r)} } diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/sum.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/sum.go index 891366922600e..8e132ad6181b7 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/sum.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/aggregate/sum.go @@ -9,25 +9,24 @@ import ( "time" "go.opentelemetry.io/otel/attribute" - "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" "go.opentelemetry.io/otel/sdk/metric/metricdata" ) type sumValue[N int64 | float64] struct { n N - res exemplar.FilteredReservoir[N] + res FilteredExemplarReservoir[N] attrs attribute.Set } // valueMap is the storage for sums. type valueMap[N int64 | float64] struct { sync.Mutex - newRes func() exemplar.FilteredReservoir[N] + newRes func(attribute.Set) FilteredExemplarReservoir[N] limit limiter[sumValue[N]] values map[attribute.Distinct]sumValue[N] } -func newValueMap[N int64 | float64](limit int, r func() exemplar.FilteredReservoir[N]) *valueMap[N] { +func newValueMap[N int64 | float64](limit int, r func(attribute.Set) FilteredExemplarReservoir[N]) *valueMap[N] { return &valueMap[N]{ newRes: r, limit: newLimiter[sumValue[N]](limit), @@ -42,7 +41,7 @@ func (s *valueMap[N]) measure(ctx context.Context, value N, fltrAttr attribute.S attr := s.limit.Attributes(fltrAttr, s.values) v, ok := s.values[attr.Equivalent()] if !ok { - v.res = s.newRes() + v.res = s.newRes(attr) } v.attrs = attr @@ -55,7 +54,7 @@ func (s *valueMap[N]) measure(ctx context.Context, value N, fltrAttr attribute.S // newSum returns an aggregator that summarizes a set of measurements as their // arithmetic sum. Each sum is scoped by attributes and the aggregation cycle // the measurements were made in. -func newSum[N int64 | float64](monotonic bool, limit int, r func() exemplar.FilteredReservoir[N]) *sum[N] { +func newSum[N int64 | float64](monotonic bool, limit int, r func(attribute.Set) FilteredExemplarReservoir[N]) *sum[N] { return &sum[N]{ valueMap: newValueMap[N](limit, r), monotonic: monotonic, @@ -142,9 +141,9 @@ func (s *sum[N]) cumulative(dest *metricdata.Aggregation) int { } // newPrecomputedSum returns an aggregator that summarizes a set of -// observatrions as their arithmetic sum. Each sum is scoped by attributes and +// observations as their arithmetic sum. Each sum is scoped by attributes and // the aggregation cycle the measurements were made in. -func newPrecomputedSum[N int64 | float64](monotonic bool, limit int, r func() exemplar.FilteredReservoir[N]) *precomputedSum[N] { +func newPrecomputedSum[N int64 | float64](monotonic bool, limit int, r func(attribute.Set) FilteredExemplarReservoir[N]) *precomputedSum[N] { return &precomputedSum[N]{ valueMap: newValueMap[N](limit, r), monotonic: monotonic, @@ -152,7 +151,7 @@ func newPrecomputedSum[N int64 | float64](monotonic bool, limit int, r func() ex } } -// precomputedSum summarizes a set of observatrions as their arithmetic sum. +// precomputedSum summarizes a set of observations as their arithmetic sum. type precomputedSum[N int64 | float64] struct { *valueMap[N] diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/drop.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/drop.go deleted file mode 100644 index 5a0f39ae14784..0000000000000 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/drop.go +++ /dev/null @@ -1,23 +0,0 @@ -// Copyright The OpenTelemetry Authors -// SPDX-License-Identifier: Apache-2.0 - -package exemplar // import "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" - -import ( - "context" - - "go.opentelemetry.io/otel/attribute" -) - -// Drop returns a [FilteredReservoir] that drops all measurements it is offered. -func Drop[N int64 | float64]() FilteredReservoir[N] { return &dropRes[N]{} } - -type dropRes[N int64 | float64] struct{} - -// Offer does nothing, all measurements offered will be dropped. -func (r *dropRes[N]) Offer(context.Context, N, []attribute.KeyValue) {} - -// Collect resets dest. No exemplars will ever be returned. -func (r *dropRes[N]) Collect(dest *[]Exemplar) { - *dest = (*dest)[:0] -} diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/filtered_reservoir.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/filtered_reservoir.go deleted file mode 100644 index 9fedfa4be680d..0000000000000 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/filtered_reservoir.go +++ /dev/null @@ -1,49 +0,0 @@ -// Copyright The OpenTelemetry Authors -// SPDX-License-Identifier: Apache-2.0 - -package exemplar // import "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" - -import ( - "context" - "time" - - "go.opentelemetry.io/otel/attribute" -) - -// FilteredReservoir wraps a [Reservoir] with a filter. -type FilteredReservoir[N int64 | float64] interface { - // Offer accepts the parameters associated with a measurement. The - // parameters will be stored as an exemplar if the filter decides to - // sample the measurement. - // - // The passed ctx needs to contain any baggage or span that were active - // when the measurement was made. This information may be used by the - // Reservoir in making a sampling decision. - Offer(ctx context.Context, val N, attr []attribute.KeyValue) - // Collect returns all the held exemplars in the reservoir. - Collect(dest *[]Exemplar) -} - -// filteredReservoir handles the pre-sampled exemplar of measurements made. -type filteredReservoir[N int64 | float64] struct { - filter Filter - reservoir Reservoir -} - -// NewFilteredReservoir creates a [FilteredReservoir] which only offers values -// that are allowed by the filter. -func NewFilteredReservoir[N int64 | float64](f Filter, r Reservoir) FilteredReservoir[N] { - return &filteredReservoir[N]{ - filter: f, - reservoir: r, - } -} - -func (f *filteredReservoir[N]) Offer(ctx context.Context, val N, attr []attribute.KeyValue) { - if f.filter(ctx) { - // only record the current time if we are sampling this measurment. - f.reservoir.Offer(ctx, time.Now(), NewValue(val), attr) - } -} - -func (f *filteredReservoir[N]) Collect(dest *[]Exemplar) { f.reservoir.Collect(dest) } diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/hist.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/hist.go deleted file mode 100644 index a6ff86d027146..0000000000000 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/exemplar/hist.go +++ /dev/null @@ -1,46 +0,0 @@ -// Copyright The OpenTelemetry Authors -// SPDX-License-Identifier: Apache-2.0 - -package exemplar // import "go.opentelemetry.io/otel/sdk/metric/internal/exemplar" - -import ( - "context" - "slices" - "sort" - "time" - - "go.opentelemetry.io/otel/attribute" -) - -// Histogram returns a [Reservoir] that samples the last measurement that falls -// within a histogram bucket. The histogram bucket upper-boundaries are define -// by bounds. -// -// The passed bounds will be sorted by this function. -func Histogram(bounds []float64) Reservoir { - slices.Sort(bounds) - return &histRes{ - bounds: bounds, - storage: newStorage(len(bounds) + 1), - } -} - -type histRes struct { - *storage - - // bounds are bucket bounds in ascending order. - bounds []float64 -} - -func (r *histRes) Offer(ctx context.Context, t time.Time, v Value, a []attribute.KeyValue) { - var x float64 - switch v.Type() { - case Int64ValueType: - x = float64(v.Int64()) - case Float64ValueType: - x = v.Float64() - default: - panic("unknown value type") - } - r.store[sort.SearchFloat64s(r.bounds, x)] = newMeasurement(ctx, t, v, a) -} diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/x/README.md b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/x/README.md index aba69d6547150..59f736b733f19 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/x/README.md +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/x/README.md @@ -10,6 +10,7 @@ See the [Compatibility and Stability](#compatibility-and-stability) section for - [Cardinality Limit](#cardinality-limit) - [Exemplars](#exemplars) +- [Instrument Enabled](#instrument-enabled) ### Cardinality Limit @@ -102,6 +103,24 @@ Revert to the default exemplar filter (`"trace_based"`) unset OTEL_METRICS_EXEMPLAR_FILTER ``` +### Instrument Enabled + +To help users avoid performing computationally expensive operations when recording measurements, synchronous instruments provide an `Enabled` method. + +#### Examples + +The following code shows an example of how to check if an instrument implements the `EnabledInstrument` interface before using the `Enabled` function to avoid doing an expensive computation: + +```go +type enabledInstrument interface { Enabled(context.Context) bool } + +ctr, err := m.Int64Counter("expensive-counter") +c, ok := ctr.(enabledInstrument) +if !ok || c.Enabled(context.Background()) { + c.Add(expensiveComputation()) +} +``` + ## Compatibility and Stability Experimental features do not fall within the scope of the OpenTelemetry Go versioning and stability [policy](../../../../VERSIONING.md). diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/x/x.go b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/x/x.go index 8cd2f37417bb2..a98606238ad28 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/internal/x/x.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/internal/x/x.go @@ -8,41 +8,26 @@ package x // import "go.opentelemetry.io/otel/sdk/metric/internal/x" import ( + "context" "os" "strconv" - "strings" ) -var ( - // Exemplars is an experimental feature flag that defines if exemplars - // should be recorded for metric data-points. - // - // To enable this feature set the OTEL_GO_X_EXEMPLAR environment variable - // to the case-insensitive string value of "true" (i.e. "True" and "TRUE" - // will also enable this). - Exemplars = newFeature("EXEMPLAR", func(v string) (string, bool) { - if strings.ToLower(v) == "true" { - return v, true - } - return "", false - }) - - // CardinalityLimit is an experimental feature flag that defines if - // cardinality limits should be applied to the recorded metric data-points. - // - // To enable this feature set the OTEL_GO_X_CARDINALITY_LIMIT environment - // variable to the integer limit value you want to use. - // - // Setting OTEL_GO_X_CARDINALITY_LIMIT to a value less than or equal to 0 - // will disable the cardinality limits. - CardinalityLimit = newFeature("CARDINALITY_LIMIT", func(v string) (int, bool) { - n, err := strconv.Atoi(v) - if err != nil { - return 0, false - } - return n, true - }) -) +// CardinalityLimit is an experimental feature flag that defines if +// cardinality limits should be applied to the recorded metric data-points. +// +// To enable this feature set the OTEL_GO_X_CARDINALITY_LIMIT environment +// variable to the integer limit value you want to use. +// +// Setting OTEL_GO_X_CARDINALITY_LIMIT to a value less than or equal to 0 +// will disable the cardinality limits. +var CardinalityLimit = newFeature("CARDINALITY_LIMIT", func(v string) (int, bool) { + n, err := strconv.Atoi(v) + if err != nil { + return 0, false + } + return n, true +}) // Feature is an experimental feature control flag. It provides a uniform way // to interact with these feature flags and parse their values. @@ -83,3 +68,14 @@ func (f Feature[T]) Enabled() bool { _, ok := f.Lookup() return ok } + +// EnabledInstrument informs whether the instrument is enabled. +// +// EnabledInstrument interface is implemented by synchronous instruments. +type EnabledInstrument interface { + // Enabled returns whether the instrument will process measurements for the given context. + // + // This function can be used in places where measuring an instrument + // would result in computationally expensive operations. + Enabled(context.Context) bool +} diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/manual_reader.go b/vendor/go.opentelemetry.io/otel/sdk/metric/manual_reader.go index e0fd86ca78daf..c495985bc28cc 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/manual_reader.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/manual_reader.go @@ -113,18 +113,17 @@ func (mr *ManualReader) Collect(ctx context.Context, rm *metricdata.ResourceMetr if err != nil { return err } - var errs []error for _, producer := range mr.externalProducers.Load().([]Producer) { - externalMetrics, err := producer.Produce(ctx) - if err != nil { - errs = append(errs, err) + externalMetrics, e := producer.Produce(ctx) + if e != nil { + err = errors.Join(err, e) } rm.ScopeMetrics = append(rm.ScopeMetrics, externalMetrics...) } global.Debug("ManualReader collection", "Data", rm) - return unifyErrors(errs) + return err } // MarshalLog returns logging data about the ManualReader. diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/meter.go b/vendor/go.opentelemetry.io/otel/sdk/metric/meter.go index 2309e5b2b0f8e..a6ccd117b80dc 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/meter.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/meter.go @@ -150,6 +150,11 @@ func (m *meter) int64ObservableInstrument(id Instrument, callbacks []metric.Int6 continue } inst.appendMeasures(in) + + // Add the measures to the pipeline. It is required to maintain + // measures per pipeline to avoid calling the measure that + // is not part of the pipeline. + insert.pipeline.addInt64Measure(inst.observableID, in) for _, cback := range callbacks { inst := int64Observer{measures: in} fn := cback @@ -309,6 +314,11 @@ func (m *meter) float64ObservableInstrument(id Instrument, callbacks []metric.Fl continue } inst.appendMeasures(in) + + // Add the measures to the pipeline. It is required to maintain + // measures per pipeline to avoid calling the measure that + // is not part of the pipeline. + insert.pipeline.addFloat64Measure(inst.observableID, in) for _, cback := range callbacks { inst := float64Observer{measures: in} fn := cback @@ -441,73 +451,80 @@ func (m *meter) RegisterCallback(f metric.Callback, insts ...metric.Observable) return noopRegister{}, nil } - reg := newObserver() - var errs multierror + var err error + validInstruments := make([]metric.Observable, 0, len(insts)) for _, inst := range insts { - // Unwrap any global. - if u, ok := inst.(interface { - Unwrap() metric.Observable - }); ok { - inst = u.Unwrap() - } - switch o := inst.(type) { case int64Observable: - if err := o.registerable(m); err != nil { - if !errors.Is(err, errEmptyAgg) { - errs.append(err) + if e := o.registerable(m); e != nil { + if !errors.Is(e, errEmptyAgg) { + err = errors.Join(err, e) } continue } - reg.registerInt64(o.observablID) + + validInstruments = append(validInstruments, inst) case float64Observable: - if err := o.registerable(m); err != nil { - if !errors.Is(err, errEmptyAgg) { - errs.append(err) + if e := o.registerable(m); e != nil { + if !errors.Is(e, errEmptyAgg) { + err = errors.Join(err, e) } continue } - reg.registerFloat64(o.observablID) + + validInstruments = append(validInstruments, inst) default: // Instrument external to the SDK. - return nil, fmt.Errorf("invalid observable: from different implementation") + return nil, errors.New("invalid observable: from different implementation") } } - err := errs.errorOrNil() - if reg.len() == 0 { + if len(validInstruments) == 0 { // All insts use drop aggregation or are invalid. return noopRegister{}, err } - // Some or all instruments were valid. - cback := func(ctx context.Context) error { return f(ctx, reg) } - return m.pipes.registerMultiCallback(cback), err + unregs := make([]func(), len(m.pipes)) + for ix, pipe := range m.pipes { + reg := newObserver(pipe) + for _, inst := range validInstruments { + switch o := inst.(type) { + case int64Observable: + reg.registerInt64(o.observableID) + case float64Observable: + reg.registerFloat64(o.observableID) + } + } + + // Some or all instruments were valid. + cBack := func(ctx context.Context) error { return f(ctx, reg) } + unregs[ix] = pipe.addMultiCallback(cBack) + } + + return unregisterFuncs{f: unregs}, err } type observer struct { embedded.Observer - float64 map[observablID[float64]]struct{} - int64 map[observablID[int64]]struct{} + pipe *pipeline + float64 map[observableID[float64]]struct{} + int64 map[observableID[int64]]struct{} } -func newObserver() observer { +func newObserver(p *pipeline) observer { return observer{ - float64: make(map[observablID[float64]]struct{}), - int64: make(map[observablID[int64]]struct{}), + pipe: p, + float64: make(map[observableID[float64]]struct{}), + int64: make(map[observableID[int64]]struct{}), } } -func (r observer) len() int { - return len(r.float64) + len(r.int64) -} - -func (r observer) registerFloat64(id observablID[float64]) { +func (r observer) registerFloat64(id observableID[float64]) { r.float64[id] = struct{}{} } -func (r observer) registerInt64(id observablID[int64]) { +func (r observer) registerInt64(id observableID[int64]) { r.int64[id] = struct{}{} } @@ -521,22 +538,12 @@ func (r observer) ObserveFloat64(o metric.Float64Observable, v float64, opts ... switch conv := o.(type) { case float64Observable: oImpl = conv - case interface { - Unwrap() metric.Observable - }: - // Unwrap any global. - async := conv.Unwrap() - var ok bool - if oImpl, ok = async.(float64Observable); !ok { - global.Error(errUnknownObserver, "failed to record asynchronous") - return - } default: global.Error(errUnknownObserver, "failed to record") return } - if _, registered := r.float64[oImpl.observablID]; !registered { + if _, registered := r.float64[oImpl.observableID]; !registered { if !oImpl.dropAggregation { global.Error(errUnregObserver, "failed to record", "name", oImpl.name, @@ -548,7 +555,12 @@ func (r observer) ObserveFloat64(o metric.Float64Observable, v float64, opts ... return } c := metric.NewObserveConfig(opts) - oImpl.observe(v, c.Attributes()) + // Access to r.pipe.float64Measure is already guarded by a lock in pipeline.produce. + // TODO (#5946): Refactor pipeline and observable measures. + measures := r.pipe.float64Measures[oImpl.observableID] + for _, m := range measures { + m(context.Background(), v, c.Attributes()) + } } func (r observer) ObserveInt64(o metric.Int64Observable, v int64, opts ...metric.ObserveOption) { @@ -556,22 +568,12 @@ func (r observer) ObserveInt64(o metric.Int64Observable, v int64, opts ...metric switch conv := o.(type) { case int64Observable: oImpl = conv - case interface { - Unwrap() metric.Observable - }: - // Unwrap any global. - async := conv.Unwrap() - var ok bool - if oImpl, ok = async.(int64Observable); !ok { - global.Error(errUnknownObserver, "failed to record asynchronous") - return - } default: global.Error(errUnknownObserver, "failed to record") return } - if _, registered := r.int64[oImpl.observablID]; !registered { + if _, registered := r.int64[oImpl.observableID]; !registered { if !oImpl.dropAggregation { global.Error(errUnregObserver, "failed to record", "name", oImpl.name, @@ -583,7 +585,12 @@ func (r observer) ObserveInt64(o metric.Int64Observable, v int64, opts ...metric return } c := metric.NewObserveConfig(opts) - oImpl.observe(v, c.Attributes()) + // Access to r.pipe.int64Measures is already guarded b a lock in pipeline.produce. + // TODO (#5946): Refactor pipeline and observable measures. + measures := r.pipe.int64Measures[oImpl.observableID] + for _, m := range measures { + m(context.Background(), v, c.Attributes()) + } } type noopRegister struct{ embedded.Registration } diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/periodic_reader.go b/vendor/go.opentelemetry.io/otel/sdk/metric/periodic_reader.go index 67ee1b11a2e52..dcd2182d9a159 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/periodic_reader.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/periodic_reader.go @@ -251,18 +251,17 @@ func (r *PeriodicReader) collect(ctx context.Context, p interface{}, rm *metricd if err != nil { return err } - var errs []error for _, producer := range r.externalProducers.Load().([]Producer) { - externalMetrics, err := producer.Produce(ctx) - if err != nil { - errs = append(errs, err) + externalMetrics, e := producer.Produce(ctx) + if e != nil { + err = errors.Join(err, e) } rm.ScopeMetrics = append(rm.ScopeMetrics, externalMetrics...) } global.Debug("PeriodicReader collection", "Data", rm) - return unifyErrors(errs) + return err } // export exports metric data m using r's exporter. diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/pipeline.go b/vendor/go.opentelemetry.io/otel/sdk/metric/pipeline.go index 823bf2fe3d276..775e2452619ad 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/pipeline.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/pipeline.go @@ -8,14 +8,13 @@ import ( "context" "errors" "fmt" - "strings" "sync" "sync/atomic" "go.opentelemetry.io/otel/internal/global" - "go.opentelemetry.io/otel/metric" "go.opentelemetry.io/otel/metric/embedded" "go.opentelemetry.io/otel/sdk/instrumentation" + "go.opentelemetry.io/otel/sdk/metric/exemplar" "go.opentelemetry.io/otel/sdk/metric/internal" "go.opentelemetry.io/otel/sdk/metric/internal/aggregate" "go.opentelemetry.io/otel/sdk/metric/internal/x" @@ -38,14 +37,17 @@ type instrumentSync struct { compAgg aggregate.ComputeAggregation } -func newPipeline(res *resource.Resource, reader Reader, views []View) *pipeline { +func newPipeline(res *resource.Resource, reader Reader, views []View, exemplarFilter exemplar.Filter) *pipeline { if res == nil { res = resource.Empty() } return &pipeline{ - resource: res, - reader: reader, - views: views, + resource: res, + reader: reader, + views: views, + int64Measures: map[observableID[int64]][]aggregate.Measure[int64]{}, + float64Measures: map[observableID[float64]][]aggregate.Measure[float64]{}, + exemplarFilter: exemplarFilter, // aggregations is lazy allocated when needed. } } @@ -63,9 +65,26 @@ type pipeline struct { views []View sync.Mutex - aggregations map[instrumentation.Scope][]instrumentSync - callbacks []func(context.Context) error - multiCallbacks list.List + int64Measures map[observableID[int64]][]aggregate.Measure[int64] + float64Measures map[observableID[float64]][]aggregate.Measure[float64] + aggregations map[instrumentation.Scope][]instrumentSync + callbacks []func(context.Context) error + multiCallbacks list.List + exemplarFilter exemplar.Filter +} + +// addInt64Measure adds a new int64 measure to the pipeline for each observer. +func (p *pipeline) addInt64Measure(id observableID[int64], m []aggregate.Measure[int64]) { + p.Lock() + defer p.Unlock() + p.int64Measures[id] = m +} + +// addFloat64Measure adds a new float64 measure to the pipeline for each observer. +func (p *pipeline) addFloat64Measure(id observableID[float64], m []aggregate.Measure[float64]) { + p.Lock() + defer p.Unlock() + p.float64Measures[id] = m } // addSync adds the instrumentSync to pipeline p with scope. This method is not @@ -105,14 +124,15 @@ func (p *pipeline) produce(ctx context.Context, rm *metricdata.ResourceMetrics) p.Lock() defer p.Unlock() - var errs multierror + var err error for _, c := range p.callbacks { // TODO make the callbacks parallel. ( #3034 ) - if err := c(ctx); err != nil { - errs.append(err) + if e := c(ctx); e != nil { + err = errors.Join(err, e) } if err := ctx.Err(); err != nil { rm.Resource = nil + clear(rm.ScopeMetrics) // Erase elements to let GC collect objects. rm.ScopeMetrics = rm.ScopeMetrics[:0] return err } @@ -120,12 +140,13 @@ func (p *pipeline) produce(ctx context.Context, rm *metricdata.ResourceMetrics) for e := p.multiCallbacks.Front(); e != nil; e = e.Next() { // TODO make the callbacks parallel. ( #3034 ) f := e.Value.(multiCallback) - if err := f(ctx); err != nil { - errs.append(err) + if e := f(ctx); e != nil { + err = errors.Join(err, e) } if err := ctx.Err(); err != nil { // This means the context expired before we finished running callbacks. rm.Resource = nil + clear(rm.ScopeMetrics) // Erase elements to let GC collect objects. rm.ScopeMetrics = rm.ScopeMetrics[:0] return err } @@ -157,7 +178,7 @@ func (p *pipeline) produce(ctx context.Context, rm *metricdata.ResourceMetrics) rm.ScopeMetrics = rm.ScopeMetrics[:i] - return errs.errorOrNil() + return err } // inserter facilitates inserting of new instruments from a single scope into a @@ -219,7 +240,7 @@ func (i *inserter[N]) Instrument(inst Instrument, readerAggregation Aggregation) measures []aggregate.Measure[N] ) - errs := &multierror{wrapped: errCreatingAggregators} + var err error seen := make(map[uint64]struct{}) for _, v := range i.pipeline.views { stream, match := v(inst) @@ -227,9 +248,9 @@ func (i *inserter[N]) Instrument(inst Instrument, readerAggregation Aggregation) continue } matched = true - in, id, err := i.cachedAggregator(inst.Scope, inst.Kind, stream, readerAggregation) - if err != nil { - errs.append(err) + in, id, e := i.cachedAggregator(inst.Scope, inst.Kind, stream, readerAggregation) + if e != nil { + err = errors.Join(err, e) } if in == nil { // Drop aggregation. continue @@ -242,8 +263,12 @@ func (i *inserter[N]) Instrument(inst Instrument, readerAggregation Aggregation) measures = append(measures, in) } + if err != nil { + err = errors.Join(errCreatingAggregators, err) + } + if matched { - return measures, errs.errorOrNil() + return measures, err } // Apply implicit default view if no explicit matched. @@ -252,15 +277,18 @@ func (i *inserter[N]) Instrument(inst Instrument, readerAggregation Aggregation) Description: inst.Description, Unit: inst.Unit, } - in, _, err := i.cachedAggregator(inst.Scope, inst.Kind, stream, readerAggregation) - if err != nil { - errs.append(err) + in, _, e := i.cachedAggregator(inst.Scope, inst.Kind, stream, readerAggregation) + if e != nil { + if err == nil { + err = errCreatingAggregators + } + err = errors.Join(err, e) } if in != nil { // Ensured to have not seen given matched was false. measures = append(measures, in) } - return measures, errs.errorOrNil() + return measures, err } // addCallback registers a single instrument callback to be run when @@ -329,6 +357,9 @@ func (i *inserter[N]) cachedAggregator(scope instrumentation.Scope, kind Instrum // The view explicitly requested the default aggregation. stream.Aggregation = DefaultAggregationSelector(kind) } + if stream.ExemplarReservoirProviderSelector == nil { + stream.ExemplarReservoirProviderSelector = DefaultExemplarReservoirProviderSelector + } if err := isAggregatorCompatible(kind, stream.Aggregation); err != nil { return nil, 0, fmt.Errorf( @@ -349,7 +380,7 @@ func (i *inserter[N]) cachedAggregator(scope instrumentation.Scope, kind Instrum cv := i.aggregators.Lookup(normID, func() aggVal[N] { b := aggregate.Builder[N]{ Temporality: i.pipeline.reader.temporality(kind), - ReservoirFunc: reservoirFunc[N](stream.Aggregation), + ReservoirFunc: reservoirFunc[N](stream.ExemplarReservoirProviderSelector(stream.Aggregation), i.pipeline.exemplarFilter), } b.Filter = stream.AttributeFilter // A value less than or equal to zero will disable the aggregation @@ -552,24 +583,16 @@ func isAggregatorCompatible(kind InstrumentKind, agg Aggregation) error { // measurement. type pipelines []*pipeline -func newPipelines(res *resource.Resource, readers []Reader, views []View) pipelines { +func newPipelines(res *resource.Resource, readers []Reader, views []View, exemplarFilter exemplar.Filter) pipelines { pipes := make([]*pipeline, 0, len(readers)) for _, r := range readers { - p := newPipeline(res, r, views) + p := newPipeline(res, r, views, exemplarFilter) r.register(p) pipes = append(pipes, p) } return pipes } -func (p pipelines) registerMultiCallback(c multiCallback) metric.Registration { - unregs := make([]func(), len(p)) - for i, pipe := range p { - unregs[i] = pipe.addMultiCallback(c) - } - return unregisterFuncs{f: unregs} -} - type unregisterFuncs struct { embedded.Registration f []func() @@ -602,15 +625,15 @@ func newResolver[N int64 | float64](p pipelines, vc *cache[string, instID]) reso func (r resolver[N]) Aggregators(id Instrument) ([]aggregate.Measure[N], error) { var measures []aggregate.Measure[N] - errs := &multierror{} + var err error for _, i := range r.inserters { - in, err := i.Instrument(id, i.readerDefaultAggregation(id.Kind)) - if err != nil { - errs.append(err) + in, e := i.Instrument(id, i.readerDefaultAggregation(id.Kind)) + if e != nil { + err = errors.Join(err, e) } measures = append(measures, in...) } - return measures, errs.errorOrNil() + return measures, err } // HistogramAggregators returns the histogram Aggregators that must be updated by the instrument @@ -619,37 +642,18 @@ func (r resolver[N]) Aggregators(id Instrument) ([]aggregate.Measure[N], error) func (r resolver[N]) HistogramAggregators(id Instrument, boundaries []float64) ([]aggregate.Measure[N], error) { var measures []aggregate.Measure[N] - errs := &multierror{} + var err error for _, i := range r.inserters { agg := i.readerDefaultAggregation(id.Kind) if histAgg, ok := agg.(AggregationExplicitBucketHistogram); ok && len(boundaries) > 0 { histAgg.Boundaries = boundaries agg = histAgg } - in, err := i.Instrument(id, agg) - if err != nil { - errs.append(err) + in, e := i.Instrument(id, agg) + if e != nil { + err = errors.Join(err, e) } measures = append(measures, in...) } - return measures, errs.errorOrNil() -} - -type multierror struct { - wrapped error - errors []string -} - -func (m *multierror) errorOrNil() error { - if len(m.errors) == 0 { - return nil - } - if m.wrapped == nil { - return errors.New(strings.Join(m.errors, "; ")) - } - return fmt.Errorf("%w: %s", m.wrapped, strings.Join(m.errors, "; ")) -} - -func (m *multierror) append(err error) { - m.errors = append(m.errors, err.Error()) + return measures, err } diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/provider.go b/vendor/go.opentelemetry.io/otel/sdk/metric/provider.go index a82af538e67c6..2fca89e5a8e5e 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/provider.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/provider.go @@ -42,7 +42,7 @@ func NewMeterProvider(options ...Option) *MeterProvider { flush, sdown := conf.readerSignals() mp := &MeterProvider{ - pipes: newPipelines(conf.res, conf.readers, conf.views), + pipes: newPipelines(conf.res, conf.readers, conf.views, conf.exemplarFilter), forceFlush: flush, shutdown: sdown, } @@ -76,15 +76,17 @@ func (mp *MeterProvider) Meter(name string, options ...metric.MeterOption) metri c := metric.NewMeterConfig(options...) s := instrumentation.Scope{ - Name: name, - Version: c.InstrumentationVersion(), - SchemaURL: c.SchemaURL(), + Name: name, + Version: c.InstrumentationVersion(), + SchemaURL: c.SchemaURL(), + Attributes: c.InstrumentationAttributes(), } global.Info("Meter created", "Name", s.Name, "Version", s.Version, "SchemaURL", s.SchemaURL, + "Attributes", s.Attributes, ) return mp.meters.Lookup(s, func() *meter { diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/reader.go b/vendor/go.opentelemetry.io/otel/sdk/metric/reader.go index d94bdee75b731..d13a7069788ed 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/reader.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/reader.go @@ -5,26 +5,26 @@ package metric // import "go.opentelemetry.io/otel/sdk/metric" import ( "context" - "fmt" + "errors" "go.opentelemetry.io/otel/sdk/metric/metricdata" ) // errDuplicateRegister is logged by a Reader when an attempt to registered it // more than once occurs. -var errDuplicateRegister = fmt.Errorf("duplicate reader registration") +var errDuplicateRegister = errors.New("duplicate reader registration") // ErrReaderNotRegistered is returned if Collect or Shutdown are called before // the reader is registered with a MeterProvider. -var ErrReaderNotRegistered = fmt.Errorf("reader is not registered") +var ErrReaderNotRegistered = errors.New("reader is not registered") // ErrReaderShutdown is returned if Collect or Shutdown are called after a // reader has been Shutdown once. -var ErrReaderShutdown = fmt.Errorf("reader is shutdown") +var ErrReaderShutdown = errors.New("reader is shutdown") // errNonPositiveDuration is logged when an environmental variable // has non-positive value. -var errNonPositiveDuration = fmt.Errorf("non-positive duration") +var errNonPositiveDuration = errors.New("non-positive duration") // Reader is the interface used between the SDK and an // exporter. Control flow is bi-directional through the @@ -60,8 +60,8 @@ type Reader interface { aggregation(InstrumentKind) Aggregation // nolint:revive // import-shadow for method scoped by type. // Collect gathers and returns all metric data related to the Reader from - // the SDK and stores it in out. An error is returned if this is called - // after Shutdown or if out is nil. + // the SDK and stores it in rm. An error is returned if this is called + // after Shutdown or if rm is nil. // // This method needs to be concurrent safe, and the cancellation of the // passed context is expected to be honored. diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/version.go b/vendor/go.opentelemetry.io/otel/sdk/metric/version.go index 44316caa11bba..1cd181626d353 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/version.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/version.go @@ -5,5 +5,5 @@ package metric // import "go.opentelemetry.io/otel/sdk/metric" // version is the current release version of the metric SDK in use. func version() string { - return "1.29.0" + return "1.33.0" } diff --git a/vendor/go.opentelemetry.io/otel/sdk/metric/view.go b/vendor/go.opentelemetry.io/otel/sdk/metric/view.go index cd08c673248af..630890f426314 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/metric/view.go +++ b/vendor/go.opentelemetry.io/otel/sdk/metric/view.go @@ -96,11 +96,12 @@ func NewView(criteria Instrument, mask Stream) View { return func(i Instrument) (Stream, bool) { if matchFunc(i) { return Stream{ - Name: nonZero(mask.Name, i.Name), - Description: nonZero(mask.Description, i.Description), - Unit: nonZero(mask.Unit, i.Unit), - Aggregation: agg, - AttributeFilter: mask.AttributeFilter, + Name: nonZero(mask.Name, i.Name), + Description: nonZero(mask.Description, i.Description), + Unit: nonZero(mask.Unit, i.Unit), + Aggregation: agg, + AttributeFilter: mask.AttributeFilter, + ExemplarReservoirProviderSelector: mask.ExemplarReservoirProviderSelector, }, true } return Stream{}, false diff --git a/vendor/go.opentelemetry.io/otel/sdk/resource/auto.go b/vendor/go.opentelemetry.io/otel/sdk/resource/auto.go index 95a61d61d49c3..c02aeefdde531 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/resource/auto.go +++ b/vendor/go.opentelemetry.io/otel/sdk/resource/auto.go @@ -7,7 +7,6 @@ import ( "context" "errors" "fmt" - "strings" ) // ErrPartialResource is returned by a detector when complete source @@ -57,62 +56,37 @@ func Detect(ctx context.Context, detectors ...Detector) (*Resource, error) { // these errors will be returned. Otherwise, nil is returned. func detect(ctx context.Context, res *Resource, detectors []Detector) error { var ( - r *Resource - errs detectErrs - err error + r *Resource + err error + e error ) for _, detector := range detectors { if detector == nil { continue } - r, err = detector.Detect(ctx) - if err != nil { - errs = append(errs, err) - if !errors.Is(err, ErrPartialResource) { + r, e = detector.Detect(ctx) + if e != nil { + err = errors.Join(err, e) + if !errors.Is(e, ErrPartialResource) { continue } } - r, err = Merge(res, r) - if err != nil { - errs = append(errs, err) + r, e = Merge(res, r) + if e != nil { + err = errors.Join(err, e) } *res = *r } - if len(errs) == 0 { - return nil - } - if errors.Is(errs, ErrSchemaURLConflict) { - // If there has been a merge conflict, ensure the resource has no - // schema URL. - res.schemaURL = "" - } - return errs -} - -type detectErrs []error - -func (e detectErrs) Error() string { - errStr := make([]string, len(e)) - for i, err := range e { - errStr[i] = fmt.Sprintf("* %s", err) - } - - format := "%d errors occurred detecting resource:\n\t%s" - return fmt.Sprintf(format, len(e), strings.Join(errStr, "\n\t")) -} + if err != nil { + if errors.Is(err, ErrSchemaURLConflict) { + // If there has been a merge conflict, ensure the resource has no + // schema URL. + res.schemaURL = "" + } -func (e detectErrs) Unwrap() error { - switch len(e) { - case 0: - return nil - case 1: - return e[0] + err = fmt.Errorf("error detecting resource: %w", err) } - return e[1:] -} - -func (e detectErrs) Is(target error) bool { - return len(e) != 0 && errors.Is(e[0], target) + return err } diff --git a/vendor/go.opentelemetry.io/otel/sdk/resource/builtin.go b/vendor/go.opentelemetry.io/otel/sdk/resource/builtin.go index 6ac1cdbf7b456..cf3c88e15cd6a 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/resource/builtin.go +++ b/vendor/go.opentelemetry.io/otel/sdk/resource/builtin.go @@ -20,15 +20,13 @@ type ( // telemetrySDK is a Detector that provides information about // the OpenTelemetry SDK used. This Detector is included as a // builtin. If these resource attributes are not wanted, use - // the WithTelemetrySDK(nil) or WithoutBuiltin() options to - // explicitly disable them. + // resource.New() to explicitly disable them. telemetrySDK struct{} // host is a Detector that provides information about the host // being run on. This Detector is included as a builtin. If // these resource attributes are not wanted, use the - // WithHost(nil) or WithoutBuiltin() options to explicitly - // disable them. + // resource.New() to explicitly disable them. host struct{} stringDetector struct { diff --git a/vendor/go.opentelemetry.io/otel/sdk/resource/host_id_windows.go b/vendor/go.opentelemetry.io/otel/sdk/resource/host_id_windows.go index 71386e2da4c76..3677c83d7da33 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/resource/host_id_windows.go +++ b/vendor/go.opentelemetry.io/otel/sdk/resource/host_id_windows.go @@ -10,17 +10,16 @@ import ( "golang.org/x/sys/windows/registry" ) -// implements hostIDReader +// implements hostIDReader. type hostIDReaderWindows struct{} -// read reads MachineGuid from the windows registry key: -// SOFTWARE\Microsoft\Cryptography +// read reads MachineGuid from the Windows registry key: +// SOFTWARE\Microsoft\Cryptography. func (*hostIDReaderWindows) read() (string, error) { k, err := registry.OpenKey( registry.LOCAL_MACHINE, `SOFTWARE\Microsoft\Cryptography`, registry.QUERY_VALUE|registry.WOW64_64KEY, ) - if err != nil { return "", err } diff --git a/vendor/go.opentelemetry.io/otel/sdk/resource/os_windows.go b/vendor/go.opentelemetry.io/otel/sdk/resource/os_windows.go index 5e3d199d7856a..a6a5a53c0ea7a 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/resource/os_windows.go +++ b/vendor/go.opentelemetry.io/otel/sdk/resource/os_windows.go @@ -17,7 +17,6 @@ import ( func platformOSDescription() (string, error) { k, err := registry.OpenKey( registry.LOCAL_MACHINE, `SOFTWARE\Microsoft\Windows NT\CurrentVersion`, registry.QUERY_VALUE) - if err != nil { return "", err } diff --git a/vendor/go.opentelemetry.io/otel/sdk/version.go b/vendor/go.opentelemetry.io/otel/sdk/version.go index b7cede891c4c6..ba7db4889505a 100644 --- a/vendor/go.opentelemetry.io/otel/sdk/version.go +++ b/vendor/go.opentelemetry.io/otel/sdk/version.go @@ -5,5 +5,5 @@ package sdk // import "go.opentelemetry.io/otel/sdk" // Version is the current release version of the OpenTelemetry SDK in use. func Version() string { - return "1.29.0" + return "1.33.0" } diff --git a/vendor/google.golang.org/genproto/googleapis/api/annotations/client.pb.go b/vendor/google.golang.org/genproto/googleapis/api/annotations/client.pb.go index aa69fb4d509ff..4a9fce53c444f 100644 --- a/vendor/google.golang.org/genproto/googleapis/api/annotations/client.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/api/annotations/client.pb.go @@ -180,6 +180,8 @@ type CommonLanguageSettings struct { ReferenceDocsUri string `protobuf:"bytes,1,opt,name=reference_docs_uri,json=referenceDocsUri,proto3" json:"reference_docs_uri,omitempty"` // The destination where API teams want this client library to be published. Destinations []ClientLibraryDestination `protobuf:"varint,2,rep,packed,name=destinations,proto3,enum=google.api.ClientLibraryDestination" json:"destinations,omitempty"` + // Configuration for which RPCs should be generated in the GAPIC client. + SelectiveGapicGeneration *SelectiveGapicGeneration `protobuf:"bytes,3,opt,name=selective_gapic_generation,json=selectiveGapicGeneration,proto3" json:"selective_gapic_generation,omitempty"` } func (x *CommonLanguageSettings) Reset() { @@ -229,6 +231,13 @@ func (x *CommonLanguageSettings) GetDestinations() []ClientLibraryDestination { return nil } +func (x *CommonLanguageSettings) GetSelectiveGapicGeneration() *SelectiveGapicGeneration { + if x != nil { + return x.SelectiveGapicGeneration + } + return nil +} + // Details about how and where to publish client libraries. type ClientLibrarySettings struct { state protoimpl.MessageState @@ -984,6 +993,16 @@ type GoSettings struct { // Some settings. Common *CommonLanguageSettings `protobuf:"bytes,1,opt,name=common,proto3" json:"common,omitempty"` + // Map of service names to renamed services. Keys are the package relative + // service names and values are the name to be used for the service client + // and call options. + // + // publishing: + // + // go_settings: + // renamed_services: + // Publisher: TopicAdmin + RenamedServices map[string]string `protobuf:"bytes,2,rep,name=renamed_services,json=renamedServices,proto3" json:"renamed_services,omitempty" protobuf_key:"bytes,1,opt,name=key,proto3" protobuf_val:"bytes,2,opt,name=value,proto3"` } func (x *GoSettings) Reset() { @@ -1025,6 +1044,13 @@ func (x *GoSettings) GetCommon() *CommonLanguageSettings { return nil } +func (x *GoSettings) GetRenamedServices() map[string]string { + if x != nil { + return x.RenamedServices + } + return nil +} + // Describes the generator configuration for a method. type MethodSettings struct { state protoimpl.MessageState @@ -1123,6 +1149,57 @@ func (x *MethodSettings) GetAutoPopulatedFields() []string { return nil } +// This message is used to configure the generation of a subset of the RPCs in +// a service for client libraries. +type SelectiveGapicGeneration struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // An allowlist of the fully qualified names of RPCs that should be included + // on public client surfaces. + Methods []string `protobuf:"bytes,1,rep,name=methods,proto3" json:"methods,omitempty"` +} + +func (x *SelectiveGapicGeneration) Reset() { + *x = SelectiveGapicGeneration{} + if protoimpl.UnsafeEnabled { + mi := &file_google_api_client_proto_msgTypes[12] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *SelectiveGapicGeneration) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*SelectiveGapicGeneration) ProtoMessage() {} + +func (x *SelectiveGapicGeneration) ProtoReflect() protoreflect.Message { + mi := &file_google_api_client_proto_msgTypes[12] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use SelectiveGapicGeneration.ProtoReflect.Descriptor instead. +func (*SelectiveGapicGeneration) Descriptor() ([]byte, []int) { + return file_google_api_client_proto_rawDescGZIP(), []int{12} +} + +func (x *SelectiveGapicGeneration) GetMethods() []string { + if x != nil { + return x.Methods + } + return nil +} + // Experimental features to be included during client library generation. // These fields will be deprecated once the feature graduates and is enabled // by default. @@ -1136,12 +1213,17 @@ type PythonSettings_ExperimentalFeatures struct { // This feature will be enabled by default 1 month after launching the // feature in preview packages. RestAsyncIoEnabled bool `protobuf:"varint,1,opt,name=rest_async_io_enabled,json=restAsyncIoEnabled,proto3" json:"rest_async_io_enabled,omitempty"` + // Enables generation of protobuf code using new types that are more + // Pythonic which are included in `protobuf>=5.29.x`. This feature will be + // enabled by default 1 month after launching the feature in preview + // packages. + ProtobufPythonicTypesEnabled bool `protobuf:"varint,2,opt,name=protobuf_pythonic_types_enabled,json=protobufPythonicTypesEnabled,proto3" json:"protobuf_pythonic_types_enabled,omitempty"` } func (x *PythonSettings_ExperimentalFeatures) Reset() { *x = PythonSettings_ExperimentalFeatures{} if protoimpl.UnsafeEnabled { - mi := &file_google_api_client_proto_msgTypes[13] + mi := &file_google_api_client_proto_msgTypes[14] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -1154,7 +1236,7 @@ func (x *PythonSettings_ExperimentalFeatures) String() string { func (*PythonSettings_ExperimentalFeatures) ProtoMessage() {} func (x *PythonSettings_ExperimentalFeatures) ProtoReflect() protoreflect.Message { - mi := &file_google_api_client_proto_msgTypes[13] + mi := &file_google_api_client_proto_msgTypes[14] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1177,6 +1259,13 @@ func (x *PythonSettings_ExperimentalFeatures) GetRestAsyncIoEnabled() bool { return false } +func (x *PythonSettings_ExperimentalFeatures) GetProtobufPythonicTypesEnabled() bool { + if x != nil { + return x.ProtobufPythonicTypesEnabled + } + return false +} + // Describes settings to use when generating API methods that use the // long-running operation pattern. // All default values below are from those used in the client library @@ -1205,7 +1294,7 @@ type MethodSettings_LongRunning struct { func (x *MethodSettings_LongRunning) Reset() { *x = MethodSettings_LongRunning{} if protoimpl.UnsafeEnabled { - mi := &file_google_api_client_proto_msgTypes[16] + mi := &file_google_api_client_proto_msgTypes[18] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -1218,7 +1307,7 @@ func (x *MethodSettings_LongRunning) String() string { func (*MethodSettings_LongRunning) ProtoMessage() {} func (x *MethodSettings_LongRunning) ProtoReflect() protoreflect.Message { - mi := &file_google_api_client_proto_msgTypes[16] + mi := &file_google_api_client_proto_msgTypes[18] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1406,7 +1495,7 @@ var file_google_api_client_proto_rawDesc = []byte{ 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x1e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0x94, 0x01, 0x0a, 0x16, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, + 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0xf8, 0x01, 0x0a, 0x16, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x30, 0x0a, 0x12, 0x72, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x5f, 0x64, 0x6f, 0x63, 0x73, 0x5f, 0x75, 0x72, 0x69, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x42, 0x02, 0x18, @@ -1415,251 +1504,275 @@ var file_google_api_client_proto_rawDesc = []byte{ 0x6f, 0x6e, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0e, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x4c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x44, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, - 0x0c, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x22, 0x93, 0x05, - 0x0a, 0x15, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x4c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x53, - 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x18, 0x0a, 0x07, 0x76, 0x65, 0x72, 0x73, 0x69, - 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, - 0x6e, 0x12, 0x3a, 0x0a, 0x0c, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x5f, 0x73, 0x74, 0x61, 0x67, - 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x17, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x53, 0x74, 0x61, 0x67, 0x65, - 0x52, 0x0b, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x53, 0x74, 0x61, 0x67, 0x65, 0x12, 0x2c, 0x0a, - 0x12, 0x72, 0x65, 0x73, 0x74, 0x5f, 0x6e, 0x75, 0x6d, 0x65, 0x72, 0x69, 0x63, 0x5f, 0x65, 0x6e, - 0x75, 0x6d, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x52, 0x10, 0x72, 0x65, 0x73, 0x74, 0x4e, - 0x75, 0x6d, 0x65, 0x72, 0x69, 0x63, 0x45, 0x6e, 0x75, 0x6d, 0x73, 0x12, 0x3d, 0x0a, 0x0d, 0x6a, - 0x61, 0x76, 0x61, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x15, 0x20, 0x01, + 0x0c, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x62, 0x0a, + 0x1a, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x5f, 0x67, 0x61, 0x70, 0x69, 0x63, + 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x53, + 0x65, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x47, 0x61, 0x70, 0x69, 0x63, 0x47, 0x65, 0x6e, + 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x18, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x69, + 0x76, 0x65, 0x47, 0x61, 0x70, 0x69, 0x63, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x22, 0x93, 0x05, 0x0a, 0x15, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x4c, 0x69, 0x62, 0x72, + 0x61, 0x72, 0x79, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x18, 0x0a, 0x07, 0x76, + 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x76, 0x65, + 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x3a, 0x0a, 0x0c, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x5f, + 0x73, 0x74, 0x61, 0x67, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x17, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x53, + 0x74, 0x61, 0x67, 0x65, 0x52, 0x0b, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x53, 0x74, 0x61, 0x67, + 0x65, 0x12, 0x2c, 0x0a, 0x12, 0x72, 0x65, 0x73, 0x74, 0x5f, 0x6e, 0x75, 0x6d, 0x65, 0x72, 0x69, + 0x63, 0x5f, 0x65, 0x6e, 0x75, 0x6d, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x52, 0x10, 0x72, + 0x65, 0x73, 0x74, 0x4e, 0x75, 0x6d, 0x65, 0x72, 0x69, 0x63, 0x45, 0x6e, 0x75, 0x6d, 0x73, 0x12, + 0x3d, 0x0a, 0x0d, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, + 0x18, 0x15, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x61, 0x70, 0x69, 0x2e, 0x4a, 0x61, 0x76, 0x61, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, + 0x52, 0x0c, 0x6a, 0x61, 0x76, 0x61, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, + 0x0a, 0x0c, 0x63, 0x70, 0x70, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x16, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x17, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, + 0x69, 0x2e, 0x43, 0x70, 0x70, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0b, 0x63, + 0x70, 0x70, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x0c, 0x70, 0x68, + 0x70, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x17, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x17, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x50, 0x68, + 0x70, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0b, 0x70, 0x68, 0x70, 0x53, 0x65, + 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x43, 0x0a, 0x0f, 0x70, 0x79, 0x74, 0x68, 0x6f, 0x6e, + 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x18, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x50, 0x79, 0x74, + 0x68, 0x6f, 0x6e, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0e, 0x70, 0x79, 0x74, + 0x68, 0x6f, 0x6e, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3d, 0x0a, 0x0d, 0x6e, + 0x6f, 0x64, 0x65, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x19, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, - 0x4a, 0x61, 0x76, 0x61, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0c, 0x6a, 0x61, - 0x76, 0x61, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x0c, 0x63, 0x70, - 0x70, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x16, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x17, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x70, - 0x70, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0b, 0x63, 0x70, 0x70, 0x53, 0x65, - 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x0c, 0x70, 0x68, 0x70, 0x5f, 0x73, 0x65, - 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x17, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x17, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x50, 0x68, 0x70, 0x53, 0x65, 0x74, - 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0b, 0x70, 0x68, 0x70, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, - 0x67, 0x73, 0x12, 0x43, 0x0a, 0x0f, 0x70, 0x79, 0x74, 0x68, 0x6f, 0x6e, 0x5f, 0x73, 0x65, 0x74, - 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x18, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x50, 0x79, 0x74, 0x68, 0x6f, 0x6e, 0x53, - 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0e, 0x70, 0x79, 0x74, 0x68, 0x6f, 0x6e, 0x53, - 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3d, 0x0a, 0x0d, 0x6e, 0x6f, 0x64, 0x65, 0x5f, - 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x19, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x18, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4e, 0x6f, 0x64, 0x65, - 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0c, 0x6e, 0x6f, 0x64, 0x65, 0x53, 0x65, - 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x43, 0x0a, 0x0f, 0x64, 0x6f, 0x74, 0x6e, 0x65, 0x74, - 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x1a, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x44, 0x6f, 0x74, - 0x6e, 0x65, 0x74, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0e, 0x64, 0x6f, 0x74, - 0x6e, 0x65, 0x74, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3d, 0x0a, 0x0d, 0x72, - 0x75, 0x62, 0x79, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x1b, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, - 0x52, 0x75, 0x62, 0x79, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0c, 0x72, 0x75, - 0x62, 0x79, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x37, 0x0a, 0x0b, 0x67, 0x6f, - 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x1c, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x47, 0x6f, 0x53, - 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0a, 0x67, 0x6f, 0x53, 0x65, 0x74, 0x74, 0x69, - 0x6e, 0x67, 0x73, 0x22, 0xf4, 0x04, 0x0a, 0x0a, 0x50, 0x75, 0x62, 0x6c, 0x69, 0x73, 0x68, 0x69, - 0x6e, 0x67, 0x12, 0x43, 0x0a, 0x0f, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x5f, 0x73, 0x65, 0x74, - 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x53, - 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0e, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x53, - 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x22, 0x0a, 0x0d, 0x6e, 0x65, 0x77, 0x5f, 0x69, - 0x73, 0x73, 0x75, 0x65, 0x5f, 0x75, 0x72, 0x69, 0x18, 0x65, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, - 0x6e, 0x65, 0x77, 0x49, 0x73, 0x73, 0x75, 0x65, 0x55, 0x72, 0x69, 0x12, 0x2b, 0x0a, 0x11, 0x64, - 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x75, 0x72, 0x69, - 0x18, 0x66, 0x20, 0x01, 0x28, 0x09, 0x52, 0x10, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x55, 0x72, 0x69, 0x12, 0x24, 0x0a, 0x0e, 0x61, 0x70, 0x69, 0x5f, - 0x73, 0x68, 0x6f, 0x72, 0x74, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x67, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x0c, 0x61, 0x70, 0x69, 0x53, 0x68, 0x6f, 0x72, 0x74, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x21, - 0x0a, 0x0c, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, 0x5f, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x18, 0x68, - 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, 0x4c, 0x61, 0x62, 0x65, - 0x6c, 0x12, 0x34, 0x0a, 0x16, 0x63, 0x6f, 0x64, 0x65, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x5f, 0x67, - 0x69, 0x74, 0x68, 0x75, 0x62, 0x5f, 0x74, 0x65, 0x61, 0x6d, 0x73, 0x18, 0x69, 0x20, 0x03, 0x28, - 0x09, 0x52, 0x14, 0x63, 0x6f, 0x64, 0x65, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x47, 0x69, 0x74, 0x68, - 0x75, 0x62, 0x54, 0x65, 0x61, 0x6d, 0x73, 0x12, 0x24, 0x0a, 0x0e, 0x64, 0x6f, 0x63, 0x5f, 0x74, - 0x61, 0x67, 0x5f, 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x18, 0x6a, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x0c, 0x64, 0x6f, 0x63, 0x54, 0x61, 0x67, 0x50, 0x72, 0x65, 0x66, 0x69, 0x78, 0x12, 0x49, 0x0a, - 0x0c, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x6b, 0x20, - 0x01, 0x28, 0x0e, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, - 0x2e, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x4c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x4f, 0x72, - 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0c, 0x6f, 0x72, 0x67, 0x61, - 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4c, 0x0a, 0x10, 0x6c, 0x69, 0x62, 0x72, - 0x61, 0x72, 0x79, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x6d, 0x20, 0x03, - 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, - 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x4c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x53, 0x65, 0x74, - 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0f, 0x6c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x53, 0x65, - 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x49, 0x0a, 0x21, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x5f, - 0x72, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x5f, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, - 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x75, 0x72, 0x69, 0x18, 0x6e, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x1e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, - 0x65, 0x44, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x55, 0x72, - 0x69, 0x12, 0x47, 0x0a, 0x20, 0x72, 0x65, 0x73, 0x74, 0x5f, 0x72, 0x65, 0x66, 0x65, 0x72, 0x65, - 0x6e, 0x63, 0x65, 0x5f, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x5f, 0x75, 0x72, 0x69, 0x18, 0x6f, 0x20, 0x01, 0x28, 0x09, 0x52, 0x1d, 0x72, 0x65, 0x73, - 0x74, 0x52, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x44, 0x6f, 0x63, 0x75, 0x6d, 0x65, - 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x55, 0x72, 0x69, 0x22, 0x9a, 0x02, 0x0a, 0x0c, 0x4a, - 0x61, 0x76, 0x61, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x27, 0x0a, 0x0f, 0x6c, - 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x5f, 0x70, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x09, 0x52, 0x0e, 0x6c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x50, 0x61, 0x63, - 0x6b, 0x61, 0x67, 0x65, 0x12, 0x5f, 0x0a, 0x13, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x5f, - 0x63, 0x6c, 0x61, 0x73, 0x73, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, - 0x0b, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4a, - 0x61, 0x76, 0x61, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, 0x53, 0x65, 0x72, 0x76, - 0x69, 0x63, 0x65, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x45, 0x6e, 0x74, - 0x72, 0x79, 0x52, 0x11, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x43, 0x6c, 0x61, 0x73, 0x73, - 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x18, - 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, + 0x4e, 0x6f, 0x64, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0c, 0x6e, 0x6f, + 0x64, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x43, 0x0a, 0x0f, 0x64, 0x6f, + 0x74, 0x6e, 0x65, 0x74, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x1a, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, + 0x2e, 0x44, 0x6f, 0x74, 0x6e, 0x65, 0x74, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, + 0x0e, 0x64, 0x6f, 0x74, 0x6e, 0x65, 0x74, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, + 0x3d, 0x0a, 0x0d, 0x72, 0x75, 0x62, 0x79, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, + 0x18, 0x1b, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x61, 0x70, 0x69, 0x2e, 0x52, 0x75, 0x62, 0x79, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, + 0x52, 0x0c, 0x72, 0x75, 0x62, 0x79, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x37, + 0x0a, 0x0b, 0x67, 0x6f, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x1c, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, + 0x2e, 0x47, 0x6f, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0a, 0x67, 0x6f, 0x53, + 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x22, 0xf4, 0x04, 0x0a, 0x0a, 0x50, 0x75, 0x62, 0x6c, + 0x69, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x12, 0x43, 0x0a, 0x0f, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, + 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, + 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, + 0x68, 0x6f, 0x64, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0e, 0x6d, 0x65, 0x74, + 0x68, 0x6f, 0x64, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x22, 0x0a, 0x0d, 0x6e, + 0x65, 0x77, 0x5f, 0x69, 0x73, 0x73, 0x75, 0x65, 0x5f, 0x75, 0x72, 0x69, 0x18, 0x65, 0x20, 0x01, + 0x28, 0x09, 0x52, 0x0b, 0x6e, 0x65, 0x77, 0x49, 0x73, 0x73, 0x75, 0x65, 0x55, 0x72, 0x69, 0x12, + 0x2b, 0x0a, 0x11, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x5f, 0x75, 0x72, 0x69, 0x18, 0x66, 0x20, 0x01, 0x28, 0x09, 0x52, 0x10, 0x64, 0x6f, 0x63, 0x75, + 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x55, 0x72, 0x69, 0x12, 0x24, 0x0a, 0x0e, + 0x61, 0x70, 0x69, 0x5f, 0x73, 0x68, 0x6f, 0x72, 0x74, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x67, + 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x61, 0x70, 0x69, 0x53, 0x68, 0x6f, 0x72, 0x74, 0x4e, 0x61, + 0x6d, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, 0x5f, 0x6c, 0x61, 0x62, + 0x65, 0x6c, 0x18, 0x68, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, + 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x12, 0x34, 0x0a, 0x16, 0x63, 0x6f, 0x64, 0x65, 0x6f, 0x77, 0x6e, + 0x65, 0x72, 0x5f, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, 0x5f, 0x74, 0x65, 0x61, 0x6d, 0x73, 0x18, + 0x69, 0x20, 0x03, 0x28, 0x09, 0x52, 0x14, 0x63, 0x6f, 0x64, 0x65, 0x6f, 0x77, 0x6e, 0x65, 0x72, + 0x47, 0x69, 0x74, 0x68, 0x75, 0x62, 0x54, 0x65, 0x61, 0x6d, 0x73, 0x12, 0x24, 0x0a, 0x0e, 0x64, + 0x6f, 0x63, 0x5f, 0x74, 0x61, 0x67, 0x5f, 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x18, 0x6a, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x0c, 0x64, 0x6f, 0x63, 0x54, 0x61, 0x67, 0x50, 0x72, 0x65, 0x66, 0x69, + 0x78, 0x12, 0x49, 0x0a, 0x0c, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x18, 0x6b, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x4c, 0x69, 0x62, 0x72, 0x61, + 0x72, 0x79, 0x4f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0c, + 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4c, 0x0a, 0x10, + 0x6c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x5f, 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, + 0x18, 0x6d, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x4c, 0x69, 0x62, 0x72, 0x61, 0x72, + 0x79, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x0f, 0x6c, 0x69, 0x62, 0x72, 0x61, + 0x72, 0x79, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x49, 0x0a, 0x21, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x5f, 0x72, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x5f, 0x64, 0x6f, + 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x75, 0x72, 0x69, 0x18, + 0x6e, 0x20, 0x01, 0x28, 0x09, 0x52, 0x1e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x65, 0x66, 0x65, + 0x72, 0x65, 0x6e, 0x63, 0x65, 0x44, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x55, 0x72, 0x69, 0x12, 0x47, 0x0a, 0x20, 0x72, 0x65, 0x73, 0x74, 0x5f, 0x72, 0x65, + 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x5f, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x75, 0x72, 0x69, 0x18, 0x6f, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x1d, 0x72, 0x65, 0x73, 0x74, 0x52, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x44, 0x6f, + 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x55, 0x72, 0x69, 0x22, 0x9a, + 0x02, 0x0a, 0x0c, 0x4a, 0x61, 0x76, 0x61, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, + 0x27, 0x0a, 0x0f, 0x6c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x5f, 0x70, 0x61, 0x63, 0x6b, 0x61, + 0x67, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0e, 0x6c, 0x69, 0x62, 0x72, 0x61, 0x72, + 0x79, 0x50, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x12, 0x5f, 0x0a, 0x13, 0x73, 0x65, 0x72, 0x76, + 0x69, 0x63, 0x65, 0x5f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x73, 0x18, + 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, + 0x70, 0x69, 0x2e, 0x4a, 0x61, 0x76, 0x61, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, + 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x4e, 0x61, 0x6d, 0x65, + 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x11, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x43, + 0x6c, 0x61, 0x73, 0x73, 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, + 0x6d, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, + 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, + 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x1a, 0x44, 0x0a, 0x16, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, + 0x43, 0x6c, 0x61, 0x73, 0x73, 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, + 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, + 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, + 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x49, 0x0a, 0x0b, 0x43, + 0x70, 0x70, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, + 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, + 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, + 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x22, 0x49, 0x0a, 0x0b, 0x50, 0x68, 0x70, 0x53, 0x65, 0x74, + 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x18, + 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, - 0x6e, 0x1a, 0x44, 0x0a, 0x16, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x43, 0x6c, 0x61, 0x73, - 0x73, 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, - 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, - 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, - 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x49, 0x0a, 0x0b, 0x43, 0x70, 0x70, 0x53, 0x65, + 0x6e, 0x22, 0xc5, 0x02, 0x0a, 0x0e, 0x50, 0x79, 0x74, 0x68, 0x6f, 0x6e, 0x53, 0x65, 0x74, 0x74, + 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, + 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, + 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, + 0x12, 0x64, 0x0a, 0x15, 0x65, 0x78, 0x70, 0x65, 0x72, 0x69, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x6c, + 0x5f, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, + 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x50, 0x79, 0x74, + 0x68, 0x6f, 0x6e, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, 0x45, 0x78, 0x70, 0x65, + 0x72, 0x69, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, + 0x52, 0x14, 0x65, 0x78, 0x70, 0x65, 0x72, 0x69, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x46, 0x65, + 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x1a, 0x90, 0x01, 0x0a, 0x14, 0x45, 0x78, 0x70, 0x65, 0x72, + 0x69, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, + 0x31, 0x0a, 0x15, 0x72, 0x65, 0x73, 0x74, 0x5f, 0x61, 0x73, 0x79, 0x6e, 0x63, 0x5f, 0x69, 0x6f, + 0x5f, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x52, 0x12, + 0x72, 0x65, 0x73, 0x74, 0x41, 0x73, 0x79, 0x6e, 0x63, 0x49, 0x6f, 0x45, 0x6e, 0x61, 0x62, 0x6c, + 0x65, 0x64, 0x12, 0x45, 0x0a, 0x1f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x5f, 0x70, + 0x79, 0x74, 0x68, 0x6f, 0x6e, 0x69, 0x63, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x73, 0x5f, 0x65, 0x6e, + 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x1c, 0x70, 0x72, 0x6f, + 0x74, 0x6f, 0x62, 0x75, 0x66, 0x50, 0x79, 0x74, 0x68, 0x6f, 0x6e, 0x69, 0x63, 0x54, 0x79, 0x70, + 0x65, 0x73, 0x45, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x22, 0x4a, 0x0a, 0x0c, 0x4e, 0x6f, 0x64, + 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, + 0x6d, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, + 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, + 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x22, 0xae, 0x04, 0x0a, 0x0e, 0x44, 0x6f, 0x74, 0x6e, 0x65, 0x74, + 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, 0x6d, + 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, 0x67, + 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, 0x6f, + 0x6d, 0x6d, 0x6f, 0x6e, 0x12, 0x5a, 0x0a, 0x10, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x5f, + 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2f, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x44, 0x6f, 0x74, 0x6e, + 0x65, 0x74, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, 0x52, 0x65, 0x6e, 0x61, 0x6d, + 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, + 0x0f, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, + 0x12, 0x5d, 0x0a, 0x11, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x73, 0x6f, + 0x75, 0x72, 0x63, 0x65, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x30, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x44, 0x6f, 0x74, 0x6e, 0x65, 0x74, 0x53, + 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, 0x52, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x52, + 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x10, 0x72, + 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x12, + 0x2b, 0x0a, 0x11, 0x69, 0x67, 0x6e, 0x6f, 0x72, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x75, + 0x72, 0x63, 0x65, 0x73, 0x18, 0x04, 0x20, 0x03, 0x28, 0x09, 0x52, 0x10, 0x69, 0x67, 0x6e, 0x6f, + 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x12, 0x38, 0x0a, 0x18, + 0x66, 0x6f, 0x72, 0x63, 0x65, 0x64, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x73, 0x70, 0x61, 0x63, 0x65, + 0x5f, 0x61, 0x6c, 0x69, 0x61, 0x73, 0x65, 0x73, 0x18, 0x05, 0x20, 0x03, 0x28, 0x09, 0x52, 0x16, + 0x66, 0x6f, 0x72, 0x63, 0x65, 0x64, 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x70, 0x61, 0x63, 0x65, 0x41, + 0x6c, 0x69, 0x61, 0x73, 0x65, 0x73, 0x12, 0x35, 0x0a, 0x16, 0x68, 0x61, 0x6e, 0x64, 0x77, 0x72, + 0x69, 0x74, 0x74, 0x65, 0x6e, 0x5f, 0x73, 0x69, 0x67, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, + 0x18, 0x06, 0x20, 0x03, 0x28, 0x09, 0x52, 0x15, 0x68, 0x61, 0x6e, 0x64, 0x77, 0x72, 0x69, 0x74, + 0x74, 0x65, 0x6e, 0x53, 0x69, 0x67, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x1a, 0x42, 0x0a, + 0x14, 0x52, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, + 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, + 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, + 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, + 0x01, 0x1a, 0x43, 0x0a, 0x15, 0x52, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, + 0x75, 0x72, 0x63, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, + 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, + 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, + 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x4a, 0x0a, 0x0c, 0x52, 0x75, 0x62, 0x79, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, 0x6f, 0x6d, 0x6d, - 0x6f, 0x6e, 0x22, 0x49, 0x0a, 0x0b, 0x50, 0x68, 0x70, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, + 0x6f, 0x6e, 0x22, 0xe4, 0x01, 0x0a, 0x0a, 0x47, 0x6f, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, - 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x22, 0xfd, 0x01, - 0x0a, 0x0e, 0x50, 0x79, 0x74, 0x68, 0x6f, 0x6e, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, - 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, - 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, - 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x12, 0x64, 0x0a, 0x15, - 0x65, 0x78, 0x70, 0x65, 0x72, 0x69, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x5f, 0x66, 0x65, 0x61, - 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x50, 0x79, 0x74, 0x68, 0x6f, 0x6e, 0x53, - 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, 0x45, 0x78, 0x70, 0x65, 0x72, 0x69, 0x6d, 0x65, - 0x6e, 0x74, 0x61, 0x6c, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x52, 0x14, 0x65, 0x78, - 0x70, 0x65, 0x72, 0x69, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, - 0x65, 0x73, 0x1a, 0x49, 0x0a, 0x14, 0x45, 0x78, 0x70, 0x65, 0x72, 0x69, 0x6d, 0x65, 0x6e, 0x74, - 0x61, 0x6c, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x31, 0x0a, 0x15, 0x72, 0x65, - 0x73, 0x74, 0x5f, 0x61, 0x73, 0x79, 0x6e, 0x63, 0x5f, 0x69, 0x6f, 0x5f, 0x65, 0x6e, 0x61, 0x62, - 0x6c, 0x65, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x52, 0x12, 0x72, 0x65, 0x73, 0x74, 0x41, - 0x73, 0x79, 0x6e, 0x63, 0x49, 0x6f, 0x45, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x22, 0x4a, 0x0a, - 0x0c, 0x4e, 0x6f, 0x64, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, - 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, - 0x6e, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, - 0x73, 0x52, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x22, 0xae, 0x04, 0x0a, 0x0e, 0x44, 0x6f, - 0x74, 0x6e, 0x65, 0x74, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, - 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, - 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, - 0x52, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x12, 0x5a, 0x0a, 0x10, 0x72, 0x65, 0x6e, 0x61, - 0x6d, 0x65, 0x64, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x18, 0x02, 0x20, 0x03, - 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, - 0x44, 0x6f, 0x74, 0x6e, 0x65, 0x74, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, 0x52, - 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x45, 0x6e, - 0x74, 0x72, 0x79, 0x52, 0x0f, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, - 0x69, 0x63, 0x65, 0x73, 0x12, 0x5d, 0x0a, 0x11, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x5f, - 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, - 0x30, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x44, 0x6f, 0x74, - 0x6e, 0x65, 0x74, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, 0x52, 0x65, 0x6e, 0x61, - 0x6d, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, - 0x79, 0x52, 0x10, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x73, 0x12, 0x2b, 0x0a, 0x11, 0x69, 0x67, 0x6e, 0x6f, 0x72, 0x65, 0x64, 0x5f, 0x72, - 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x18, 0x04, 0x20, 0x03, 0x28, 0x09, 0x52, 0x10, - 0x69, 0x67, 0x6e, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, - 0x12, 0x38, 0x0a, 0x18, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x64, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x73, - 0x70, 0x61, 0x63, 0x65, 0x5f, 0x61, 0x6c, 0x69, 0x61, 0x73, 0x65, 0x73, 0x18, 0x05, 0x20, 0x03, - 0x28, 0x09, 0x52, 0x16, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x64, 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x70, - 0x61, 0x63, 0x65, 0x41, 0x6c, 0x69, 0x61, 0x73, 0x65, 0x73, 0x12, 0x35, 0x0a, 0x16, 0x68, 0x61, - 0x6e, 0x64, 0x77, 0x72, 0x69, 0x74, 0x74, 0x65, 0x6e, 0x5f, 0x73, 0x69, 0x67, 0x6e, 0x61, 0x74, - 0x75, 0x72, 0x65, 0x73, 0x18, 0x06, 0x20, 0x03, 0x28, 0x09, 0x52, 0x15, 0x68, 0x61, 0x6e, 0x64, - 0x77, 0x72, 0x69, 0x74, 0x74, 0x65, 0x6e, 0x53, 0x69, 0x67, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65, - 0x73, 0x1a, 0x42, 0x0a, 0x14, 0x52, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, - 0x69, 0x63, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, - 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, - 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, - 0x65, 0x3a, 0x02, 0x38, 0x01, 0x1a, 0x43, 0x0a, 0x15, 0x52, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, - 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, - 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, - 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x4a, 0x0a, 0x0c, 0x52, 0x75, - 0x62, 0x79, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, - 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, - 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, - 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x22, 0x48, 0x0a, 0x0a, 0x47, 0x6f, 0x53, 0x65, 0x74, 0x74, - 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, - 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, - 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, - 0x22, 0xc2, 0x03, 0x0a, 0x0e, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x53, 0x65, 0x74, 0x74, 0x69, - 0x6e, 0x67, 0x73, 0x12, 0x1a, 0x0a, 0x08, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x18, - 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x12, - 0x49, 0x0a, 0x0c, 0x6c, 0x6f, 0x6e, 0x67, 0x5f, 0x72, 0x75, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, - 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, - 0x73, 0x2e, 0x4c, 0x6f, 0x6e, 0x67, 0x52, 0x75, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x52, 0x0b, 0x6c, - 0x6f, 0x6e, 0x67, 0x52, 0x75, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x12, 0x32, 0x0a, 0x15, 0x61, 0x75, - 0x74, 0x6f, 0x5f, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x74, 0x65, 0x64, 0x5f, 0x66, 0x69, 0x65, - 0x6c, 0x64, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x09, 0x52, 0x13, 0x61, 0x75, 0x74, 0x6f, 0x50, - 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x74, 0x65, 0x64, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x73, 0x1a, 0x94, - 0x02, 0x0a, 0x0b, 0x4c, 0x6f, 0x6e, 0x67, 0x52, 0x75, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x12, 0x47, - 0x0a, 0x12, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x5f, 0x70, 0x6f, 0x6c, 0x6c, 0x5f, 0x64, - 0x65, 0x6c, 0x61, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x10, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x50, 0x6f, - 0x6c, 0x6c, 0x44, 0x65, 0x6c, 0x61, 0x79, 0x12, 0x32, 0x0a, 0x15, 0x70, 0x6f, 0x6c, 0x6c, 0x5f, - 0x64, 0x65, 0x6c, 0x61, 0x79, 0x5f, 0x6d, 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c, 0x69, 0x65, 0x72, - 0x18, 0x02, 0x20, 0x01, 0x28, 0x02, 0x52, 0x13, 0x70, 0x6f, 0x6c, 0x6c, 0x44, 0x65, 0x6c, 0x61, - 0x79, 0x4d, 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c, 0x69, 0x65, 0x72, 0x12, 0x3f, 0x0a, 0x0e, 0x6d, - 0x61, 0x78, 0x5f, 0x70, 0x6f, 0x6c, 0x6c, 0x5f, 0x64, 0x65, 0x6c, 0x61, 0x79, 0x18, 0x03, 0x20, + 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x12, 0x56, 0x0a, + 0x10, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, + 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x47, 0x6f, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, + 0x52, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x45, + 0x6e, 0x74, 0x72, 0x79, 0x52, 0x0f, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x53, 0x65, 0x72, + 0x76, 0x69, 0x63, 0x65, 0x73, 0x1a, 0x42, 0x0a, 0x14, 0x52, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, + 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, + 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, + 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, + 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0xc2, 0x03, 0x0a, 0x0e, 0x4d, 0x65, + 0x74, 0x68, 0x6f, 0x64, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x1a, 0x0a, 0x08, + 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, + 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x12, 0x49, 0x0a, 0x0c, 0x6c, 0x6f, 0x6e, 0x67, + 0x5f, 0x72, 0x75, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x26, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x68, + 0x6f, 0x64, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, 0x4c, 0x6f, 0x6e, 0x67, 0x52, + 0x75, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x52, 0x0b, 0x6c, 0x6f, 0x6e, 0x67, 0x52, 0x75, 0x6e, 0x6e, + 0x69, 0x6e, 0x67, 0x12, 0x32, 0x0a, 0x15, 0x61, 0x75, 0x74, 0x6f, 0x5f, 0x70, 0x6f, 0x70, 0x75, + 0x6c, 0x61, 0x74, 0x65, 0x64, 0x5f, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x73, 0x18, 0x03, 0x20, 0x03, + 0x28, 0x09, 0x52, 0x13, 0x61, 0x75, 0x74, 0x6f, 0x50, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x74, 0x65, + 0x64, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x73, 0x1a, 0x94, 0x02, 0x0a, 0x0b, 0x4c, 0x6f, 0x6e, 0x67, + 0x52, 0x75, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x12, 0x47, 0x0a, 0x12, 0x69, 0x6e, 0x69, 0x74, 0x69, + 0x61, 0x6c, 0x5f, 0x70, 0x6f, 0x6c, 0x6c, 0x5f, 0x64, 0x65, 0x6c, 0x61, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0c, - 0x6d, 0x61, 0x78, 0x50, 0x6f, 0x6c, 0x6c, 0x44, 0x65, 0x6c, 0x61, 0x79, 0x12, 0x47, 0x0a, 0x12, - 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x5f, 0x70, 0x6f, 0x6c, 0x6c, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x6f, - 0x75, 0x74, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x52, 0x10, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x50, 0x6f, 0x6c, 0x6c, 0x54, 0x69, - 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x2a, 0xa3, 0x01, 0x0a, 0x19, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, - 0x4c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x4f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x12, 0x2b, 0x0a, 0x27, 0x43, 0x4c, 0x49, 0x45, 0x4e, 0x54, 0x5f, 0x4c, 0x49, - 0x42, 0x52, 0x41, 0x52, 0x59, 0x5f, 0x4f, 0x52, 0x47, 0x41, 0x4e, 0x49, 0x5a, 0x41, 0x54, 0x49, - 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, - 0x12, 0x09, 0x0a, 0x05, 0x43, 0x4c, 0x4f, 0x55, 0x44, 0x10, 0x01, 0x12, 0x07, 0x0a, 0x03, 0x41, - 0x44, 0x53, 0x10, 0x02, 0x12, 0x0a, 0x0a, 0x06, 0x50, 0x48, 0x4f, 0x54, 0x4f, 0x53, 0x10, 0x03, - 0x12, 0x0f, 0x0a, 0x0b, 0x53, 0x54, 0x52, 0x45, 0x45, 0x54, 0x5f, 0x56, 0x49, 0x45, 0x57, 0x10, - 0x04, 0x12, 0x0c, 0x0a, 0x08, 0x53, 0x48, 0x4f, 0x50, 0x50, 0x49, 0x4e, 0x47, 0x10, 0x05, 0x12, - 0x07, 0x0a, 0x03, 0x47, 0x45, 0x4f, 0x10, 0x06, 0x12, 0x11, 0x0a, 0x0d, 0x47, 0x45, 0x4e, 0x45, - 0x52, 0x41, 0x54, 0x49, 0x56, 0x45, 0x5f, 0x41, 0x49, 0x10, 0x07, 0x2a, 0x67, 0x0a, 0x18, 0x43, - 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x4c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x44, 0x65, 0x73, 0x74, - 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x2a, 0x0a, 0x26, 0x43, 0x4c, 0x49, 0x45, 0x4e, - 0x54, 0x5f, 0x4c, 0x49, 0x42, 0x52, 0x41, 0x52, 0x59, 0x5f, 0x44, 0x45, 0x53, 0x54, 0x49, 0x4e, - 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, - 0x44, 0x10, 0x00, 0x12, 0x0a, 0x0a, 0x06, 0x47, 0x49, 0x54, 0x48, 0x55, 0x42, 0x10, 0x0a, 0x12, - 0x13, 0x0a, 0x0f, 0x50, 0x41, 0x43, 0x4b, 0x41, 0x47, 0x45, 0x5f, 0x4d, 0x41, 0x4e, 0x41, 0x47, - 0x45, 0x52, 0x10, 0x14, 0x3a, 0x4a, 0x0a, 0x10, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x5f, 0x73, - 0x69, 0x67, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65, 0x12, 0x1e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d, 0x65, 0x74, 0x68, 0x6f, - 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x9b, 0x08, 0x20, 0x03, 0x28, 0x09, 0x52, - 0x0f, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x53, 0x69, 0x67, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65, - 0x3a, 0x43, 0x0a, 0x0c, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, 0x68, 0x6f, 0x73, 0x74, - 0x12, 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, - 0x73, 0x18, 0x99, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, - 0x74, 0x48, 0x6f, 0x73, 0x74, 0x3a, 0x43, 0x0a, 0x0c, 0x6f, 0x61, 0x75, 0x74, 0x68, 0x5f, 0x73, - 0x63, 0x6f, 0x70, 0x65, 0x73, 0x12, 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x4f, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x9a, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x6f, - 0x61, 0x75, 0x74, 0x68, 0x53, 0x63, 0x6f, 0x70, 0x65, 0x73, 0x3a, 0x44, 0x0a, 0x0b, 0x61, 0x70, - 0x69, 0x5f, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x65, 0x72, 0x76, - 0x69, 0x63, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0xc1, 0xba, 0xab, 0xfa, 0x01, - 0x20, 0x01, 0x28, 0x09, 0x52, 0x0a, 0x61, 0x70, 0x69, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, - 0x42, 0x69, 0x0a, 0x0e, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, - 0x70, 0x69, 0x42, 0x0b, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, - 0x01, 0x5a, 0x41, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, - 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x65, 0x6e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x61, 0x6e, 0x6e, - 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x3b, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0xa2, 0x02, 0x04, 0x47, 0x41, 0x50, 0x49, 0x62, 0x06, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x33, + 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x10, + 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x50, 0x6f, 0x6c, 0x6c, 0x44, 0x65, 0x6c, 0x61, 0x79, + 0x12, 0x32, 0x0a, 0x15, 0x70, 0x6f, 0x6c, 0x6c, 0x5f, 0x64, 0x65, 0x6c, 0x61, 0x79, 0x5f, 0x6d, + 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c, 0x69, 0x65, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x02, 0x52, + 0x13, 0x70, 0x6f, 0x6c, 0x6c, 0x44, 0x65, 0x6c, 0x61, 0x79, 0x4d, 0x75, 0x6c, 0x74, 0x69, 0x70, + 0x6c, 0x69, 0x65, 0x72, 0x12, 0x3f, 0x0a, 0x0e, 0x6d, 0x61, 0x78, 0x5f, 0x70, 0x6f, 0x6c, 0x6c, + 0x5f, 0x64, 0x65, 0x6c, 0x61, 0x79, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, + 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0c, 0x6d, 0x61, 0x78, 0x50, 0x6f, 0x6c, 0x6c, + 0x44, 0x65, 0x6c, 0x61, 0x79, 0x12, 0x47, 0x0a, 0x12, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x5f, 0x70, + 0x6f, 0x6c, 0x6c, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x18, 0x04, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x10, 0x74, 0x6f, + 0x74, 0x61, 0x6c, 0x50, 0x6f, 0x6c, 0x6c, 0x54, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x22, 0x34, + 0x0a, 0x18, 0x53, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x47, 0x61, 0x70, 0x69, 0x63, + 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x18, 0x0a, 0x07, 0x6d, 0x65, + 0x74, 0x68, 0x6f, 0x64, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x09, 0x52, 0x07, 0x6d, 0x65, 0x74, + 0x68, 0x6f, 0x64, 0x73, 0x2a, 0xa3, 0x01, 0x0a, 0x19, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x4c, + 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x4f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x12, 0x2b, 0x0a, 0x27, 0x43, 0x4c, 0x49, 0x45, 0x4e, 0x54, 0x5f, 0x4c, 0x49, 0x42, + 0x52, 0x41, 0x52, 0x59, 0x5f, 0x4f, 0x52, 0x47, 0x41, 0x4e, 0x49, 0x5a, 0x41, 0x54, 0x49, 0x4f, + 0x4e, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, + 0x09, 0x0a, 0x05, 0x43, 0x4c, 0x4f, 0x55, 0x44, 0x10, 0x01, 0x12, 0x07, 0x0a, 0x03, 0x41, 0x44, + 0x53, 0x10, 0x02, 0x12, 0x0a, 0x0a, 0x06, 0x50, 0x48, 0x4f, 0x54, 0x4f, 0x53, 0x10, 0x03, 0x12, + 0x0f, 0x0a, 0x0b, 0x53, 0x54, 0x52, 0x45, 0x45, 0x54, 0x5f, 0x56, 0x49, 0x45, 0x57, 0x10, 0x04, + 0x12, 0x0c, 0x0a, 0x08, 0x53, 0x48, 0x4f, 0x50, 0x50, 0x49, 0x4e, 0x47, 0x10, 0x05, 0x12, 0x07, + 0x0a, 0x03, 0x47, 0x45, 0x4f, 0x10, 0x06, 0x12, 0x11, 0x0a, 0x0d, 0x47, 0x45, 0x4e, 0x45, 0x52, + 0x41, 0x54, 0x49, 0x56, 0x45, 0x5f, 0x41, 0x49, 0x10, 0x07, 0x2a, 0x67, 0x0a, 0x18, 0x43, 0x6c, + 0x69, 0x65, 0x6e, 0x74, 0x4c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x44, 0x65, 0x73, 0x74, 0x69, + 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x2a, 0x0a, 0x26, 0x43, 0x4c, 0x49, 0x45, 0x4e, 0x54, + 0x5f, 0x4c, 0x49, 0x42, 0x52, 0x41, 0x52, 0x59, 0x5f, 0x44, 0x45, 0x53, 0x54, 0x49, 0x4e, 0x41, + 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, + 0x10, 0x00, 0x12, 0x0a, 0x0a, 0x06, 0x47, 0x49, 0x54, 0x48, 0x55, 0x42, 0x10, 0x0a, 0x12, 0x13, + 0x0a, 0x0f, 0x50, 0x41, 0x43, 0x4b, 0x41, 0x47, 0x45, 0x5f, 0x4d, 0x41, 0x4e, 0x41, 0x47, 0x45, + 0x52, 0x10, 0x14, 0x3a, 0x4a, 0x0a, 0x10, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x5f, 0x73, 0x69, + 0x67, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65, 0x12, 0x1e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, + 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x9b, 0x08, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0f, + 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x53, 0x69, 0x67, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65, 0x3a, + 0x43, 0x0a, 0x0c, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, 0x68, 0x6f, 0x73, 0x74, 0x12, + 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, + 0x18, 0x99, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, + 0x48, 0x6f, 0x73, 0x74, 0x3a, 0x43, 0x0a, 0x0c, 0x6f, 0x61, 0x75, 0x74, 0x68, 0x5f, 0x73, 0x63, + 0x6f, 0x70, 0x65, 0x73, 0x12, 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x4f, 0x70, + 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x9a, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x6f, 0x61, + 0x75, 0x74, 0x68, 0x53, 0x63, 0x6f, 0x70, 0x65, 0x73, 0x3a, 0x44, 0x0a, 0x0b, 0x61, 0x70, 0x69, + 0x5f, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, + 0x63, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0xc1, 0xba, 0xab, 0xfa, 0x01, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x0a, 0x61, 0x70, 0x69, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x42, + 0x69, 0x0a, 0x0e, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, + 0x69, 0x42, 0x0b, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, + 0x5a, 0x41, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, + 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x65, 0x6e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x61, 0x6e, 0x6e, 0x6f, + 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x3b, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x73, 0xa2, 0x02, 0x04, 0x47, 0x41, 0x50, 0x49, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, + 0x6f, 0x33, } var ( @@ -1675,7 +1788,7 @@ func file_google_api_client_proto_rawDescGZIP() []byte { } var file_google_api_client_proto_enumTypes = make([]protoimpl.EnumInfo, 2) -var file_google_api_client_proto_msgTypes = make([]protoimpl.MessageInfo, 17) +var file_google_api_client_proto_msgTypes = make([]protoimpl.MessageInfo, 19) var file_google_api_client_proto_goTypes = []interface{}{ (ClientLibraryOrganization)(0), // 0: google.api.ClientLibraryOrganization (ClientLibraryDestination)(0), // 1: google.api.ClientLibraryDestination @@ -1691,55 +1804,59 @@ var file_google_api_client_proto_goTypes = []interface{}{ (*RubySettings)(nil), // 11: google.api.RubySettings (*GoSettings)(nil), // 12: google.api.GoSettings (*MethodSettings)(nil), // 13: google.api.MethodSettings - nil, // 14: google.api.JavaSettings.ServiceClassNamesEntry - (*PythonSettings_ExperimentalFeatures)(nil), // 15: google.api.PythonSettings.ExperimentalFeatures - nil, // 16: google.api.DotnetSettings.RenamedServicesEntry - nil, // 17: google.api.DotnetSettings.RenamedResourcesEntry - (*MethodSettings_LongRunning)(nil), // 18: google.api.MethodSettings.LongRunning - (api.LaunchStage)(0), // 19: google.api.LaunchStage - (*durationpb.Duration)(nil), // 20: google.protobuf.Duration - (*descriptorpb.MethodOptions)(nil), // 21: google.protobuf.MethodOptions - (*descriptorpb.ServiceOptions)(nil), // 22: google.protobuf.ServiceOptions + (*SelectiveGapicGeneration)(nil), // 14: google.api.SelectiveGapicGeneration + nil, // 15: google.api.JavaSettings.ServiceClassNamesEntry + (*PythonSettings_ExperimentalFeatures)(nil), // 16: google.api.PythonSettings.ExperimentalFeatures + nil, // 17: google.api.DotnetSettings.RenamedServicesEntry + nil, // 18: google.api.DotnetSettings.RenamedResourcesEntry + nil, // 19: google.api.GoSettings.RenamedServicesEntry + (*MethodSettings_LongRunning)(nil), // 20: google.api.MethodSettings.LongRunning + (api.LaunchStage)(0), // 21: google.api.LaunchStage + (*durationpb.Duration)(nil), // 22: google.protobuf.Duration + (*descriptorpb.MethodOptions)(nil), // 23: google.protobuf.MethodOptions + (*descriptorpb.ServiceOptions)(nil), // 24: google.protobuf.ServiceOptions } var file_google_api_client_proto_depIdxs = []int32{ 1, // 0: google.api.CommonLanguageSettings.destinations:type_name -> google.api.ClientLibraryDestination - 19, // 1: google.api.ClientLibrarySettings.launch_stage:type_name -> google.api.LaunchStage - 5, // 2: google.api.ClientLibrarySettings.java_settings:type_name -> google.api.JavaSettings - 6, // 3: google.api.ClientLibrarySettings.cpp_settings:type_name -> google.api.CppSettings - 7, // 4: google.api.ClientLibrarySettings.php_settings:type_name -> google.api.PhpSettings - 8, // 5: google.api.ClientLibrarySettings.python_settings:type_name -> google.api.PythonSettings - 9, // 6: google.api.ClientLibrarySettings.node_settings:type_name -> google.api.NodeSettings - 10, // 7: google.api.ClientLibrarySettings.dotnet_settings:type_name -> google.api.DotnetSettings - 11, // 8: google.api.ClientLibrarySettings.ruby_settings:type_name -> google.api.RubySettings - 12, // 9: google.api.ClientLibrarySettings.go_settings:type_name -> google.api.GoSettings - 13, // 10: google.api.Publishing.method_settings:type_name -> google.api.MethodSettings - 0, // 11: google.api.Publishing.organization:type_name -> google.api.ClientLibraryOrganization - 3, // 12: google.api.Publishing.library_settings:type_name -> google.api.ClientLibrarySettings - 14, // 13: google.api.JavaSettings.service_class_names:type_name -> google.api.JavaSettings.ServiceClassNamesEntry - 2, // 14: google.api.JavaSettings.common:type_name -> google.api.CommonLanguageSettings - 2, // 15: google.api.CppSettings.common:type_name -> google.api.CommonLanguageSettings - 2, // 16: google.api.PhpSettings.common:type_name -> google.api.CommonLanguageSettings - 2, // 17: google.api.PythonSettings.common:type_name -> google.api.CommonLanguageSettings - 15, // 18: google.api.PythonSettings.experimental_features:type_name -> google.api.PythonSettings.ExperimentalFeatures - 2, // 19: google.api.NodeSettings.common:type_name -> google.api.CommonLanguageSettings - 2, // 20: google.api.DotnetSettings.common:type_name -> google.api.CommonLanguageSettings - 16, // 21: google.api.DotnetSettings.renamed_services:type_name -> google.api.DotnetSettings.RenamedServicesEntry - 17, // 22: google.api.DotnetSettings.renamed_resources:type_name -> google.api.DotnetSettings.RenamedResourcesEntry - 2, // 23: google.api.RubySettings.common:type_name -> google.api.CommonLanguageSettings - 2, // 24: google.api.GoSettings.common:type_name -> google.api.CommonLanguageSettings - 18, // 25: google.api.MethodSettings.long_running:type_name -> google.api.MethodSettings.LongRunning - 20, // 26: google.api.MethodSettings.LongRunning.initial_poll_delay:type_name -> google.protobuf.Duration - 20, // 27: google.api.MethodSettings.LongRunning.max_poll_delay:type_name -> google.protobuf.Duration - 20, // 28: google.api.MethodSettings.LongRunning.total_poll_timeout:type_name -> google.protobuf.Duration - 21, // 29: google.api.method_signature:extendee -> google.protobuf.MethodOptions - 22, // 30: google.api.default_host:extendee -> google.protobuf.ServiceOptions - 22, // 31: google.api.oauth_scopes:extendee -> google.protobuf.ServiceOptions - 22, // 32: google.api.api_version:extendee -> google.protobuf.ServiceOptions - 33, // [33:33] is the sub-list for method output_type - 33, // [33:33] is the sub-list for method input_type - 33, // [33:33] is the sub-list for extension type_name - 29, // [29:33] is the sub-list for extension extendee - 0, // [0:29] is the sub-list for field type_name + 14, // 1: google.api.CommonLanguageSettings.selective_gapic_generation:type_name -> google.api.SelectiveGapicGeneration + 21, // 2: google.api.ClientLibrarySettings.launch_stage:type_name -> google.api.LaunchStage + 5, // 3: google.api.ClientLibrarySettings.java_settings:type_name -> google.api.JavaSettings + 6, // 4: google.api.ClientLibrarySettings.cpp_settings:type_name -> google.api.CppSettings + 7, // 5: google.api.ClientLibrarySettings.php_settings:type_name -> google.api.PhpSettings + 8, // 6: google.api.ClientLibrarySettings.python_settings:type_name -> google.api.PythonSettings + 9, // 7: google.api.ClientLibrarySettings.node_settings:type_name -> google.api.NodeSettings + 10, // 8: google.api.ClientLibrarySettings.dotnet_settings:type_name -> google.api.DotnetSettings + 11, // 9: google.api.ClientLibrarySettings.ruby_settings:type_name -> google.api.RubySettings + 12, // 10: google.api.ClientLibrarySettings.go_settings:type_name -> google.api.GoSettings + 13, // 11: google.api.Publishing.method_settings:type_name -> google.api.MethodSettings + 0, // 12: google.api.Publishing.organization:type_name -> google.api.ClientLibraryOrganization + 3, // 13: google.api.Publishing.library_settings:type_name -> google.api.ClientLibrarySettings + 15, // 14: google.api.JavaSettings.service_class_names:type_name -> google.api.JavaSettings.ServiceClassNamesEntry + 2, // 15: google.api.JavaSettings.common:type_name -> google.api.CommonLanguageSettings + 2, // 16: google.api.CppSettings.common:type_name -> google.api.CommonLanguageSettings + 2, // 17: google.api.PhpSettings.common:type_name -> google.api.CommonLanguageSettings + 2, // 18: google.api.PythonSettings.common:type_name -> google.api.CommonLanguageSettings + 16, // 19: google.api.PythonSettings.experimental_features:type_name -> google.api.PythonSettings.ExperimentalFeatures + 2, // 20: google.api.NodeSettings.common:type_name -> google.api.CommonLanguageSettings + 2, // 21: google.api.DotnetSettings.common:type_name -> google.api.CommonLanguageSettings + 17, // 22: google.api.DotnetSettings.renamed_services:type_name -> google.api.DotnetSettings.RenamedServicesEntry + 18, // 23: google.api.DotnetSettings.renamed_resources:type_name -> google.api.DotnetSettings.RenamedResourcesEntry + 2, // 24: google.api.RubySettings.common:type_name -> google.api.CommonLanguageSettings + 2, // 25: google.api.GoSettings.common:type_name -> google.api.CommonLanguageSettings + 19, // 26: google.api.GoSettings.renamed_services:type_name -> google.api.GoSettings.RenamedServicesEntry + 20, // 27: google.api.MethodSettings.long_running:type_name -> google.api.MethodSettings.LongRunning + 22, // 28: google.api.MethodSettings.LongRunning.initial_poll_delay:type_name -> google.protobuf.Duration + 22, // 29: google.api.MethodSettings.LongRunning.max_poll_delay:type_name -> google.protobuf.Duration + 22, // 30: google.api.MethodSettings.LongRunning.total_poll_timeout:type_name -> google.protobuf.Duration + 23, // 31: google.api.method_signature:extendee -> google.protobuf.MethodOptions + 24, // 32: google.api.default_host:extendee -> google.protobuf.ServiceOptions + 24, // 33: google.api.oauth_scopes:extendee -> google.protobuf.ServiceOptions + 24, // 34: google.api.api_version:extendee -> google.protobuf.ServiceOptions + 35, // [35:35] is the sub-list for method output_type + 35, // [35:35] is the sub-list for method input_type + 35, // [35:35] is the sub-list for extension type_name + 31, // [31:35] is the sub-list for extension extendee + 0, // [0:31] is the sub-list for field type_name } func init() { file_google_api_client_proto_init() } @@ -1892,7 +2009,19 @@ func file_google_api_client_proto_init() { return nil } } - file_google_api_client_proto_msgTypes[13].Exporter = func(v interface{}, i int) interface{} { + file_google_api_client_proto_msgTypes[12].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*SelectiveGapicGeneration); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_google_api_client_proto_msgTypes[14].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*PythonSettings_ExperimentalFeatures); i { case 0: return &v.state @@ -1904,7 +2033,7 @@ func file_google_api_client_proto_init() { return nil } } - file_google_api_client_proto_msgTypes[16].Exporter = func(v interface{}, i int) interface{} { + file_google_api_client_proto_msgTypes[18].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*MethodSettings_LongRunning); i { case 0: return &v.state @@ -1923,7 +2052,7 @@ func file_google_api_client_proto_init() { GoPackagePath: reflect.TypeOf(x{}).PkgPath(), RawDescriptor: file_google_api_client_proto_rawDesc, NumEnums: 2, - NumMessages: 17, + NumMessages: 19, NumExtensions: 4, NumServices: 0, }, diff --git a/vendor/google.golang.org/genproto/googleapis/api/metric/metric.pb.go b/vendor/google.golang.org/genproto/googleapis/api/metric/metric.pb.go index d4b89c98d19b7..7f6e006cde312 100644 --- a/vendor/google.golang.org/genproto/googleapis/api/metric/metric.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/api/metric/metric.pb.go @@ -172,6 +172,63 @@ func (MetricDescriptor_ValueType) EnumDescriptor() ([]byte, []int) { return file_google_api_metric_proto_rawDescGZIP(), []int{0, 1} } +// The resource hierarchy level of the timeseries data of a metric. +type MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel int32 + +const ( + // Do not use this default value. + MetricDescriptor_MetricDescriptorMetadata_TIME_SERIES_RESOURCE_HIERARCHY_LEVEL_UNSPECIFIED MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel = 0 + // Scopes a metric to a project. + MetricDescriptor_MetricDescriptorMetadata_PROJECT MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel = 1 + // Scopes a metric to an organization. + MetricDescriptor_MetricDescriptorMetadata_ORGANIZATION MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel = 2 + // Scopes a metric to a folder. + MetricDescriptor_MetricDescriptorMetadata_FOLDER MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel = 3 +) + +// Enum value maps for MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel. +var ( + MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel_name = map[int32]string{ + 0: "TIME_SERIES_RESOURCE_HIERARCHY_LEVEL_UNSPECIFIED", + 1: "PROJECT", + 2: "ORGANIZATION", + 3: "FOLDER", + } + MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel_value = map[string]int32{ + "TIME_SERIES_RESOURCE_HIERARCHY_LEVEL_UNSPECIFIED": 0, + "PROJECT": 1, + "ORGANIZATION": 2, + "FOLDER": 3, + } +) + +func (x MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel) Enum() *MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel { + p := new(MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel) + *p = x + return p +} + +func (x MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel) String() string { + return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) +} + +func (MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel) Descriptor() protoreflect.EnumDescriptor { + return file_google_api_metric_proto_enumTypes[2].Descriptor() +} + +func (MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel) Type() protoreflect.EnumType { + return &file_google_api_metric_proto_enumTypes[2] +} + +func (x MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel) Number() protoreflect.EnumNumber { + return protoreflect.EnumNumber(x) +} + +// Deprecated: Use MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel.Descriptor instead. +func (MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel) EnumDescriptor() ([]byte, []int) { + return file_google_api_metric_proto_rawDescGZIP(), []int{0, 0, 0} +} + // Defines a metric type and its schema. Once a metric descriptor is created, // deleting or altering it stops data collection and makes the metric type's // existing data unusable. @@ -519,6 +576,8 @@ type MetricDescriptor_MetricDescriptorMetadata struct { // age are guaranteed to be ingested and available to be read, excluding // data loss due to errors. IngestDelay *durationpb.Duration `protobuf:"bytes,3,opt,name=ingest_delay,json=ingestDelay,proto3" json:"ingest_delay,omitempty"` + // The scope of the timeseries data of the metric. + TimeSeriesResourceHierarchyLevel []MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel `protobuf:"varint,4,rep,packed,name=time_series_resource_hierarchy_level,json=timeSeriesResourceHierarchyLevel,proto3,enum=google.api.MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel" json:"time_series_resource_hierarchy_level,omitempty"` } func (x *MetricDescriptor_MetricDescriptorMetadata) Reset() { @@ -575,6 +634,13 @@ func (x *MetricDescriptor_MetricDescriptorMetadata) GetIngestDelay() *durationpb return nil } +func (x *MetricDescriptor_MetricDescriptorMetadata) GetTimeSeriesResourceHierarchyLevel() []MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel { + if x != nil { + return x.TimeSeriesResourceHierarchyLevel + } + return nil +} + var File_google_api_metric_proto protoreflect.FileDescriptor var file_google_api_metric_proto_rawDesc = []byte{ @@ -585,7 +651,7 @@ var file_google_api_metric_proto_rawDesc = []byte{ 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x5f, 0x73, 0x74, 0x61, 0x67, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x1e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x64, 0x75, - 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0xc1, 0x07, 0x0a, + 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0xf0, 0x09, 0x0a, 0x10, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x12, 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, 0x18, 0x08, 0x20, @@ -620,7 +686,7 @@ var file_google_api_metric_proto_rawDesc = []byte{ 0x6f, 0x72, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x73, 0x18, 0x0d, 0x20, 0x03, 0x28, 0x09, 0x52, 0x16, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x54, 0x79, 0x70, 0x65, - 0x73, 0x1a, 0xd8, 0x01, 0x0a, 0x18, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, + 0x73, 0x1a, 0x87, 0x04, 0x0a, 0x18, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x12, 0x3e, 0x0a, 0x0c, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x5f, 0x73, 0x74, 0x61, 0x67, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x17, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, @@ -633,35 +699,54 @@ var file_google_api_metric_proto_rawDesc = []byte{ 0x0a, 0x0c, 0x69, 0x6e, 0x67, 0x65, 0x73, 0x74, 0x5f, 0x64, 0x65, 0x6c, 0x61, 0x79, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, - 0x0b, 0x69, 0x6e, 0x67, 0x65, 0x73, 0x74, 0x44, 0x65, 0x6c, 0x61, 0x79, 0x22, 0x4f, 0x0a, 0x0a, - 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x4b, 0x69, 0x6e, 0x64, 0x12, 0x1b, 0x0a, 0x17, 0x4d, 0x45, - 0x54, 0x52, 0x49, 0x43, 0x5f, 0x4b, 0x49, 0x4e, 0x44, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, - 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x09, 0x0a, 0x05, 0x47, 0x41, 0x55, 0x47, 0x45, - 0x10, 0x01, 0x12, 0x09, 0x0a, 0x05, 0x44, 0x45, 0x4c, 0x54, 0x41, 0x10, 0x02, 0x12, 0x0e, 0x0a, - 0x0a, 0x43, 0x55, 0x4d, 0x55, 0x4c, 0x41, 0x54, 0x49, 0x56, 0x45, 0x10, 0x03, 0x22, 0x71, 0x0a, - 0x09, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x54, 0x79, 0x70, 0x65, 0x12, 0x1a, 0x0a, 0x16, 0x56, 0x41, - 0x4c, 0x55, 0x45, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, - 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x08, 0x0a, 0x04, 0x42, 0x4f, 0x4f, 0x4c, 0x10, 0x01, - 0x12, 0x09, 0x0a, 0x05, 0x49, 0x4e, 0x54, 0x36, 0x34, 0x10, 0x02, 0x12, 0x0a, 0x0a, 0x06, 0x44, - 0x4f, 0x55, 0x42, 0x4c, 0x45, 0x10, 0x03, 0x12, 0x0a, 0x0a, 0x06, 0x53, 0x54, 0x52, 0x49, 0x4e, - 0x47, 0x10, 0x04, 0x12, 0x10, 0x0a, 0x0c, 0x44, 0x49, 0x53, 0x54, 0x52, 0x49, 0x42, 0x55, 0x54, - 0x49, 0x4f, 0x4e, 0x10, 0x05, 0x12, 0x09, 0x0a, 0x05, 0x4d, 0x4f, 0x4e, 0x45, 0x59, 0x10, 0x06, - 0x22, 0x8f, 0x01, 0x0a, 0x06, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x12, 0x12, 0x0a, 0x04, 0x74, - 0x79, 0x70, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, - 0x36, 0x0a, 0x06, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, - 0x1e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, - 0x72, 0x69, 0x63, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, - 0x06, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x1a, 0x39, 0x0a, 0x0b, 0x4c, 0x61, 0x62, 0x65, 0x6c, - 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, - 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, - 0x38, 0x01, 0x42, 0x5f, 0x0a, 0x0e, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x61, 0x70, 0x69, 0x42, 0x0b, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x50, 0x72, 0x6f, 0x74, - 0x6f, 0x50, 0x01, 0x5a, 0x37, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, - 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x65, 0x6e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x6d, - 0x65, 0x74, 0x72, 0x69, 0x63, 0x3b, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0xa2, 0x02, 0x04, 0x47, - 0x41, 0x50, 0x49, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x0b, 0x69, 0x6e, 0x67, 0x65, 0x73, 0x74, 0x44, 0x65, 0x6c, 0x61, 0x79, 0x12, 0xa6, 0x01, 0x0a, + 0x24, 0x74, 0x69, 0x6d, 0x65, 0x5f, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x5f, 0x72, 0x65, 0x73, + 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x68, 0x69, 0x65, 0x72, 0x61, 0x72, 0x63, 0x68, 0x79, 0x5f, + 0x6c, 0x65, 0x76, 0x65, 0x6c, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0e, 0x32, 0x56, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x44, + 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, + 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, + 0x74, 0x61, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x73, + 0x6f, 0x75, 0x72, 0x63, 0x65, 0x48, 0x69, 0x65, 0x72, 0x61, 0x72, 0x63, 0x68, 0x79, 0x4c, 0x65, + 0x76, 0x65, 0x6c, 0x52, 0x20, 0x74, 0x69, 0x6d, 0x65, 0x53, 0x65, 0x72, 0x69, 0x65, 0x73, 0x52, + 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x48, 0x69, 0x65, 0x72, 0x61, 0x72, 0x63, 0x68, 0x79, + 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x22, 0x83, 0x01, 0x0a, 0x20, 0x54, 0x69, 0x6d, 0x65, 0x53, 0x65, + 0x72, 0x69, 0x65, 0x73, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x48, 0x69, 0x65, 0x72, + 0x61, 0x72, 0x63, 0x68, 0x79, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x12, 0x34, 0x0a, 0x30, 0x54, 0x49, + 0x4d, 0x45, 0x5f, 0x53, 0x45, 0x52, 0x49, 0x45, 0x53, 0x5f, 0x52, 0x45, 0x53, 0x4f, 0x55, 0x52, + 0x43, 0x45, 0x5f, 0x48, 0x49, 0x45, 0x52, 0x41, 0x52, 0x43, 0x48, 0x59, 0x5f, 0x4c, 0x45, 0x56, + 0x45, 0x4c, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, + 0x12, 0x0b, 0x0a, 0x07, 0x50, 0x52, 0x4f, 0x4a, 0x45, 0x43, 0x54, 0x10, 0x01, 0x12, 0x10, 0x0a, + 0x0c, 0x4f, 0x52, 0x47, 0x41, 0x4e, 0x49, 0x5a, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x10, 0x02, 0x12, + 0x0a, 0x0a, 0x06, 0x46, 0x4f, 0x4c, 0x44, 0x45, 0x52, 0x10, 0x03, 0x22, 0x4f, 0x0a, 0x0a, 0x4d, + 0x65, 0x74, 0x72, 0x69, 0x63, 0x4b, 0x69, 0x6e, 0x64, 0x12, 0x1b, 0x0a, 0x17, 0x4d, 0x45, 0x54, + 0x52, 0x49, 0x43, 0x5f, 0x4b, 0x49, 0x4e, 0x44, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, + 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x09, 0x0a, 0x05, 0x47, 0x41, 0x55, 0x47, 0x45, 0x10, + 0x01, 0x12, 0x09, 0x0a, 0x05, 0x44, 0x45, 0x4c, 0x54, 0x41, 0x10, 0x02, 0x12, 0x0e, 0x0a, 0x0a, + 0x43, 0x55, 0x4d, 0x55, 0x4c, 0x41, 0x54, 0x49, 0x56, 0x45, 0x10, 0x03, 0x22, 0x71, 0x0a, 0x09, + 0x56, 0x61, 0x6c, 0x75, 0x65, 0x54, 0x79, 0x70, 0x65, 0x12, 0x1a, 0x0a, 0x16, 0x56, 0x41, 0x4c, + 0x55, 0x45, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, + 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x08, 0x0a, 0x04, 0x42, 0x4f, 0x4f, 0x4c, 0x10, 0x01, 0x12, + 0x09, 0x0a, 0x05, 0x49, 0x4e, 0x54, 0x36, 0x34, 0x10, 0x02, 0x12, 0x0a, 0x0a, 0x06, 0x44, 0x4f, + 0x55, 0x42, 0x4c, 0x45, 0x10, 0x03, 0x12, 0x0a, 0x0a, 0x06, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, + 0x10, 0x04, 0x12, 0x10, 0x0a, 0x0c, 0x44, 0x49, 0x53, 0x54, 0x52, 0x49, 0x42, 0x55, 0x54, 0x49, + 0x4f, 0x4e, 0x10, 0x05, 0x12, 0x09, 0x0a, 0x05, 0x4d, 0x4f, 0x4e, 0x45, 0x59, 0x10, 0x06, 0x22, + 0x8f, 0x01, 0x0a, 0x06, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x12, 0x12, 0x0a, 0x04, 0x74, 0x79, + 0x70, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, 0x36, + 0x0a, 0x06, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x1e, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x72, + 0x69, 0x63, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x06, + 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x73, 0x1a, 0x39, 0x0a, 0x0b, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x73, + 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, + 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, + 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, + 0x01, 0x42, 0x5f, 0x0a, 0x0e, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x61, 0x70, 0x69, 0x42, 0x0b, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, + 0x50, 0x01, 0x5a, 0x37, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, + 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x65, 0x6e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x6d, 0x65, + 0x74, 0x72, 0x69, 0x63, 0x3b, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0xa2, 0x02, 0x04, 0x47, 0x41, + 0x50, 0x49, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( @@ -676,34 +761,36 @@ func file_google_api_metric_proto_rawDescGZIP() []byte { return file_google_api_metric_proto_rawDescData } -var file_google_api_metric_proto_enumTypes = make([]protoimpl.EnumInfo, 2) +var file_google_api_metric_proto_enumTypes = make([]protoimpl.EnumInfo, 3) var file_google_api_metric_proto_msgTypes = make([]protoimpl.MessageInfo, 4) var file_google_api_metric_proto_goTypes = []interface{}{ - (MetricDescriptor_MetricKind)(0), // 0: google.api.MetricDescriptor.MetricKind - (MetricDescriptor_ValueType)(0), // 1: google.api.MetricDescriptor.ValueType - (*MetricDescriptor)(nil), // 2: google.api.MetricDescriptor - (*Metric)(nil), // 3: google.api.Metric - (*MetricDescriptor_MetricDescriptorMetadata)(nil), // 4: google.api.MetricDescriptor.MetricDescriptorMetadata - nil, // 5: google.api.Metric.LabelsEntry - (*label.LabelDescriptor)(nil), // 6: google.api.LabelDescriptor - (api.LaunchStage)(0), // 7: google.api.LaunchStage - (*durationpb.Duration)(nil), // 8: google.protobuf.Duration + (MetricDescriptor_MetricKind)(0), // 0: google.api.MetricDescriptor.MetricKind + (MetricDescriptor_ValueType)(0), // 1: google.api.MetricDescriptor.ValueType + (MetricDescriptor_MetricDescriptorMetadata_TimeSeriesResourceHierarchyLevel)(0), // 2: google.api.MetricDescriptor.MetricDescriptorMetadata.TimeSeriesResourceHierarchyLevel + (*MetricDescriptor)(nil), // 3: google.api.MetricDescriptor + (*Metric)(nil), // 4: google.api.Metric + (*MetricDescriptor_MetricDescriptorMetadata)(nil), // 5: google.api.MetricDescriptor.MetricDescriptorMetadata + nil, // 6: google.api.Metric.LabelsEntry + (*label.LabelDescriptor)(nil), // 7: google.api.LabelDescriptor + (api.LaunchStage)(0), // 8: google.api.LaunchStage + (*durationpb.Duration)(nil), // 9: google.protobuf.Duration } var file_google_api_metric_proto_depIdxs = []int32{ - 6, // 0: google.api.MetricDescriptor.labels:type_name -> google.api.LabelDescriptor - 0, // 1: google.api.MetricDescriptor.metric_kind:type_name -> google.api.MetricDescriptor.MetricKind - 1, // 2: google.api.MetricDescriptor.value_type:type_name -> google.api.MetricDescriptor.ValueType - 4, // 3: google.api.MetricDescriptor.metadata:type_name -> google.api.MetricDescriptor.MetricDescriptorMetadata - 7, // 4: google.api.MetricDescriptor.launch_stage:type_name -> google.api.LaunchStage - 5, // 5: google.api.Metric.labels:type_name -> google.api.Metric.LabelsEntry - 7, // 6: google.api.MetricDescriptor.MetricDescriptorMetadata.launch_stage:type_name -> google.api.LaunchStage - 8, // 7: google.api.MetricDescriptor.MetricDescriptorMetadata.sample_period:type_name -> google.protobuf.Duration - 8, // 8: google.api.MetricDescriptor.MetricDescriptorMetadata.ingest_delay:type_name -> google.protobuf.Duration - 9, // [9:9] is the sub-list for method output_type - 9, // [9:9] is the sub-list for method input_type - 9, // [9:9] is the sub-list for extension type_name - 9, // [9:9] is the sub-list for extension extendee - 0, // [0:9] is the sub-list for field type_name + 7, // 0: google.api.MetricDescriptor.labels:type_name -> google.api.LabelDescriptor + 0, // 1: google.api.MetricDescriptor.metric_kind:type_name -> google.api.MetricDescriptor.MetricKind + 1, // 2: google.api.MetricDescriptor.value_type:type_name -> google.api.MetricDescriptor.ValueType + 5, // 3: google.api.MetricDescriptor.metadata:type_name -> google.api.MetricDescriptor.MetricDescriptorMetadata + 8, // 4: google.api.MetricDescriptor.launch_stage:type_name -> google.api.LaunchStage + 6, // 5: google.api.Metric.labels:type_name -> google.api.Metric.LabelsEntry + 8, // 6: google.api.MetricDescriptor.MetricDescriptorMetadata.launch_stage:type_name -> google.api.LaunchStage + 9, // 7: google.api.MetricDescriptor.MetricDescriptorMetadata.sample_period:type_name -> google.protobuf.Duration + 9, // 8: google.api.MetricDescriptor.MetricDescriptorMetadata.ingest_delay:type_name -> google.protobuf.Duration + 2, // 9: google.api.MetricDescriptor.MetricDescriptorMetadata.time_series_resource_hierarchy_level:type_name -> google.api.MetricDescriptor.MetricDescriptorMetadata.TimeSeriesResourceHierarchyLevel + 10, // [10:10] is the sub-list for method output_type + 10, // [10:10] is the sub-list for method input_type + 10, // [10:10] is the sub-list for extension type_name + 10, // [10:10] is the sub-list for extension extendee + 0, // [0:10] is the sub-list for field type_name } func init() { file_google_api_metric_proto_init() } @@ -754,7 +841,7 @@ func file_google_api_metric_proto_init() { File: protoimpl.DescBuilder{ GoPackagePath: reflect.TypeOf(x{}).PkgPath(), RawDescriptor: file_google_api_metric_proto_rawDesc, - NumEnums: 2, + NumEnums: 3, NumMessages: 4, NumExtensions: 0, NumServices: 0, diff --git a/vendor/google.golang.org/genproto/googleapis/rpc/errdetails/error_details.pb.go b/vendor/google.golang.org/genproto/googleapis/rpc/errdetails/error_details.pb.go index 3e5621827921e..3cd9a5bb8e62b 100644 --- a/vendor/google.golang.org/genproto/googleapis/rpc/errdetails/error_details.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/rpc/errdetails/error_details.pb.go @@ -80,11 +80,12 @@ type ErrorInfo struct { Domain string `protobuf:"bytes,2,opt,name=domain,proto3" json:"domain,omitempty"` // Additional structured details about this error. // - // Keys should match /[a-zA-Z0-9-_]/ and be limited to 64 characters in + // Keys must match a regular expression of `[a-z][a-zA-Z0-9-_]+` but should + // ideally be lowerCamelCase. Also, they must be limited to 64 characters in // length. When identifying the current value of an exceeded limit, the units // should be contained in the key, not the value. For example, rather than - // {"instanceLimit": "100/request"}, should be returned as, - // {"instanceLimitPerRequest": "100"}, if the client exceeds the number of + // `{"instanceLimit": "100/request"}`, should be returned as, + // `{"instanceLimitPerRequest": "100"}`, if the client exceeds the number of // instances that can be created in a single (batch) request. Metadata map[string]string `protobuf:"bytes,3,rep,name=metadata,proto3" json:"metadata,omitempty" protobuf_key:"bytes,1,opt,name=key,proto3" protobuf_val:"bytes,2,opt,name=value,proto3"` } @@ -870,6 +871,16 @@ type BadRequest_FieldViolation struct { Field string `protobuf:"bytes,1,opt,name=field,proto3" json:"field,omitempty"` // A description of why the request element is bad. Description string `protobuf:"bytes,2,opt,name=description,proto3" json:"description,omitempty"` + // The reason of the field-level error. This is a constant value that + // identifies the proximate cause of the field-level error. It should + // uniquely identify the type of the FieldViolation within the scope of the + // google.rpc.ErrorInfo.domain. This should be at most 63 + // characters and match a regular expression of `[A-Z][A-Z0-9_]+[A-Z0-9]`, + // which represents UPPER_SNAKE_CASE. + Reason string `protobuf:"bytes,3,opt,name=reason,proto3" json:"reason,omitempty"` + // Provides a localized error message for field-level errors that is safe to + // return to the API consumer. + LocalizedMessage *LocalizedMessage `protobuf:"bytes,4,opt,name=localized_message,json=localizedMessage,proto3" json:"localized_message,omitempty"` } func (x *BadRequest_FieldViolation) Reset() { @@ -918,6 +929,20 @@ func (x *BadRequest_FieldViolation) GetDescription() string { return "" } +func (x *BadRequest_FieldViolation) GetReason() string { + if x != nil { + return x.Reason + } + return "" +} + +func (x *BadRequest_FieldViolation) GetLocalizedMessage() *LocalizedMessage { + if x != nil { + return x.LocalizedMessage + } + return nil +} + // Describes a URL link. type Help_Link struct { state protoimpl.MessageState @@ -1026,51 +1051,57 @@ var file_google_rpc_error_details_proto_rawDesc = []byte{ 0x07, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, - 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0xa8, 0x01, 0x0a, 0x0a, 0x42, 0x61, + 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x8c, 0x02, 0x0a, 0x0a, 0x42, 0x61, 0x64, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x50, 0x0a, 0x10, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x5f, 0x76, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x42, 0x61, 0x64, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0f, 0x66, 0x69, 0x65, 0x6c, 0x64, - 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x1a, 0x48, 0x0a, 0x0e, 0x46, 0x69, - 0x65, 0x6c, 0x64, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x14, 0x0a, 0x05, - 0x66, 0x69, 0x65, 0x6c, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x66, 0x69, 0x65, - 0x6c, 0x64, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, - 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x4f, 0x0a, 0x0b, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x49, - 0x6e, 0x66, 0x6f, 0x12, 0x1d, 0x0a, 0x0a, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x69, - 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, - 0x49, 0x64, 0x12, 0x21, 0x0a, 0x0c, 0x73, 0x65, 0x72, 0x76, 0x69, 0x6e, 0x67, 0x5f, 0x64, 0x61, - 0x74, 0x61, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x73, 0x65, 0x72, 0x76, 0x69, 0x6e, - 0x67, 0x44, 0x61, 0x74, 0x61, 0x22, 0x90, 0x01, 0x0a, 0x0c, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x23, 0x0a, 0x0d, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, - 0x63, 0x65, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x72, - 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x54, 0x79, 0x70, 0x65, 0x12, 0x23, 0x0a, 0x0d, 0x72, - 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x09, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x4e, 0x61, 0x6d, 0x65, - 0x12, 0x14, 0x0a, 0x05, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x05, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x6f, 0x0a, 0x04, 0x48, 0x65, 0x6c, 0x70, - 0x12, 0x2b, 0x0a, 0x05, 0x6c, 0x69, 0x6e, 0x6b, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, - 0x15, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x48, 0x65, 0x6c, - 0x70, 0x2e, 0x4c, 0x69, 0x6e, 0x6b, 0x52, 0x05, 0x6c, 0x69, 0x6e, 0x6b, 0x73, 0x1a, 0x3a, 0x0a, - 0x04, 0x4c, 0x69, 0x6e, 0x6b, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, - 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x10, 0x0a, 0x03, 0x75, 0x72, 0x6c, 0x18, 0x02, - 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x75, 0x72, 0x6c, 0x22, 0x44, 0x0a, 0x10, 0x4c, 0x6f, 0x63, - 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x64, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x12, 0x16, 0x0a, - 0x06, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x6c, - 0x6f, 0x63, 0x61, 0x6c, 0x65, 0x12, 0x18, 0x0a, 0x07, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, - 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x42, - 0x6c, 0x0a, 0x0e, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, - 0x63, 0x42, 0x11, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x44, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, 0x50, - 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x3f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, - 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x65, 0x6e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x2f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2f, 0x72, 0x70, - 0x63, 0x2f, 0x65, 0x72, 0x72, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, 0x3b, 0x65, 0x72, 0x72, - 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, 0xa2, 0x02, 0x03, 0x52, 0x50, 0x43, 0x62, 0x06, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x1a, 0xab, 0x01, 0x0a, 0x0e, 0x46, + 0x69, 0x65, 0x6c, 0x64, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x14, 0x0a, + 0x05, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x66, 0x69, + 0x65, 0x6c, 0x64, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, + 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, + 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x16, 0x0a, 0x06, 0x72, 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x18, + 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x72, 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x12, 0x49, 0x0a, + 0x11, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x64, 0x5f, 0x6d, 0x65, 0x73, 0x73, 0x61, + 0x67, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x4c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x64, 0x4d, + 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x52, 0x10, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x7a, 0x65, + 0x64, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x22, 0x4f, 0x0a, 0x0b, 0x52, 0x65, 0x71, 0x75, + 0x65, 0x73, 0x74, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x1d, 0x0a, 0x0a, 0x72, 0x65, 0x71, 0x75, 0x65, + 0x73, 0x74, 0x5f, 0x69, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x72, 0x65, 0x71, + 0x75, 0x65, 0x73, 0x74, 0x49, 0x64, 0x12, 0x21, 0x0a, 0x0c, 0x73, 0x65, 0x72, 0x76, 0x69, 0x6e, + 0x67, 0x5f, 0x64, 0x61, 0x74, 0x61, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x73, 0x65, + 0x72, 0x76, 0x69, 0x6e, 0x67, 0x44, 0x61, 0x74, 0x61, 0x22, 0x90, 0x01, 0x0a, 0x0c, 0x52, 0x65, + 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x23, 0x0a, 0x0d, 0x72, 0x65, + 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x54, 0x79, 0x70, 0x65, 0x12, + 0x23, 0x0a, 0x0d, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x6e, 0x61, 0x6d, 0x65, + 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, + 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x18, 0x03, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x05, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, + 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x6f, 0x0a, 0x04, + 0x48, 0x65, 0x6c, 0x70, 0x12, 0x2b, 0x0a, 0x05, 0x6c, 0x69, 0x6e, 0x6b, 0x73, 0x18, 0x01, 0x20, + 0x03, 0x28, 0x0b, 0x32, 0x15, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, + 0x2e, 0x48, 0x65, 0x6c, 0x70, 0x2e, 0x4c, 0x69, 0x6e, 0x6b, 0x52, 0x05, 0x6c, 0x69, 0x6e, 0x6b, + 0x73, 0x1a, 0x3a, 0x0a, 0x04, 0x4c, 0x69, 0x6e, 0x6b, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, + 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, + 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x10, 0x0a, 0x03, 0x75, + 0x72, 0x6c, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x75, 0x72, 0x6c, 0x22, 0x44, 0x0a, + 0x10, 0x4c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x64, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, + 0x65, 0x12, 0x16, 0x0a, 0x06, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x06, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x65, 0x12, 0x18, 0x0a, 0x07, 0x6d, 0x65, 0x73, + 0x73, 0x61, 0x67, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x6d, 0x65, 0x73, 0x73, + 0x61, 0x67, 0x65, 0x42, 0x6c, 0x0a, 0x0e, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x72, 0x70, 0x63, 0x42, 0x11, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x44, 0x65, 0x74, 0x61, + 0x69, 0x6c, 0x73, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x3f, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x65, + 0x6e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, + 0x73, 0x2f, 0x72, 0x70, 0x63, 0x2f, 0x65, 0x72, 0x72, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, + 0x3b, 0x65, 0x72, 0x72, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, 0xa2, 0x02, 0x03, 0x52, 0x50, + 0x43, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( @@ -1111,11 +1142,12 @@ var file_google_rpc_error_details_proto_depIdxs = []int32{ 12, // 3: google.rpc.PreconditionFailure.violations:type_name -> google.rpc.PreconditionFailure.Violation 13, // 4: google.rpc.BadRequest.field_violations:type_name -> google.rpc.BadRequest.FieldViolation 14, // 5: google.rpc.Help.links:type_name -> google.rpc.Help.Link - 6, // [6:6] is the sub-list for method output_type - 6, // [6:6] is the sub-list for method input_type - 6, // [6:6] is the sub-list for extension type_name - 6, // [6:6] is the sub-list for extension extendee - 0, // [0:6] is the sub-list for field type_name + 9, // 6: google.rpc.BadRequest.FieldViolation.localized_message:type_name -> google.rpc.LocalizedMessage + 7, // [7:7] is the sub-list for method output_type + 7, // [7:7] is the sub-list for method input_type + 7, // [7:7] is the sub-list for extension type_name + 7, // [7:7] is the sub-list for extension extendee + 0, // [0:7] is the sub-list for field type_name } func init() { file_google_rpc_error_details_proto_init() } diff --git a/vendor/google.golang.org/genproto/googleapis/type/timeofday/timeofday.pb.go b/vendor/google.golang.org/genproto/googleapis/type/timeofday/timeofday.pb.go new file mode 100644 index 0000000000000..a8a3108a0592d --- /dev/null +++ b/vendor/google.golang.org/genproto/googleapis/type/timeofday/timeofday.pb.go @@ -0,0 +1,202 @@ +// Copyright 2024 Google LLC +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +// Code generated by protoc-gen-go. DO NOT EDIT. +// versions: +// protoc-gen-go v1.26.0 +// protoc v4.24.4 +// source: google/type/timeofday.proto + +package timeofday + +import ( + reflect "reflect" + sync "sync" + + protoreflect "google.golang.org/protobuf/reflect/protoreflect" + protoimpl "google.golang.org/protobuf/runtime/protoimpl" +) + +const ( + // Verify that this generated code is sufficiently up-to-date. + _ = protoimpl.EnforceVersion(20 - protoimpl.MinVersion) + // Verify that runtime/protoimpl is sufficiently up-to-date. + _ = protoimpl.EnforceVersion(protoimpl.MaxVersion - 20) +) + +// Represents a time of day. The date and time zone are either not significant +// or are specified elsewhere. An API may choose to allow leap seconds. Related +// types are [google.type.Date][google.type.Date] and +// `google.protobuf.Timestamp`. +type TimeOfDay struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Hours of day in 24 hour format. Should be from 0 to 23. An API may choose + // to allow the value "24:00:00" for scenarios like business closing time. + Hours int32 `protobuf:"varint,1,opt,name=hours,proto3" json:"hours,omitempty"` + // Minutes of hour of day. Must be from 0 to 59. + Minutes int32 `protobuf:"varint,2,opt,name=minutes,proto3" json:"minutes,omitempty"` + // Seconds of minutes of the time. Must normally be from 0 to 59. An API may + // allow the value 60 if it allows leap-seconds. + Seconds int32 `protobuf:"varint,3,opt,name=seconds,proto3" json:"seconds,omitempty"` + // Fractions of seconds in nanoseconds. Must be from 0 to 999,999,999. + Nanos int32 `protobuf:"varint,4,opt,name=nanos,proto3" json:"nanos,omitempty"` +} + +func (x *TimeOfDay) Reset() { + *x = TimeOfDay{} + if protoimpl.UnsafeEnabled { + mi := &file_google_type_timeofday_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *TimeOfDay) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*TimeOfDay) ProtoMessage() {} + +func (x *TimeOfDay) ProtoReflect() protoreflect.Message { + mi := &file_google_type_timeofday_proto_msgTypes[0] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use TimeOfDay.ProtoReflect.Descriptor instead. +func (*TimeOfDay) Descriptor() ([]byte, []int) { + return file_google_type_timeofday_proto_rawDescGZIP(), []int{0} +} + +func (x *TimeOfDay) GetHours() int32 { + if x != nil { + return x.Hours + } + return 0 +} + +func (x *TimeOfDay) GetMinutes() int32 { + if x != nil { + return x.Minutes + } + return 0 +} + +func (x *TimeOfDay) GetSeconds() int32 { + if x != nil { + return x.Seconds + } + return 0 +} + +func (x *TimeOfDay) GetNanos() int32 { + if x != nil { + return x.Nanos + } + return 0 +} + +var File_google_type_timeofday_proto protoreflect.FileDescriptor + +var file_google_type_timeofday_proto_rawDesc = []byte{ + 0x0a, 0x1b, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x74, 0x79, 0x70, 0x65, 0x2f, 0x74, 0x69, + 0x6d, 0x65, 0x6f, 0x66, 0x64, 0x61, 0x79, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x0b, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x22, 0x6b, 0x0a, 0x09, 0x54, 0x69, + 0x6d, 0x65, 0x4f, 0x66, 0x44, 0x61, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x68, 0x6f, 0x75, 0x72, 0x73, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x05, 0x68, 0x6f, 0x75, 0x72, 0x73, 0x12, 0x18, 0x0a, + 0x07, 0x6d, 0x69, 0x6e, 0x75, 0x74, 0x65, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x07, + 0x6d, 0x69, 0x6e, 0x75, 0x74, 0x65, 0x73, 0x12, 0x18, 0x0a, 0x07, 0x73, 0x65, 0x63, 0x6f, 0x6e, + 0x64, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x05, 0x52, 0x07, 0x73, 0x65, 0x63, 0x6f, 0x6e, 0x64, + 0x73, 0x12, 0x14, 0x0a, 0x05, 0x6e, 0x61, 0x6e, 0x6f, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, 0x05, + 0x52, 0x05, 0x6e, 0x61, 0x6e, 0x6f, 0x73, 0x42, 0x6c, 0x0a, 0x0f, 0x63, 0x6f, 0x6d, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x42, 0x0e, 0x54, 0x69, 0x6d, 0x65, + 0x4f, 0x66, 0x44, 0x61, 0x79, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x3e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, + 0x67, 0x65, 0x6e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, + 0x70, 0x69, 0x73, 0x2f, 0x74, 0x79, 0x70, 0x65, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x66, 0x64, + 0x61, 0x79, 0x3b, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x66, 0x64, 0x61, 0x79, 0xf8, 0x01, 0x01, 0xa2, + 0x02, 0x03, 0x47, 0x54, 0x50, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, +} + +var ( + file_google_type_timeofday_proto_rawDescOnce sync.Once + file_google_type_timeofday_proto_rawDescData = file_google_type_timeofday_proto_rawDesc +) + +func file_google_type_timeofday_proto_rawDescGZIP() []byte { + file_google_type_timeofday_proto_rawDescOnce.Do(func() { + file_google_type_timeofday_proto_rawDescData = protoimpl.X.CompressGZIP(file_google_type_timeofday_proto_rawDescData) + }) + return file_google_type_timeofday_proto_rawDescData +} + +var file_google_type_timeofday_proto_msgTypes = make([]protoimpl.MessageInfo, 1) +var file_google_type_timeofday_proto_goTypes = []interface{}{ + (*TimeOfDay)(nil), // 0: google.type.TimeOfDay +} +var file_google_type_timeofday_proto_depIdxs = []int32{ + 0, // [0:0] is the sub-list for method output_type + 0, // [0:0] is the sub-list for method input_type + 0, // [0:0] is the sub-list for extension type_name + 0, // [0:0] is the sub-list for extension extendee + 0, // [0:0] is the sub-list for field type_name +} + +func init() { file_google_type_timeofday_proto_init() } +func file_google_type_timeofday_proto_init() { + if File_google_type_timeofday_proto != nil { + return + } + if !protoimpl.UnsafeEnabled { + file_google_type_timeofday_proto_msgTypes[0].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*TimeOfDay); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + } + type x struct{} + out := protoimpl.TypeBuilder{ + File: protoimpl.DescBuilder{ + GoPackagePath: reflect.TypeOf(x{}).PkgPath(), + RawDescriptor: file_google_type_timeofday_proto_rawDesc, + NumEnums: 0, + NumMessages: 1, + NumExtensions: 0, + NumServices: 0, + }, + GoTypes: file_google_type_timeofday_proto_goTypes, + DependencyIndexes: file_google_type_timeofday_proto_depIdxs, + MessageInfos: file_google_type_timeofday_proto_msgTypes, + }.Build() + File_google_type_timeofday_proto = out.File + file_google_type_timeofday_proto_rawDesc = nil + file_google_type_timeofday_proto_goTypes = nil + file_google_type_timeofday_proto_depIdxs = nil +} diff --git a/vendor/modules.txt b/vendor/modules.txt index bf14fd4052559..6e1ae6e645598 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -1,5 +1,5 @@ -# cel.dev/expr v0.16.1 -## explicit; go 1.18 +# cel.dev/expr v0.19.1 +## explicit; go 1.21.1 cel.dev/expr # cloud.google.com/go v0.117.0 ## explicit; go 1.21 @@ -50,7 +50,7 @@ cloud.google.com/go/iam/apiv1/iampb cloud.google.com/go/longrunning cloud.google.com/go/longrunning/autogen cloud.google.com/go/longrunning/autogen/longrunningpb -# cloud.google.com/go/monitoring v1.21.2 +# cloud.google.com/go/monitoring v1.22.1 ## explicit; go 1.21 cloud.google.com/go/monitoring/apiv3/v2 cloud.google.com/go/monitoring/apiv3/v2/monitoringpb @@ -212,11 +212,11 @@ github.com/DmitriyVTitov/size # github.com/GoogleCloudPlatform/opentelemetry-operations-go/detectors/gcp v1.25.0 ## explicit; go 1.21 github.com/GoogleCloudPlatform/opentelemetry-operations-go/detectors/gcp -# github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric v0.48.1 -## explicit; go 1.21 +# github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric v0.49.0 +## explicit; go 1.22 github.com/GoogleCloudPlatform/opentelemetry-operations-go/exporter/metric -# github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping v0.48.1 -## explicit; go 1.21 +# github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping v0.49.0 +## explicit; go 1.22 github.com/GoogleCloudPlatform/opentelemetry-operations-go/internal/resourcemapping # github.com/IBM/go-sdk-core/v5 v5.18.3 ## explicit; go 1.21 @@ -516,14 +516,10 @@ github.com/buger/jsonparser # github.com/c2h5oh/datasize v0.0.0-20231215233829-aa82cc1e6500 ## explicit github.com/c2h5oh/datasize -# github.com/census-instrumentation/opencensus-proto v0.4.1 -## explicit; go 1.18 -github.com/census-instrumentation/opencensus-proto/gen-go/resource/v1 -github.com/census-instrumentation/opencensus-proto/gen-go/trace/v1 # github.com/cespare/xxhash/v2 v2.3.0 ## explicit; go 1.11 github.com/cespare/xxhash/v2 -# github.com/cncf/xds/go v0.0.0-20240905190251-b4127c9b8d78 +# github.com/cncf/xds/go v0.0.0-20241223141626-cff3c89139a3 ## explicit; go 1.19 github.com/cncf/xds/go/udpa/annotations github.com/cncf/xds/go/udpa/type/v1 @@ -685,7 +681,7 @@ github.com/efficientgo/core/testutil/internal ## explicit; go 1.13 github.com/emicklei/go-restful/v3 github.com/emicklei/go-restful/v3/log -# github.com/envoyproxy/go-control-plane v0.13.1 +# github.com/envoyproxy/go-control-plane/envoy v1.32.2 ## explicit; go 1.21 github.com/envoyproxy/go-control-plane/envoy/admin/v3 github.com/envoyproxy/go-control-plane/envoy/annotations @@ -725,6 +721,8 @@ github.com/envoyproxy/go-control-plane/envoy/type/matcher/v3 github.com/envoyproxy/go-control-plane/envoy/type/metadata/v3 github.com/envoyproxy/go-control-plane/envoy/type/tracing/v3 github.com/envoyproxy/go-control-plane/envoy/type/v3 +# github.com/envoyproxy/go-control-plane/ratelimit v0.1.0 +## explicit; go 1.21 # github.com/envoyproxy/protoc-gen-validate v1.1.0 ## explicit; go 1.19 github.com/envoyproxy/protoc-gen-validate/validate @@ -747,8 +745,8 @@ github.com/fluent/fluent-bit-go/output ## explicit; go 1.17 github.com/fsnotify/fsnotify github.com/fsnotify/fsnotify/internal -# github.com/fsouza/fake-gcs-server v1.50.2 -## explicit; go 1.22 +# github.com/fsouza/fake-gcs-server v1.51.0 +## explicit; go 1.22.9 github.com/fsouza/fake-gcs-server/fakestorage github.com/fsouza/fake-gcs-server/internal/backend github.com/fsouza/fake-gcs-server/internal/checksum @@ -839,7 +837,7 @@ github.com/go-redsync/redsync/v4/redis/goredis/v9 # github.com/go-zookeeper/zk v1.0.3 ## explicit; go 1.13 github.com/go-zookeeper/zk -# github.com/goccy/go-json v0.10.3 +# github.com/goccy/go-json v0.10.4 ## explicit; go 1.19 github.com/goccy/go-json github.com/goccy/go-json/internal/decoder @@ -1215,8 +1213,8 @@ github.com/klauspost/compress/snappy github.com/klauspost/compress/zlib github.com/klauspost/compress/zstd github.com/klauspost/compress/zstd/internal/xxhash -# github.com/klauspost/cpuid/v2 v2.2.8 -## explicit; go 1.15 +# github.com/klauspost/cpuid/v2 v2.2.9 +## explicit; go 1.20 github.com/klauspost/cpuid/v2 # github.com/klauspost/pgzip v1.2.6 ## explicit @@ -1803,15 +1801,15 @@ go.opentelemetry.io/collector/pdata/pmetric/pmetricotlp # go.opentelemetry.io/collector/semconv v0.108.1 ## explicit; go 1.22.0 go.opentelemetry.io/collector/semconv/v1.6.1 -# go.opentelemetry.io/contrib/detectors/gcp v1.29.0 -## explicit; go 1.21 +# go.opentelemetry.io/contrib/detectors/gcp v1.33.0 +## explicit; go 1.22.0 go.opentelemetry.io/contrib/detectors/gcp -# go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.54.0 -## explicit; go 1.21 +# go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.58.0 +## explicit; go 1.22.7 go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/internal -# go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.54.0 -## explicit; go 1.21 +# go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.58.0 +## explicit; go 1.22.0 go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/request go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv @@ -1838,18 +1836,18 @@ go.opentelemetry.io/otel/semconv/v1.26.0 go.opentelemetry.io/otel/metric go.opentelemetry.io/otel/metric/embedded go.opentelemetry.io/otel/metric/noop -# go.opentelemetry.io/otel/sdk v1.29.0 -## explicit; go 1.21 +# go.opentelemetry.io/otel/sdk v1.33.0 +## explicit; go 1.22.0 go.opentelemetry.io/otel/sdk go.opentelemetry.io/otel/sdk/instrumentation go.opentelemetry.io/otel/sdk/internal/x go.opentelemetry.io/otel/sdk/resource -# go.opentelemetry.io/otel/sdk/metric v1.29.0 -## explicit; go 1.21 +# go.opentelemetry.io/otel/sdk/metric v1.33.0 +## explicit; go 1.22.0 go.opentelemetry.io/otel/sdk/metric +go.opentelemetry.io/otel/sdk/metric/exemplar go.opentelemetry.io/otel/sdk/metric/internal go.opentelemetry.io/otel/sdk/metric/internal/aggregate -go.opentelemetry.io/otel/sdk/metric/internal/exemplar go.opentelemetry.io/otel/sdk/metric/internal/x go.opentelemetry.io/otel/sdk/metric/metricdata # go.opentelemetry.io/otel/trace v1.33.0 @@ -2030,9 +2028,10 @@ google.golang.org/api/transport/http google.golang.org/genproto/googleapis/type/calendarperiod google.golang.org/genproto/googleapis/type/date google.golang.org/genproto/googleapis/type/expr +google.golang.org/genproto/googleapis/type/timeofday google.golang.org/genproto/protobuf/api -# google.golang.org/genproto/googleapis/api v0.0.0-20241118233622-e639e219e697 -## explicit; go 1.21 +# google.golang.org/genproto/googleapis/api v0.0.0-20250102185135-69823020774d +## explicit; go 1.22 google.golang.org/genproto/googleapis/api google.golang.org/genproto/googleapis/api/annotations google.golang.org/genproto/googleapis/api/distribution @@ -2040,8 +2039,8 @@ google.golang.org/genproto/googleapis/api/expr/v1alpha1 google.golang.org/genproto/googleapis/api/label google.golang.org/genproto/googleapis/api/metric google.golang.org/genproto/googleapis/api/monitoredres -# google.golang.org/genproto/googleapis/rpc v0.0.0-20241209162323-e6fa225c2576 -## explicit; go 1.21 +# google.golang.org/genproto/googleapis/rpc v0.0.0-20250102185135-69823020774d +## explicit; go 1.22 google.golang.org/genproto/googleapis/rpc/code google.golang.org/genproto/googleapis/rpc/errdetails google.golang.org/genproto/googleapis/rpc/status @@ -2180,8 +2179,8 @@ google.golang.org/grpc/xds/internal/xdsclient/xdslbregistry google.golang.org/grpc/xds/internal/xdsclient/xdslbregistry/converter google.golang.org/grpc/xds/internal/xdsclient/xdsresource google.golang.org/grpc/xds/internal/xdsclient/xdsresource/version -# google.golang.org/grpc/stats/opentelemetry v0.0.0-20240907200651-3ffb98b2c93a -## explicit; go 1.21 +# google.golang.org/grpc/stats/opentelemetry v0.0.0-20241028142157-ada6787961b3 +## explicit; go 1.22.7 google.golang.org/grpc/stats/opentelemetry google.golang.org/grpc/stats/opentelemetry/internal # google.golang.org/protobuf v1.36.2